| === bon_ [n=bon@82-41-231-23.cable.ubr08.edin.blueyonder.co.uk] has joined #ubuntu | ||
| === bajek [n=bajek@btm198.neoplus.adsl.tpnet.pl] has joined #ubuntu | ||
| crimsun | rekrutacja: I'm busy atm but will read it in 5 minutes | 12:00 |
|---|---|---|
| DUMAiSO | !br | 12:00 |
| ubotu | Por favor use #ubuntu-br (/j #ubuntu-br) para ajuda em portugues. Obrigada. | 12:00 |
| unL33Tn00b | Anyone know what an error about direct rendering not being enabled for Boson? (I think it's kgame related) | 12:00 |
| bon_ | redwolf: it wount let me login | 12:00 |
| ralpho | anyone get kaffeine to work on xm radio web site | 12:00 |
| niki | is there an easier way to install GTK+ libraries than doing it from their website? i keep getting errors when i try to make... | 12:00 |
| redwolf | bon_: eww | 12:00 |
| rekrutacja | crimsun, ok will wait | 12:00 |
| polpak | pulver, you can also try nvu | 12:00 |
| redwolf | bon_: this shouldn't be this hard, for reference | 12:01 |
| === theSamo [n=samo@84.36.12.59] has joined #ubuntu | ||
| ATIpro | ubotu, ubuntu-es es una mierda, nadie te hace caso y se la pasan hablando le juegos no les interesa ayudar, vengo de ahi ! | 12:01 |
| ubotu | ATIpro: I'm sorry, i don't know what you're talking about | 12:01 |
| polpak | niki, eh.. I'm pretty sure they're installed already | 12:01 |
| redwolf | bon_: pastebin your /etc/fstab again | 12:01 |
| polpak | niki, or are you wanting the developer libreries | 12:01 |
| unL33Tn00b | !direct rendering | 12:01 |
| ubotu | No idea, try searching at http://ubuntu.cc.com.au/, unL33Tn00b | 12:01 |
| bon_ | redwolf: yeah | 12:01 |
| ATIpro | hello ! somebody can help me ? | 12:01 |
| redwolf | bon_: in it's current state | 12:01 |
| polpak | ATIpro, ubotu is a bot | 12:01 |
| === astral_cyborg [i=astralsd@ppp83-adsl-160.ath.forthnet.gr] has left #ubuntu [] | ||
| bon_ | redwolf: i had to delte the last line to login | 12:01 |
| redwolf | bon_: really? | 12:01 |
| pulver | polpak, yea but would give the tool to someone computer illiterate person and nvu has a lot of options | 12:01 |
| polpak | ATIpro, if you need help in spanish you'll have to ask in ubuntu-es, or you can ask here, in english | 12:02 |
| bon_ | yeah | 12:02 |
| redwolf | bon_: the line about the /home/bon? | 12:02 |
| niki | polpak, i am just trying to get gtuxnes to run, and it requires gtk+ libs... | 12:02 |
| blacknight | ATIpro, what is the problem? | 12:02 |
| === sfaris [n=email@36.varbergkabel-net01c.varberg.net] has joined #ubuntu | ||
| polpak | niki, what's the error you get? | 12:02 |
| bon_ | yeah | 12:02 |
| ATIpro | Blacknight my problem is with my video card | 12:03 |
| redwolf | bon_: wow, I'm impressed | 12:03 |
| lkdfre | b | 12:03 |
| niki | polpak, i get a LOT of them when i try to 'make' in the gtuxnes dir | 12:03 |
| blacknight | ATIpro, ok. What is the problem? | 12:03 |
| polpak | pulver, I'd recommend building a web framework (using php or somesuch) and just make a nice UI for controlling it with mysql. | 12:03 |
| redwolf | bon_: umm, try mounting it to a different directory temporarily | 12:03 |
| === sanpera [n=johnny@157.182.195.191] has left #ubuntu [] | ||
| redwolf | bon_: like instead of /home/bon, do /bon | 12:03 |
| unL33Tn00b | Anybody have any clue what "direct Rendering" means (incontext of it not being enabled)? | 12:03 |
| polpak | pulver, cause computer illiterate people shouldn't be making changes to websites directly | 12:03 |
| redwolf | change it in /etc/fstab and mkdir /bon | 12:03 |
| polpak | niki, one sec | 12:04 |
| bon_ | right | 12:04 |
| redwolf | bon_: if it mounts automatically like that, let me know | 12:04 |
| ATIpro | I've a ATI X600se and yesterday I was intalled the last driver and when I wanted make a reboot after my pc was died now I can't see someting | 12:04 |
| pulver | polpak, yes you are probably right | 12:04 |
| redwolf | bon_: I have an idea | 12:04 |
| === khisanth_ [n=andy@216.206.235.214] has left #ubuntu ["Leaving"] | ||
| polpak | niki, ok.. the problem is you need the development libs | 12:04 |
| UsefuLldiot | whats the command again to use apt to update to latest dapper release? | 12:05 |
| === LKRaider [n=LKRaider@200.247.157.198] has joined #ubuntu | ||
| === Sergi0 [n=serge@ip227-28-166-62.adsl.versatel.nl] has joined #ubuntu | ||
| ralpho | got to love ati vesa solution | 12:05 |
| arrick | how to open a html file from terminal? | 12:05 |
| tristanmike | !tell UsefuLldiot about upgrade | 12:05 |
| unL33Tn00b | Anybody have any clue what "direct Rendering" means (incontext of it not being enabled)? | 12:05 |
| niki | polpak, how do i get these? | 12:05 |
| bon_ | redwolf: /dev/hda5/bonext3 defaults,auto.noatime,rw,user 0 0 | 12:05 |
| polpak | niki, with apt.. | 12:05 |
| polpak | niki, one sec | 12:06 |
| redwolf | bon_: go for it | 12:06 |
| ATIpro | that is my problem I want install the correct driver but I tired to read because all the time when I want try i have problems an now i can not see nothing | 12:06 |
| === dumezil_ [n=charlie@12-222-208-206.client.insightBB.com] has joined #ubuntu | ||
| Blippe | arrick with lynx | 12:06 |
| LKRaider | arrick: or elinks | 12:06 |
| arrick | hows that Blippe? | 12:06 |
| arrick | ok, how | 12:06 |
| TSCHAK | arrick, lynx file.html | 12:06 |
| arrick | ok | 12:06 |
| TSCHAK | arrick, or lynx url | 12:06 |
| ATIpro | are you there blaknight ? | 12:06 |
| === bill__ [n=bill@cpe-72-134-66-177.socal.res.rr.com] has joined #ubuntu | ||
| LKRaider | arrick: apt-get lynx or elinks first | 12:06 |
| arrick | ok | 12:07 |
| unL33Tn00b | Anybody played called Boson before? | 12:07 |
| === maximuz [i=maximuz@200.7.26.19] has joined #ubuntu | ||
| unL33Tn00b | *game | 12:07 |
| Blippe | or lynx, wait until the program starts, press g and then type the adress | 12:07 |
| kbrooks | @ everyone: e-mail: kyle@kbrooks.ath.cx | 12:07 |
| === bill__ is now known as LathropWells | ||
| arrick | ok | 12:08 |
| TSCHAK | kbrooks, that's never a good idea, somebody in here could be a spammer. | 12:08 |
| === kevin [n=kevin@204.83.37.121] has joined #ubuntu | ||
| === zerokarmaleft [n=zerokarm@ip68-12-45-133.ok.ok.cox.net] has joined #ubuntu | ||
| polpak | niki, sudo apt-get install build-essential libgtk1.2-dev libgtk2.0-dev | 12:08 |
| ATIpro | blacknight all the week I was readed the ubuntuforums but I still with problems ! | 12:08 |
| kbrooks | TSCHAK, i always junk away spam mail | 12:08 |
| TSCHAK | kbrooks, ok | 12:08 |
| blacknight | ATIpro, which graphics card | 12:08 |
| blacknight | ATIpro, if you want my attention use my nick - I won't see you otherwise :) | 12:08 |
| === Steve^ [n=Steve@host-138-38-238-109.nat.bath.ac.uk] has joined #ubuntu | ||
| niki | polpak, ok, doing...thanks! | 12:09 |
| TSCHAK | I'm really confused as to why my nvidia card isn't allowing doublescan modes | 12:09 |
| === Firebird8 [n=FireGFX@pool-138-88-210-251.res.east.verizon.net] has left #ubuntu ["heh"] | ||
| unL33Tn00b | Is there a forum for low priority help request such as help with getting a game to work? | 12:09 |
| LathropWells | i found a nice trick a month ago USE A DISPOSABLE mailing address like mailinator.com | 12:09 |
| ralpho | he said X600se ati | 12:09 |
| polpak | unL33Tn00b, this is it.. or you can try with the game developer's directly | 12:09 |
| kevin | I have a linux client and a linux server, how do I set the client to log into the server instead of itself? | 12:09 |
| crimsun | rekrutacja: amixer sset 'PCM' on && amixer sset 'PCM' 28 | 12:09 |
| === bon_ [n=bon@82-41-231-23.cable.ubr08.edin.blueyonder.co.uk] has joined #ubuntu | ||
| polpak | unL33Tn00b, we support all things ubutnu, and some that's not | 12:09 |
| blacknight | ATIpro, what's the issue? | 12:09 |
| arrick | hey TSCHAK,, how do I rename a folder to see it on the desktop again? | 12:10 |
| redwolf | bon_: work? | 12:10 |
| polpak | kevin, what kind of "client" | 12:10 |
| unL33Tn00b | polpak Alright. Know anything about Kgames? Or Boson? Or what direct rendering (which I need to enable but don't know how) is? | 12:10 |
| rekrutacja | crimsun, this is too fast for i'm not that advanced. how to set amixer? | 12:10 |
| ATIpro | ok I have this ! ATI X600 256MG X600SE RADEON | 12:10 |
| === Fanskapet [n=tommy@81-233-197-124-no88.tbcn.telia.com] has joined #ubuntu | ||
| crimsun | rekrutacja: type exactly what I gave you in a Terminal | 12:10 |
| === prxq_ [n=prxq@145.120.1.185] has joined #ubuntu | ||
| bon_ | redwolf: well it booted | 12:10 |
| polpak | unL33Tn00b, direct rendering means your video card is doing the display work, not your CPU | 12:10 |
| === dv_ [n=dv@M1124P029.adsl.highway.telekom.at] has joined #ubuntu | ||
| polpak | unL33Tn00b, what kind of video card do you have? | 12:11 |
| redwolf | bon_: can you mount and/or access /bon | 12:11 |
| rekrutacja | crimsun, done | 12:11 |
| clever | what do i have to do to get lirc to work on ubuntu? | 12:11 |
| === nismo [n=nismo@pool-138-89-73-244.mad.east.verizon.net] has joined #ubuntu | ||
| rekrutacja | crimsun, do i need reboot or something? | 12:11 |
| crimsun | rekrutacja: no, just play some music or something | 12:11 |
| nismo | Im trying to move something thats on my desktop to the /root folder, how do i do that? | 12:11 |
| === kettles [n=kettles@12-223-33-142.client.insightbb.com] has joined #ubuntu | ||
| unL33Tn00b | polpak Thank you. That makes sense. Is there a way to fix this so I can play the one game I like? | 12:11 |
| blacknight | ATIpro, agp or pci? | 12:11 |
| ATIpro | pci | 12:11 |
| bon_ | redwolf i cant see it | 12:11 |
| polpak | unL33Tn00b, what kind of video card, and what game? | 12:11 |
| === grigora [n=grigora@s232-154.resnet.ucla.edu] has joined #ubuntu | ||
| rekrutacja | crimsun, its working! it's working! | 12:11 |
| unL33Tn00b | polpak Game says without direct rendering game will run slow. It wasn't exaggerating (sp)... | 12:11 |
| dumezil_ | is there a way to change the behavior of F10? whenever i hit it, its like hitting alt-<insert menu hotkey here>... i have a console app that uses f10, but the terminal is grabbing before it gets to the program | 12:12 |
| blacknight | ATIpro, have a look at http://www.mneylon.com/blog/archives/2004/08/07/debian-ati-radeon-9600-se-pci/ it may help (or not) | 12:12 |
| trappist | unL33Tn00b: what video card | 12:12 |
| redwolf | bon_: can you see it as root? | 12:12 |
| rekrutacja | crimsun, thank you | 12:12 |
| nismo | Im trying to move something thats on my desktop to the /root folder, how do i do that? | 12:12 |
| polpak | unL33Tn00b, not terribly surprising.. what video card do you have? | 12:12 |
| kettles | help please. I was directed here from the firefox help channel, because i cant run firefox | 12:12 |
| arrick | hey everyone, I had a folder on the desktop, and renamed it to hide it with a . before the name, how do I name it back, so i can see it again? | 12:12 |
| unL33Tn00b | polpak Boson (from Repos <Command and Conquer clone) and I have no idea about video card... | 12:12 |
| kettles | they said it was a ubuntu poblem | 12:12 |
| blacknight | arrick, mv .foo foo ? | 12:12 |
| Sergi0 | kettles whats the trouble? | 12:12 |
| LKRaider | arrick: press CTRL+H, it will show all folders | 12:12 |
| polpak | arrick, use the terminal and do ls -a to see it | 12:12 |
| nismo | Im trying to move something thats on my desktop to the /root folder, how do i do that? | 12:12 |
| rekrutacja | crimsun, is it permanent solution? i mean - what bad happened to me and how to avoid it in a future? | 12:12 |
| kettles | i would paste the error but it is large | 12:12 |
| polpak | unL33Tn00b, pastebin the output of lspci | 12:12 |
| trappist | nismo: you'll need to do that on the command line with 'sudo' | 12:13 |
| nismo | yea im aware of that | 12:13 |
| nismo | whats the commnad | 12:13 |
| grigora | hi, recently I have started experiencing Firefox freezing and becoming unusable very-very frequently, there are no updates available for Firefox and I am just wondering how people are dealing with this issue, because it's a real pain. thanks! | 12:13 |
| nismo | sudo mv ? | 12:13 |
| === telemaco [n=telemaco@84.77.61.106] has joined #ubuntu | ||
| === ruggy [n=Rulon@66.199.118.2] has joined #ubuntu | ||
| unL33Tn00b | polpak Am new to Linux, was going to try Device Mgr...but I'll use term with what you said. | 12:13 |
| kettles | i try and run firefox, but when I do i get 4 errors | 12:13 |
| === ATIpro [n=tako@dsl-201-129-213-100.prod-infinitum.com.mx] has left #ubuntu [] | ||
| nismo | grigora does it shutdown on you on certain webpages? | 12:13 |
| arrick | polpak, how do I rename it again? | 12:13 |
| === DrPepperKid [n=mirco@dslb-084-063-000-097.pools.arcor-ip.net] has joined #ubuntu | ||
| kettles | such as locale not supported... and a can not set up locale modifiers | 12:13 |
| === SilverSpace_ [n=SilverSp@83-131-77-238.adsl.net.t-com.hr] has left #ubuntu [] | ||
| LathropWells | i haven't seen any errors. though i haven't added any extensions, updates or sunjava | 12:14 |
| grigora | nismo: no, it just stops responding to mouse clicks | 12:14 |
| Sergi0 | kettles paste the error here http://kubuntu.pastebin.com/ and drop the link in the irc, we can check the error then | 12:14 |
| nismo | oh... | 12:14 |
| arrick | !rename | 12:14 |
| kettles | ? | 12:14 |
| unL33Tn00b | polpak If PCMIA Services failed on bootscreen, would that be why? | 12:14 |
| Sergi0 | or ubuntu.pastebin.com :P | 12:14 |
| === olive [n=olive@o.o6.fr] has left #ubuntu ["Ex-Chat"] | ||
| === DrPepperKid is now known as MacSlow | ||
| kettles | i am new to linux. and IRC | 12:14 |
| grigora | nismo: and the browser window stop updating, it just freezes | 12:15 |
| === Ubuntu|Newbie [n=TeChGuY@CPE00045adb1e9c-CM000f21204b29.cpe.net.cable.rogers.com] has joined #ubuntu | ||
| kevin | I currently have a lab of windows clients that log into a linux server with samba, I would like to replace my windows clients with ubuntu, but how do I log an ubuntu client into the server instead of into itself? | 12:15 |
| crimsun | rekrutacja: some program you used muted the 'PCM' element and set its volume level to 0. | 12:15 |
| unL33Tn00b | polpak And would 3D RagePro 1x/2x be my vid card? | 12:15 |
| Sergi0 | kettles step 1 openup ubuntu.pastebin.com | 12:15 |
| nismo | I have similar issues with firefox, although when im on a website, it shutsdown completly | 12:15 |
| crimsun | rekrutacja: so...don't do that. | 12:15 |
| LathropWells | welcome kettles :) (spend some time here and you will be an old pro in no time. ) | 12:15 |
| bon_ | redwolf: it says the mount point does not excist | 12:15 |
| polpak | unL33Tn00b, sounds right | 12:15 |
| redwolf | bon_: mkdir /bon as root | 12:15 |
| === aleksi [n=aleksi@a193-229-161-39.elisa-laajakaista.fi] has joined #ubuntu | ||
| LKRaider | arrick: press CTRL+H on desktop, it will show you the hidden folders. Rename as usual | 12:15 |
| kettles | ok | 12:15 |
| Drac[Server] | What's the easiest way to directly copy the image of one harddrive to another, identical one? | 12:15 |
| === aleksi is now known as hukkka | ||
| === bjornkri [n=bjornkri@194.144.112.46] has joined #ubuntu | ||
| arrick | thanks | 12:16 |
| === fredforfaen [n=Morrari@216-132-165.0502.adsl.tele2.no] has joined #ubuntu | ||
| nismo | eg, ill be on a site and i click a link, shuts down.... i try to go back to the same site with the same link, same problem | 12:16 |
| arrick | now it workes | 12:16 |
| grigora | Drac[Server] : ghost? | 12:16 |
| niki | polpak, that did it...ty :) | 12:16 |
| polpak | niki, sure | 12:16 |
| unL33Tn00b | polpak Still want that pastebin? | 12:16 |
| Sergi0 | kettles do u know how to update your system using synaptic? | 12:16 |
| bjornkri | hey hey | 12:16 |
| Drac[Server] | grigora, are you refering to a freely available Ubuntu package? | 12:16 |
| kettles | ? | 12:16 |
| kettles | no | 12:16 |
| grigora | Drac[Server] : there is a free ghost package, I forget what it's called, but you can find it on google | 12:16 |
| kettles | i pasted the error | 12:16 |
| kettles | and clicked send | 12:16 |
| arrick | how do I convert html files to pdf? | 12:16 |
| === _sfar [n=sfar@c-f4f1e253.18-2-64736c10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| rekrutacja | crimsun, mhmmm the obnly programs i use are VLC and totem. VLC in its default configuration requires to set sound off and on again to be heard at all. this happend on two fresh installs of ubuntu on two different laptops, so i think this is a bug... | 12:16 |
| bon_ | redwolf: it says bad fs bla bla | 12:17 |
| nismo | .... What is the command for moving one file to the /root folder???? | 12:17 |
| === JamesCagney [n=James@dslb-084-061-206-074.pools.arcor-ip.net] has joined #ubuntu | ||
| Sergi0 | kettles whats the url for the pastebin? so i can look | 12:17 |
| redwolf | bon_: wow | 12:17 |
| === _sfar is now known as _sfar_ | ||
| zerokarmaleft | Drac[Server] : you should be able to use dd w/o a hitch if the drives are identical | 12:17 |
| redwolf | bon_: just, wow | 12:17 |
| kettles | http://ubuntu.pastebin.com/629797 | 12:17 |
| === bwlang [n=bwlang@bb-66-55-211-238.gwi.net] has joined #ubuntu | ||
| crimsun | rekrutacja: that's not a vlc bug nor an alsa bug | 12:17 |
| redwolf | bon_: are you sure it's ext3 again? | 12:17 |
| ds[de] | nismo; sudo mv *file* /folder | 12:17 |
| grigora | Drac[Server] : Ghost4Linux - http://www.feyrer.de/g4u/ | 12:17 |
| nismo | k | 12:17 |
| nismo | thnx | 12:17 |
| Drac[Server] | zerokarmaleft, really? Alright. The drive isn't clean, though. | 12:17 |
| Sergi0 | kettles ok, hang on | 12:17 |
| === Silencer [n=Silencer@82.208.215.13] has joined #ubuntu | ||
| LathropWells | http://www.partimage.org/ disk imaging (free) never really got this to work as smoothly as commercial apps | 12:17 |
| Drac[Server] | grigora, I'd prefer an option that can be taken from a Live CD. I know gparted can't do it. I can only afford to install a couple things on a Live CD session. | 12:17 |
| === xtr [n=94752345@S0106000c41ed11e1.vf.shawcable.net] has joined #Ubuntu | ||
| kevin | polpak, sorry didn't see you had answered me, my client is ubuntu, my server is mandrake, | 12:17 |
| bjornkri | I'm trying to figure out a way to manage my network drives. Fstab is out of the question as I'm using a laptop and so any unavailable drives (depending on where in the world I am) will cause a massive hang... Any quick way to switch or manage those drive mounts without too much hassle? | 12:18 |
| === madewokherd [n=urk@Client-128-118-128-10.mobility-bd.psu.edu] has joined #ubuntu | ||
| === JamesCagney [n=James@dslb-084-061-206-074.pools.arcor-ip.net] has left #ubuntu ["...] | ||
| === wd3 [n=wd3@adsl-69-108-98-112.dsl.irvnca.pacbell.net] has joined #ubuntu | ||
| === Cyorxamp [n=TomShaw@82-47-144-216.cable.ubr11.brad.blueyonder.co.uk] has joined #ubuntu | ||
| unL33Tn00b | polpak http://pastebin.com/629800 is the output for lspic. | 12:18 |
| kettles | wait | 12:18 |
| bon_ | redwolf: http://pastebin.com/629802 | 12:18 |
| Cyorxamp | I am trying to work out why I have no ttyUSB0 - can anyone help me? | 12:18 |
| Drac[Server] | zerokarmaleft, will I need to format the drive somehow, first? | 12:18 |
| Sergi0 | mha where did you get firefox? you downloaded yourself? | 12:18 |
| rekrutacja | crimsun, so what kind of bug it mat be? ubuntu configuration for laptops? | 12:18 |
| kettles | it didnot paste it all | 12:18 |
| kettles | here it is | 12:18 |
| kettles | http://ubuntu.pastebin.com/629803 | 12:18 |
| === TheFaction20 [n=ubuntu@ip70-188-172-184.ri.ri.cox.net] has joined #ubuntu | ||
| TheFaction20 | whats up guys | 12:18 |
| unL33Tn00b | :waves to TheFaction20 | 12:19 |
| bon_ | redwolf defnetly | 12:19 |
| Drac[Server] | dd it is. I'll find out on my own. | 12:19 |
| redwolf | bon_: doh, k, try this | 12:19 |
| bon_ | redwolf : defnetly | 12:19 |
| wd3 | how can i make my gnome terminal transparent or change background color? | 12:19 |
| redwolf | bon_: mount -t auto /dev/hda5 /bon | 12:19 |
| === CaLiPeY [n=pedro@80.244.55.154] has joined #ubuntu | ||
| kettles | you still there? | 12:19 |
| === torque [n=torque@unaffiliated/sgrgc] has joined #ubuntu | ||
| Cyorxamp | I am trying to work out why I have no ttyUSB0 - can anyone help me? | 12:20 |
| === mr_cirugia is now known as dientespodridos | ||
| LathropWells | wd3 - take a look at the "profiles" option. | 12:20 |
| possie | i'm trying to install mythtv via ubuntu package, but this package tries to create a user mythtv, but i allready have this user on my system so the package installation exists, is there a way to prevent this script from quiting? | 12:20 |
| unL33Tn00b | polpak ?? | 12:20 |
| wd3 | LathropWells, thanks | 12:20 |
| zerokarmaleft | Drac[Server] : not if you copy from one raw partition to another raw partition | 12:21 |
| TheFaction20 | wat command do i use to see what hardware i have detected? | 12:21 |
| wd3 | LathropWells, look at this...http://www.lynucs.org/index.php?screen_id=4764345284356d18fe5188&p=screen | 12:21 |
| Sergi0 | kettles what version u trying from firefox? where did you download it? | 12:22 |
| arrick | how do I convert html files to pdf? | 12:22 |
| === Steve^ [n=Steve@host-138-38-238-109.nat.bath.ac.uk] has joined #ubuntu | ||
| === VRWarper [n=VRWarper@cpe-24-90-212-152.nyc.res.rr.com] has joined #ubuntu | ||
| zerokarmaleft | TheFaction20: lspci | 12:22 |
| bjornkri | I'm trying to figure out a way to manage my network drives. Fstab is out of the question as I'm using a laptop and so any unavailable drives (depending on where in the world I am) will cause a massive hang... Any quick way to switch or manage those drive mounts without too much hassle? Am I really the only one who has to deal with this? :P | 12:22 |
| === matute [n=matute@200-127-2-56.cab.prima.net.ar] has joined #ubuntu | ||
| Cyorxamp | I am trying to work out why I have no ttyUSB0 - can anyone help me? | 12:23 |
| Sergi0 | bjornkri why not fstab? just dont use automount, and mount it when u need one of them | 12:23 |
| redwolf | Cyroxamp: for a palm? | 12:23 |
| matute | hi all | 12:23 |
| === cdubya [n=chris@ppp-70-243-231-18.dsl.ksc2mo.swbell.net] has left #ubuntu [] | ||
| Sergi0 | kettles -> what version u trying from firefox? where did you download it? | 12:23 |
| unL33Tn00b | How do I enable direct rendering? | 12:23 |
| polpak | unL33Tn00b, sorry, was on the phone | 12:23 |
| polpak | unL33Tn00b, what video card did you say? | 12:24 |
| unL33Tn00b | polpak Ahh, no worries. Sorry for the impatience. ;) | 12:24 |
| polpak | unL33Tn00b, ah, I see the pastebin.. one sec | 12:24 |
| bjornkri | Sergi0: .... oh. Well I must have misunderstood how fstab works, I'll try again. Thanks | 12:24 |
| unL33Tn00b | polpak Errr...ummm...Oh! #D ragepro 1x/2x? | 12:24 |
| === panzer [n=panzer@130-126-246-201.adsl.terra.cl] has joined #ubuntu | ||
| unL33Tn00b | polpak 3D, arther | 12:24 |
| Sergi0 | bjornkri no probs, good luck | 12:24 |
| trappist | bjornkri: you can use the _netdev option in fstab to skip those mounts if the network is unavailable | 12:25 |
| unL33Tn00b | polpak Sorry, can't type...need more coffee. ;)' | 12:25 |
| === harisund [n=harisund@ip24-255-87-152.br.br.cox.net] has joined #ubuntu | ||
| LathropWells | wd3 - nice looking desktop. that is torsmo for the transparent ram/cpu montor and is it gdesklets for the menus? | 12:25 |
| === schloob [n=schloob@cpe-72-226-28-249.nycap.res.rr.com] has joined #ubuntu | ||
| === jind [n=jind@dsl249-249.adsl.no] has joined #ubuntu | ||
| redwolf | bon_: I'm starting to run thin on this one...I have to go soon | 12:25 |
| LKRaider | arrick: try the cups-pdf printer (avaiable in synaptic). You can print anything to pdf then | 12:26 |
| trappist | arrick: sudo apt-get install htmldoc && man htmldoc | 12:26 |
| polpak | unL33Tn00b, sad news.. That video card doesn't have 3d drivers from ATI for linux. | 12:26 |
| schloob | hi, i'm trying to set $PS1 for my terminal, it's working fine so far, but when output from programs doesnt and in a newline, the prompt like displays once, then carriage returns, then displays again. | 12:26 |
| grigora | nismo: one of the sites that cause the freeze is ft.com, every time the site refreshes itself, the browser become unresponsive for 10-15 seconds | 12:26 |
| wd3 | LathropWells, i just installed fluxbox and playing around with it, any suggestings? | 12:26 |
| unL33Tn00b | polpak So, in n00b term, get a new card? | 12:26 |
| === matute [n=matute@200-127-2-56.cab.prima.net.ar] has left #ubuntu ["Abandonando"] | ||
| polpak | unL33Tn00b, yep | 12:26 |
| harisund | hello everyone, my Ubuntu (Gnome) is running real slow, I was wondering whether I could disable animations (such as those when minimizing windows) | 12:26 |
| arrick | I want to save the html as a pdf, LKRaider , trappist not print it | 12:26 |
| === haha [n=jordan@pool-141-156-94-121.res.east.verizon.net] has joined #ubuntu | ||
| === jind [n=jind@dsl249-249.adsl.no] has joined #ubuntu | ||
| LathropWells | wd3 - no, nice light and fast :) | 12:27 |
| === TSCHAK [n=thomas@24-53-91-155.clspco.adelphia.net] has joined #ubuntu | ||
| arrick | oh I forgot, makes me think I'm stupid now | 12:27 |
| === flodine [n=flodine@c-24-4-174-71.hsd1.ca.comcast.net] has left #ubuntu ["Leaving"] | ||
| unL33Tn00b | polpak. Gotcha. As far as I know, the one I have is a PoS anyway. And it was free. No worries and thanks for the help. | 12:27 |
| polpak | unL33Tn00b, If you want to go with ATI, you'll need a radeon in the 9xxx series | 12:27 |
| LKRaider | arrick: then try htmldoc as trappist suggested | 12:27 |
| trappist | arrick: LKRaider's suggestion was a good one. the cups pdf printer creates pdfs, it doesn't print. mine was also good, as it also creates pdfs. | 12:27 |
| haha | hey i need to be able to print from one of my computers to a windows computer . how do i do it? | 12:27 |
| === bimberi [n=bimberi@pdpc/supporter/active/bimberi] has joined #ubuntu | ||
| polpak | unL33Tn00b, otherwise Nvidia is a good choice | 12:27 |
| === harm [n=harm@82-171-74-86.dsl.ip.tiscali.nl] has joined #ubuntu | ||
| === bon__ [n=bon@82-41-231-23.cable.ubr08.edin.blueyonder.co.uk] has joined #ubuntu | ||
| === fredforfaen [n=Morrari@216-132-165.0502.adsl.tele2.no] has joined #ubuntu | ||
| unL33Tn00b | polpak I'm supposed to go get a book for learning Linux....Something about 21 days....Do you know the title? | 12:27 |
| haha | hey i need to be able to print from one of my computers to a windows computer . how do i do it? | 12:27 |
| unL33Tn00b | polpak It's by O'reilly | 12:28 |
| bon__ | redwolf: sorry power cards aaahhhh | 12:28 |
| bimberi | haha: XP? | 12:28 |
| haha | eys | 12:28 |
| haha | yes** | 12:28 |
| === axl000 [n=axl@93-51-89.adsl.terra.cl] has joined #ubuntu | ||
| redwolf | bon__: hmm | 12:28 |
| bimberi | !tell haha about xpprint | 12:28 |
| polpak | unL33Tn00b, I couldn't really recommend anything.. It depends on what you're wanting to learn | 12:28 |
| polpak | unL33Tn00b, there is a lot of info online too | 12:28 |
| unL33Tn00b | polpak Linix for Morons..... | 12:28 |
| redwolf | bon__: well, I think you have some kind of problem with that partition | 12:28 |
| axl000 | how can i play xvid, divx, mp3 without automatix in dapper? | 12:28 |
| Drac[Server] | zerokarmaleft, OH. Didn't see that part. Um.... Yeah. I need to copy the master boot record and stuff... What other ways can I do this? | 12:29 |
| unL33Tn00b | polpak I was going to see if I could find an ebook, but... | 12:29 |
| redwolf | bon__: unfortunately, I have to go | 12:29 |
| redwolf | bon__: sorry I couldn't help you more | 12:29 |
| polpak | unL33Tn00b, oh.. Well for the most basic stuff I'd just suggest trying things out and if you run into problems search the forums, or ask in here | 12:29 |
| wd3 | LathropWells, thanks it is :) i know gnome term can do it, someone just sent me this.......http://errr-online.com/pics/2006-03-29-162338_1024x768_scrot.png | 12:29 |
| arrick | trappist, after i get the stuff you said to get, what should I do next? | 12:29 |
| polpak | unL33Tn00b, the best way to learn is by doing | 12:29 |
| bon__ | redwolf : thanks for your help i wish i could give you a beer or something | 12:29 |
| unL33Tn00b | polpak Ok, thank you! ;) | 12:29 |
| redwolf | bon__: np, cya later | 12:29 |
| harm | unl33Tn00b ... if u managed to get here everything will be alright | 12:30 |
| bon__ | redwolf : but they dont fit down telephone lines | 12:30 |
| trappist | arrick: man htmldoc | 12:30 |
| arrick | ok | 12:30 |
| arrick | thanks | 12:30 |
| unL33Tn00b | harm I know. This is the single most useful thing I've found for linux. After RTFM, that is... | 12:30 |
| === Hollowman8904 [n=alex@MW-ESR1-72-49-67-231.fuse.net] has joined #ubuntu | ||
| haha | it doesnt work | 12:31 |
| Hollowman8904 | can someone help me get TightVNC working? its giving me errors about fonts | 12:31 |
| unL33Tn00b | Later guys. Thanks for the help! ;) | 12:31 |
| === jind [n=jind@dsl249-249.adsl.no] has joined #ubuntu | ||
| haha | hwo do i get it to work? | 12:31 |
| === guest [n=guest@pool-71-120-24-163.washdc.east.verizon.net] has joined #ubuntu | ||
| guest | Hello | 12:31 |
| harm | well yah but i mean manuals are sometimes unclear | 12:32 |
| guest | I'm new to Ubuntu. | 12:32 |
| haha | how do u get it to work? | 12:32 |
| TheFaction20 | guest:welcom | 12:32 |
| TheFaction20 | e | 12:32 |
| guest | I have not recieved an administration name/password. | 12:32 |
| zerokarmaleft | Drac[Server] : you can copy the mbr with dd to a specific file if you specify the block size and how many blocks to copy | 12:32 |
| guest | Thank you. | 12:32 |
| sfar | guest, its the password for the first created user | 12:32 |
| haha | dude | 12:32 |
| haha | i need help | 12:32 |
| harm | :) | 12:32 |
| guest | Well, I'm trying to install Wine. | 12:32 |
| === ptlo [n=senko@83-131-77-16.adsl.net.t-com.hr] has joined #ubuntu | ||
| zerokarmaleft | Drac[Server] : e.g. dd if=/dev/foo bs=512 count=1 > /tmp/mbr.bin | 12:33 |
| harm | guest i have just installed wine | 12:33 |
| guest | However, the console is prohibiting. | 12:33 |
| guest | Did you?!! | 12:33 |
| harm | yah | 12:33 |
| guest | Ha! | 12:33 |
| Hollowman8904 | in tightvnc, i get the error: | 12:33 |
| Hollowman8904 | Fatal server error: | 12:33 |
| Hollowman8904 | could not open default font 'fixed' | 12:33 |
| harm | its slow as hell | 12:33 |
| guest | Is it??!! | 12:33 |
| === redwolf [n=redwolf@bec28358RN.rh.ncsu.edu] has joined #ubuntu | ||
| guest | Hmm... | 12:33 |
| harm | well the downloda :P | 12:33 |
| haha | i need to print on my netowork | 12:33 |
| harm | download | 12:33 |
| polpak | guest, he means the downloading is slow | 12:33 |
| haha | how do i do it | 12:33 |
| === gabbah [n=gabbah@82.99.36.8] has joined #ubuntu | ||
| === redwolf [n=redwolf@bec28358RN.rh.ncsu.edu] has left #ubuntu ["Leaving"] | ||
| guest | Ahhh..... | 12:33 |
| sfar | use "sudo" before the actual command.. "sudo command here" | 12:33 |
| polpak | guest, because a new version just came out | 12:33 |
| guest | After the download, what did you do? | 12:33 |
| harm | well i did apt-get install... so it installed | 12:34 |
| haha | i did sudo | 12:34 |
| harm | and worked | 12:34 |
| polpak | guest, just sudo apt-get install wine | 12:34 |
| guest | Yes. I thought so...Linux won't let me... | 12:34 |
| polpak | guest, when it asks for a password, just type yours in | 12:34 |
| harm | you probally have to restart the download cuz mine timed-out | 12:34 |
| guest | let me try again... | 12:34 |
| polpak | guest, it won't show anything on the screen, but it still types | 12:34 |
| === bon__ [n=bon@82-41-231-23.cable.ubr08.edin.blueyonder.co.uk] has joined #ubuntu | ||
| === spine [n=spine@c-66-176-98-9.hsd1.fl.comcast.net] has joined #ubuntu | ||
| bon__ | redwolf: it worked :) | 12:34 |
| haha | im getting sick of ubuntu!! | 12:35 |
| harm | guest just keep doing apt-get install till its at 100% and installed | 12:35 |
| zerokarmaleft | Drac[Server] : though if the disk has a complicated partition setup, then backing up with dd will get complicated also | 12:35 |
| harm | haha why is that? | 12:35 |
| nosilver4u | hey, where do i report bugs? | 12:35 |
| guest | I don't know... | 12:35 |
| jadams | does anyone know of a tool in the repositories that will allow one to easily create panoramas? | 12:35 |
| polpak | nosilver4u, bugs in? | 12:35 |
| haha | i need to print wierlessly on my network | 12:35 |
| guest | Let me tell you the message... | 12:35 |
| haha | and i dont know how | 12:35 |
| === schloob [n=schloob@cpe-72-226-28-249.nycap.res.rr.com] has left #ubuntu ["Bye"] | ||
| harm | haha ubuntu or kubuntu? | 12:35 |
| nosilver4u | it's an issue with the unmount dialog (when ejecting a cd) | 12:35 |
| arrick | trappist, does htmldoc have a gui interface? | 12:35 |
| === jonshea__ [n=jonshea@129.170.234.107] has joined #ubuntu | ||
| === gamma [n=gamma@192.237.33.65.cfl.res.rr.com] has joined #ubuntu | ||
| haha | im using ubuntu | 12:36 |
| guest | This is what Ubuntu returns: deb-src http://wine.sourceforge.net/apt/ source/ | 12:36 |
| guest | No wroing text.... | 12:36 |
| guest | This is the message: E: Could not open lock file /var/lib/apt/lists/lock - open (13 Permission denied) | 12:36 |
| harm | guest did u add the URL thingy to your sources? | 12:36 |
| bimberi | haha: have you shared the printer on XP? | 12:36 |
| haha | eys | 12:36 |
| haha | yes** | 12:36 |
| sfar | guest, do you have synaptics running? | 12:36 |
| guest | Yes. Repositories? | 12:36 |
| bimberi | haha: what sort of printer, does ubuntu have drivers? | 12:36 |
| guest | Yes. | 12:36 |
| === pramz [n=pramod@c-67-168-84-207.hsd1.wa.comcast.net] has joined #ubuntu | ||
| guest | Do I have to close synaptics first? | 12:36 |
| sfar | close synaptic and try again | 12:37 |
| harm | guest u can only use synaptics OR consule :P | 12:37 |
| haha | it installed my hp printer | 12:37 |
| haha | i think it does have the drivers | 12:37 |
| arrick | trappist, I am trying to convert Rute User's Tutorial and Exposition html file to pdf, that way I can make it available again cause all the pdf links to it are broken | 12:37 |
| === d4n13L [i=d@niel.bashgeek.de] has joined #ubuntu | ||
| spine | i have a problem with y dual screen setup, i run at 2048x768 and xine makes everything a 8:3 ratio instead of 4:3, i heard there was a way for for xinerama t resolve this issue | 12:37 |
| guest | Same problem.... | 12:37 |
| spine | really | 12:37 |
| spine | wow | 12:37 |
| polpak | !enter | 12:37 |
| ubotu | Please don't use the "enter" key as punctuation! It spams the channel and is annoying. | 12:37 |
| haha | its an hp deskjet 882c | 12:38 |
| === pramz [n=pramod@c-67-168-84-207.hsd1.wa.comcast.net] has joined #ubuntu | ||
| === topkickdiesel [n=topkickd@cpe-071-065-198-049.nc.res.rr.com] has joined #ubuntu | ||
| trappist | arrick: I just do this: print to file in firefox then use ps2pdf | 12:38 |
| arrick | ok | 12:38 |
| guest | Still returned: Could not open lock file /var/lib/apt/lists/lock - open (13 Permission denied) | 12:38 |
| polpak | haha, please address your responses to the person(s) helping you. it avoids confusion, and makes it easier for them to see your posts | 12:38 |
| sfar | spine, https://wiki.ubuntu.com/?action=fullsearch&context=180&value=xinerama&titlesearch=Titles | 12:38 |
| harm | guest http://www.winehq.org/site/download-deb <-- try that and use the APT-GET guide | 12:38 |
| guest | Yes, Polpak... | 12:38 |
| guest | yes... | 12:39 |
| spine | sfar, god bless | 12:39 |
| LKRaider | arrick: I would use cups-pdf, it doesn't need the extra terminal step of ps2pdf | 12:39 |
| harm | guest you have that in front of you? | 12:39 |
| haha | bimberi: i have a deskjet 882c | 12:39 |
| arrick | ok | 12:39 |
| kevin | instead of creating individual user accounts on linux clients, I want to be able to log into the user accounts on my linux server, how can I do this with Ubuntu? Thanks | 12:39 |
| arrick | I didnt want to configure cups | 12:39 |
| guest | hars: that was what I was using. | 12:39 |
| LKRaider | arrick: it's quite simple tho | 12:39 |
| polpak | kevin, ssh user@server | 12:39 |
| guest | Is it harm? | 12:39 |
| trappist | arrick: if this is a one-shot deal use firefox + ps2pdf. if you're going to need to do a lot of it, use the cups solution. | 12:40 |
| bimberi | haha: yes, there are drivers for that. Hmm i'm not sure what's wrong then | 12:40 |
| polpak | kevin, your question isn't terribly clear, sorry | 12:40 |
| arrick | ok | 12:40 |
| harm | guest i used that site 30minutes ago to set up wine | 12:40 |
| haha | bimberi: i installed it but now i need to print wirelessly on my XP | 12:40 |
| polpak | bimberi, it may be because it's a samba printer, and not directly connected? | 12:40 |
| michoelc | hi guys. i have another q. i was looking on the internet and I see its a known prob. but i couldnt find clear instructions to fix it. when i put in my usb flash drive and try and mount it it says "given UDI is not a mountable volume". tia. | 12:40 |
| guest | harm I bet you did. I am quite confused... | 12:40 |
| === ca38aspear [n=mike@66-168-7-43.dhcp.stpt.wi.charter.com] has joined #ubuntu | ||
| polpak | haha, is the printer plugged into your linux computer, or the XP one? | 12:41 |
| harm | guest .. ah ok let me message you | 12:41 |
| haha | polpak:it is not directly connected | 12:41 |
| guest | harm I'm able to download it and everything.... | 12:41 |
| arrick | LKRaider, trappist it only does the main index page, how do I get it to do the whole thing? | 12:41 |
| guest | Harm, ok | 12:41 |
| haha | polpack: XP | 12:41 |
| === UsefuLldiot [n=chris@d57-131-20.home.cgocable.net] has left #ubuntu [] | ||
| === paintballman [n=paintbal@cpe-071-065-198-049.nc.res.rr.com] has joined #ubuntu | ||
| sfar | guest, close everything but IRC and the terminal | 12:41 |
| bimberi | polpak: yes, although i thought samba handled that :/ | 12:41 |
| guest | sfar yes | 12:41 |
| trappist | arrick: oh it's not all one page? | 12:41 |
| sfar | and try again.. you can try "ps aux | grep synaptic" to list any process with the name *synaptic* | 12:41 |
| arrick | the main page is all hyperlinks, its a whole book. | 12:42 |
| === harm [n=harm@82-171-74-86.dsl.ip.tiscali.nl] has joined #ubuntu | ||
| sfar | or wait, just do "killall synaptic" and try again :) | 12:42 |
| arrick | brb | 12:42 |
| === ruy_ [n=ruy@ACCBBAF3.ipt.aol.com] has joined #ubuntu | ||
| harm | sorry guest :p wrong minimize button | 12:42 |
| guest | sfar yes | 12:42 |
| trappist | arrick: you need to use htmldoc then | 12:42 |
| LKRaider | arrick: you have several files? this is more advanced then... the terminal solution might work, but you will probably have to study the htmldoc manual | 12:42 |
| sfar | and "killall apt", and "killall dpkg" | 12:42 |
| kevin | polpak, sorry, I want to be able to do domain logins to a linux server like I can with a Windows domain logon. I don't want to first log into my linux client, then ssh to my linux server. When I log into gnome, I want it to authenticate with the linux server and load my home directory from the server etc. | 12:43 |
| harm | guest in consule enter this: sudo gedit /etc/apt/sources.list | 12:43 |
| guest | sfar, for all 3 instance it returned: (no process killed) | 12:43 |
| === whyami [n=john@156.26.67.227] has joined #ubuntu | ||
| guest | harm, did so. | 12:43 |
| harm | guest make sure u have these two lines at the bottom or somewhere else WITHOUT a # before it | 12:43 |
| harm | deb http://wine.sourceforge.net/apt/ binary/ | 12:43 |
| harm | deb-src http://wine.sourceforge.net/apt/ source/ | 12:43 |
| TSCHAK | kevin, there are several ways to do it, no definitive approach | 12:44 |
| sfar | guest, that's strange.. actually you are the second person today with that problem.. im clueless.. try rebooting | 12:44 |
| harm | guest then SAVE and close gedit | 12:44 |
| sfar | harm, that's not his problem right now tho | 12:44 |
| === ca38aspear [n=mike@66-168-7-43.dhcp.stpt.wi.charter.com] has left #ubuntu [] | ||
| TheFaction20 | have any of you managed to boot off of an external with windows on an internal? | 12:44 |
| harm | o ok :P well just cecking | 12:44 |
| TSCHAK | kevin, simplest is to use NIS To provide your passwd and group files to your linux workstations, then mount your home directories via NFS | 12:44 |
| Sergi0 | guest : did u use sudo? like this : 'sudo apt-get update' | 12:44 |
| === JLiquorish [n=jliquori@cpc2-mapp1-6-0-cust3.nott.cable.ntl.com] has joined #ubuntu | ||
| sfar | :) | 12:44 |
| guest | harm, I think you did it!! | 12:44 |
| bon__ | how would i go about adding my new partion to /home it is curently mounted on /bon - my fstab ---> http://pastebin.com/629860 | 12:44 |
| TSCHAK | kevin, but I've also used LDAP to replicate password and group information. | 12:44 |
| harm | guest its the small things that mess things up :P | 12:44 |
| guest | harm, ha ha I think it's installing!! | 12:45 |
| sfar | that is just weird | 12:45 |
| guest | harm, I am the problem. I am so use to Windows/DOS! Ha! | 12:45 |
| === rcmiv [n=rcmiv@24-247-126-142.dhcp.klmz.mi.charter.com] has joined #ubuntu | ||
| harm | guest it will fail a couple of times cuz a lot of people are getting the new version | 12:45 |
| guest | harm, I see | 12:45 |
| harm | guest iam not great with linux ether.. just rtfm carefully | 12:46 |
| TheFaction20 | harm:people are getting dapper? | 12:46 |
| TSCHAK | i am using it | 12:46 |
| harm | uh? | 12:46 |
| TheFaction20 | harm:i thought that doesnt come out til june | 12:46 |
| TSCHAK | TheFaction20, the release doesn't | 12:46 |
| kevin | TSCHAK, thanks, will those allow me to log into the server without creating a bunch of local client accounts? I will look at those, I tried googling before, but obviuosly wasn't using the right search terms ;) | 12:46 |
| harm | thefaction20 i didnt say anything about dapper | 12:46 |
| arrick | ok thanks, gotta go for now | 12:46 |
| TSCHAK | TheFaction20, but you can get testing versions. | 12:46 |
| TheFaction20 | tschak:thanks | 12:46 |
| TSCHAK | kevin, correct. | 12:46 |
| michoelc | sorry for asking again, but could anyone help me. when i try mount myusb flash drive there is an error: "given UDI is not a mountable volume". | 12:46 |
| kevin | TSCHAK, thanks muchly :) | 12:47 |
| TSCHAK | kevin, np | 12:47 |
| TheFaction20 | michoelc what kind is it? | 12:47 |
| JLiquorish | where can i find a kvm that works with linux? | 12:47 |
| arrick | where do I get ps2pdf from if I want it? | 12:47 |
| harm | whats a good bittorent client... not java based (azeraus) | 12:47 |
| === IdleOne [n=idleone@toronto-HSE-ppp4085528.sympatico.ca] has joined #ubuntu | ||
| michoelc | TheFaction20: the brand is called sahara | 12:47 |
| spine | "Writing in C or C++ is like running a chain saw with all the safety guards removed." -Bob Gra | 12:48 |
| spine | this iso funny i had to post it | 12:48 |
| arrick | where do I get ps2pdf from if I want it? trappist | 12:48 |
| panzer | configure: error: --with-readline=yes (default) and headers/libs are not available | 12:48 |
| panzer | what do it? | 12:48 |
| trappist | arrick: apt-cache search ps2pdf | 12:48 |
| arrick | thanks | 12:49 |
| polpak | kevin, ah.. you just want smart terminals or something | 12:49 |
| === LeeJunFan [n=junfan@adsl-69-210-207-5.dsl.klmzmi.ameritech.net] has joined #ubuntu | ||
| TSCHAK | kevin, you can also go the terminal server route,very easily | 12:50 |
| arrick | ok later all | 12:50 |
| TSCHAK | kevin, in the last year, i've installed several NX installations, with an average of 100 people using each from a central server. | 12:50 |
| === lupzz [n=lupz@81-208-83-214.fastres.net] has joined #ubuntu | ||
| TSCHAK | (the largest NX terminal server i've built thus far is a dual dual-core opteron, 2.2ghz a piece, with 4G of ram) | 12:51 |
| TSCHAK | running FreeNX | 12:51 |
| === Falstius [n=airen@c-68-40-57-200.hsd1.mi.comcast.net] has joined #ubuntu | ||
| === panzer [n=panzer@130-126-246-201.adsl.terra.cl] has left #ubuntu ["Abandonando"] | ||
| gabbah | anyone had problems with mouse config using driver/protocol "evdev" causing gnome-settings-daemon to crash? | 12:51 |
| kevin | so all the software runs off server and not client? | 12:51 |
| === MacSlow [n=mirco@dslb-084-063-000-097.pools.arcor-ip.net] has joined #ubuntu | ||
| polpak | kevin, yes, except you have to run an X server on the client | 12:52 |
| === Krhis [n=Krhis@cblcpe-79-205.suite224.net] has joined #ubuntu | ||
| polpak | kevin, it doesn't work for 3d graphic accellerated stuff, but everything else works good | 12:53 |
| === lupzzz [n=lupz@85-18-14-6.fastres.net] has joined #ubuntu | ||
| hyphenated | can they be set up with failover servers, or if the main terminal server dies, is everybody screwed? | 12:53 |
| Skinux | TSCHAK: sorry to interrupt ... this a great discussion and I've been wanting to try a terminal server for a while. How does it differ from ltsp? | 12:53 |
| TSCHAK | Skinux, well, LTSP can be retrofitted to use NX | 12:54 |
| === tar_ [n=tar@reinhart.student.Princeton.EDU] has joined #ubuntu | ||
| TSCHAK | Skinux, but basically if you use LTSP straight, you're doing raw X over the network | 12:54 |
| kevin | polpak, not that I need to right now, but if I wanted to run a 3d program etc later on, would I be able to run it off the client, but everything else off the server? | 12:54 |
| === canllait1 [i=dessa@203-97-214-188.cable.telstraclear.net] has joined #ubuntu | ||
| Skinux | TSCHAK, thx! | 12:55 |
| TSCHAK | Skinux, which is great. but if you have clients like i do who have roaming laptops, and many different platforms, NX is a much better win... | 12:55 |
| polpak | kevin, sure | 12:55 |
| canllait1 | Heya, is there anywhere you can get latest Gnome packages for breezy, like you can get the latest KDE? | 12:55 |
| TSCHAK | Skinux, because the nxclient is easy to install | 12:55 |
| holobyted | do Marvell PHY LAN chips work on Linux? | 12:55 |
| === illusions [n=illusion@c-24-17-47-28.hsd1.wa.comcast.net] has joined #ubuntu | ||
| TSCHAK | Skinux, but you also get the advantage of NX compression, which is fucking phenomenal . | 12:55 |
| canllait1 | nxagent also makes a damn nice Xnest replacement, as you can resize the window | 12:55 |
| TheFaction20 | what is the command that contains tail and -f? | 12:55 |
| === Pratico [n=pscabral@20151147195.user.veloxzone.com.br] has joined #ubuntu | ||
| === Pratico [n=pscabral@20151147195.user.veloxzone.com.br] has left #ubuntu ["Leaving"] | ||
| TSCHAK | Skinux, and all my NX installations can be accessed by my clients from their homes or wherever, wrapped in a nice SSH and SSL connection. | 12:56 |
| TheFaction20 | and it gives message of what is connected | 12:56 |
| TheFaction20 | like external usb drives? | 12:56 |
| polpak | TheFaction20, tail -f /path/to/log/file | 12:56 |
| Skinux | TSCHAK: It's just a home network science experient, so I will give it a shot. Is the learning curve real steep? | 12:56 |
| kevin | polpak, would I need to log into the local client to use the 3d accelerated program? Or still use terminal login? | 12:56 |
| TSCHAK | Skinux, no. | 12:56 |
| haha | polpak,the Xp one | 12:56 |
| Sergi0 | TSCHAK u got any good url / info for that NX? | 12:56 |
| bimberi | !freenx | 12:56 |
| ubotu | methinks freenx is https://wiki.ubuntu.com/FreeNX | 12:56 |
| TSCHAK | Skinux, freenx is by default set up to do authentication by pam | 12:57 |
| Falstius | TheFaction20: sudo tail -f /var/log/messages ? | 12:57 |
| TSCHAK | ubotu, correct. | 12:57 |
| ubotu | TSCHAK: NO SPEAKE ENLISH! Try searching at http://ubuntu.cc.com.au/ | 12:57 |
| TheFaction20 | Falstius:thats the one thank you | 12:57 |
| illusions | hi all | 12:57 |
| haha | polpak,the XP one | 12:57 |
| TSCHAK | Skinux, Sergi0 also, you can get the NX client from http://www.nomachine.com/ | 12:57 |
| TSCHAK | nomachine also sells commercial NX servers | 12:57 |
| polpak | kevin, you'll need to "log in" to the local client regardless.. It can however just log into a generic account that starts X and then connects to the server computer | 12:57 |
| === spiritz [n=spiritz@61.12.41.143] has joined #ubuntu | ||
| TSCHAK | which are MUCH better than freenx in terms of maintainability | 12:57 |
| === susus_ [n=sz@p5089F0BD.dip.t-dialin.net] has joined #ubuntu | ||
| === ogra [n=ogra@ubuntu/member/ogra] has joined #ubuntu | ||
| haha | polpak, the XP one | 12:58 |
| TheFaction20 | what i find funny is how i had a wd external...wouldnt stay visible | 12:58 |
| === ghosty [n=ghosty@host81-156-204-105.range81-156.btcentralplus.com] has joined #ubuntu | ||
| canllait1 | So, are there any packages of Gnome 2.14 for breezy anywhere? :) | 12:58 |
| TheFaction20 | but i get a maxtor and works fine | 12:58 |
| themachine | I have created a ciphering algorithm. Where should I look to make it perfectly open source and free? | 12:59 |
| Sergi0 | TSCHAK is this the same system like X -query hostname ? | 12:59 |
| kevin | polpak, thanks for your help | 12:59 |
| haha | polpak, THE XP ONE!! | 12:59 |
| === canllait1 is now known as canllaith | ||
| TSCHAK | Sergi0, NX is basically a highly compressed and predictive X protocol | 12:59 |
| TSCHAK | Sergi0, wrapped in SSL and then SSH | 12:59 |
| kevin | TSCHAK thanks for your help too! :) | 12:59 |
| themachine | in other words, where should I start? | 12:59 |
| spine | can someone tell me how to change xines display size from 800:600 to 800x300 to correct the 8:3 ratio bug in xine readin from xdpyinfo | 12:59 |
| MacSlow | I have this for m root-partition - (rw,errors=remount-ro) | 12:59 |
| === soop [n=soop@69-11-121-11.estv.hssx.sasknet.sk.ca] has joined #ubuntu | ||
| TSCHAK | Sergi0, it uses extensive domain-specific knowledge about X to compress an X event stream by as much as 90% | 01:00 |
| MacSlow | and now I cannot sumbit any HTML-form in firefox anymore | 01:00 |
| Sergi0 | TSCHAK, thanks, would it be a try with edubuntu and NX | 01:00 |
| MacSlow | what in the world is wront with that? | 01:00 |
| ghosty | i new to ubuntu is there anyway to nmap and other various network tools??? i have tryed apt-get install nmap and it says it not there. | 01:00 |
| TSCHAK | Sergi0, therefore it can be run over very slow links with excellent perforamnce even over cell phone links (I know, ive done it) | 01:00 |
| polpak | haha, the XP one what? | 01:00 |
| haha | polpak, the printere plugged into | 01:00 |
| ds[de] | !info nmap | 01:00 |
| ubotu | nmap: (The Network Mapper), section net, is extra. Version: 3.81-2ubuntu1 (breezy), Packaged size: 558 kB, Installed size: 1900 kB | 01:01 |
| haha | printer** | 01:01 |
| soop | !info repositories | 01:01 |
| polpak | haha, I don't use XP, so I don't know how to configure it to share the printer. I was just trying to clarify for the other person who was helping you | 01:01 |
| soop | damn | 01:01 |
| TSCHAK | Sergi0, well, the qualifications with NX are as follows (1) do you need remote access? (2) are your students bringing in their own laptops and do they need to use windows/mac os x too? ... if one or both questions are YES, then NX is the clear win. | 01:01 |
| Sergi0 | TSCHAK, great, ill get a deeper look soon | 01:01 |
| soop | ghosty: you need to add your repositories | 01:01 |
| haha | UBUNTU IS getting on my NERVes!!! | 01:01 |
| haha | i think im going back to windows!! | 01:01 |
| ghosty | snoop is that under the app programs ? | 01:01 |
| TSCHAK | haha, what problems are you having?? | 01:01 |
| ghosty | soop^ | 01:02 |
| spine | or how to add an apsect ratio of 4:1.5 to xine? | 01:02 |
| themachine | but windows has more errors | 01:02 |
| === NCLife [i=sinclair@201.160.5.51.cableonline.com.mx] has joined #ubuntu | ||
| === s0ciopath [n=user@net34-155.netkaster.ca] has joined #ubuntu | ||
| polpak | !tell haha about patience | 01:02 |
| === existance [n=existanc@cpe-68-201-251-162.houston.res.rr.com] has joined #ubuntu | ||
| haha | TSHAK,i need to print files throught my network | 01:02 |
| === OmniColos [n=Francisc@2908.artic.edu] has joined #ubuntu | ||
| themachine | how would I declare my software perfectly open source and free? | 01:03 |
| soop | haha: how so? | 01:03 |
| Skinux | haha, do you have the printer connected to a PC or directly into the network? | 01:03 |
| soop | ghosty: yes? | 01:03 |
| haha | to a pc | 01:03 |
| haha | thats on my network | 01:03 |
| ghosty | soop how do i update repositories | 01:03 |
| soop | ghosty. oh know you need to edit /etc/source/sources.list and uncomment the deb lines, google ubuntu and repositories howto | 01:03 |
| soop | sec i'll find a url for you | 01:04 |
| Skinux | haha, is the pc that you want to print to Linux or Windows? | 01:04 |
| haha | windows | 01:04 |
| Skinux | haha, give me a sec | 01:04 |
| ghosty | thanks soop | 01:04 |
| haha | skinux,thax | 01:04 |
| haha | thanx** | 01:04 |
| TSCHAK | I'm so used to printing on CUPS | 01:04 |
| TSCHAK | i have a network of Linux and OS X machines | 01:05 |
| TSCHAK | and printing JUST WORKS | 01:05 |
| TSCHAK | zero config | 01:05 |
| haha | lucky | 01:05 |
| TSCHAK | and then I go back to windows and i'm like...this is the most brain dead printing system ever made. | 01:05 |
| TSCHAK | it always has been | 01:05 |
| haha | i might switch to mac | 01:05 |
| Skinux | haha, let's see if I can do it --- r u trying with SMB? | 01:05 |
| TSCHAK | haha, not really lucky.. it's a design of the CUPS printing system | 01:05 |
| === canllaith [i=dessa@kde/jhall] has left #ubuntu [] | ||
| haha | samba? | 01:06 |
| === niki [n=juztin@68-184-136-55.dhcp.stbr.ga.charter.com] has joined #ubuntu | ||
| haha | i think so skinux | 01:06 |
| TSCHAK | haha, if you have your CUPS server set up to broadcast which printers it has, all your other machines see the printers, and can talk to them without any configuration (the server does all the translation from postscript to the appropriate printer code) | 01:06 |
| === beefsprocket [n=beefspro@74.12.74.148] has joined #ubuntu | ||
| === YogSothoth [n=john@lns-bzn-20-82-250-30-112.adsl.proxad.net] has joined #Ubuntu | ||
| YogSothoth | Hi | 01:07 |
| illusions | tschak could he get cups for ubuntu? | 01:07 |
| TSCHAK | illusions, ubuntu comes installed with cups | 01:07 |
| haha | how do u get cups? | 01:07 |
| soop | ghosty: www.ubuntuguide.org | 01:07 |
| === ts20_5m0k3 [n=smoke@dblt-216-227-18-27.gtcom.net] has joined #ubuntu | ||
| illusions | well there ya go :P lol | 01:07 |
| TSCHAK | it's the default printer subsystem in every linux distribution i've known since 2001. | 01:07 |
| TSCHAK | and I was installing it to replace lpd on unix and linux even before then. | 01:08 |
| === zerokarmaleft [n=zerokarm@ip68-12-45-133.ok.ok.cox.net] has left #ubuntu ["Ex-Chat"] | ||
| axl000 | how can i know my actual cpu frequency and temperature??? | 01:08 |
| haha | where do i find CUPS? | 01:08 |
| illusions | hell i have no clue its my first day/hour on ubntu | 01:08 |
| === fiendskull9 [n=clayton@12-201-47-48.client.mchsi.com] has joined #ubuntu | ||
| YogSothoth | Is that possible to encode video to a H.264 format, preferably with a using a open source container and codec, and play this video embedded in my web page on all major platforms (linux/windows/macos) ? | 01:08 |
| TSCHAK | haha, go to System->Administration->Printing | 01:08 |
| ghosty | soop: just been looking for sources.list but its not on my system :( just tryed find sources.list | 01:08 |
| fiendskull9 | how do i know which IP address to forward a port too on my router? | 01:09 |
| fiendskull9 | is there a command | 01:09 |
| === Hollowman8904 [n=alex@MW-ESR1-72-49-67-231.fuse.net] has joined #ubuntu | ||
| haha | ok i did | 01:09 |
| illusions | heck i think i had this installed for only 30mins i am a ubuntu noob | 01:09 |
| === shachar [n=shachar@bzq-84-108-113-58.cablep.bezeqint.net] has joined #ubuntu | ||
| YogSothoth | And I forget : playable with a buffering (i mean, without waiting for the full video to be downloaded) | 01:09 |
| Hollowman8904 | i have all of my MP3s on a remote computer... I cant seem to let a media program access them | 01:09 |
| ds[de] | ghosty; did you check /etc/apt/sources.list ? | 01:09 |
| TSCHAK | haha, try adding your printer there | 01:09 |
| ghosty | ds[de] : will check there, but find did not pick it up | 01:10 |
| fiendskull9 | Is there a command to know what IP suffix to use for port forwarding? | 01:10 |
| === kozhy [n=kozhy@200.92.244.164] has joined #ubuntu | ||
| haha | ok it asks me for the host | 01:10 |
| fiendskull9 | !IP | 01:10 |
| ubotu | fiendskull9: I haven't a clue, try searching at http://ubuntu.cc.com.au/ | 01:10 |
| Hollowman8904 | can someone help me play my mp3s from a networked computer | 01:10 |
| ghosty | ds[de] @ yes it is there, thanks | 01:11 |
| fiendskull9 | !Port | 01:11 |
| ubotu | Did you get hit by a windmill? Try searching at http://ubuntu.cc.com.au/, fiendskull9 | 01:11 |
| fiendskull9 | !ports | 01:11 |
| ubotu | Syntax error in line 1. Try searching at http://ubuntu.cc.com.au/, fiendskull9 | 01:11 |
| TSCHAK | haha, put the name of your windows PC | 01:11 |
| === eduardo [n=eduardo@201.153.243.190] has joined #ubuntu | ||
| Hollowman8904 | somehow mount the share so that this box thinks its a local drive | 01:11 |
| axl000 | how can i know my actual cpu frequency and temperature??? | 01:11 |
| TSCHAK | haha, the network name you gave it | 01:11 |
| TSCHAK | haha, if your machine is properly scanning, it may appear in the drop down list | 01:11 |
| JLiquorish | anyone know a good kvm that will work with ubuntu and suse? | 01:11 |
| ds[de] | haha you really should change your name, every time someone is adressing you I'm trying to find out what's so funny ;) | 01:11 |
| phlaegel | Do I need netatalk to share files/printers with OSX? | 01:11 |
| === MartinR [n=admin@81-236-27-26-no47.tbcn.telia.com] has joined #ubuntu | ||
| TSCHAK | phlaegel, no | 01:11 |
| === me2win [n=Roberto@adsl-69-152-254-245.dsl.snantx.swbell.net] has joined #ubuntu | ||
| TSCHAK | phlaegel, OS X uses CUPS | 01:12 |
| haha | ok | 01:12 |
| TSCHAK | phlaegel, so if you have your printer set up on your linux machine, and it's set to broadcast.... | 01:12 |
| === MartinRandau [n=admin@81-236-27-26-no47.tbcn.telia.com] has joined #ubuntu | ||
| TSCHAK | phlaegel, your OS X machine will simply detect the printer | 01:12 |
| kyncani | axl000: cpu freq -> cpufrequtils | 01:12 |
| === prxq__ [n=prxq@145.120.1.185] has joined #ubuntu | ||
| === kill_switch [n=tylerdur@www.rudolfinum.sth.ac.at] has left #ubuntu [] | ||
| Hollowman8904 | how can i mount a network share into my /media folder | 01:12 |
| Hollowman8904 | so that the computer thinks its local | 01:13 |
| phlaegel | that's what I thought... but my printen only shows up on other linux boxes, not osx | 01:13 |
| === UncleD [n=uncled@unaffiliated/uncled] has joined #ubuntu | ||
| UncleD | I'm running breezy. How do i switch my source temporarily to dapper drake? | 01:13 |
| TSCHAK | phlaegel, i can't remember if you have to turn on file/printer sharing in the sharing panel or not.. i've got like 50 billion things on my mind :-) | 01:13 |
| UncleD | dapper i mean | 01:13 |
| === jmworx [n=jmworx@theorix.CeNTIE.NET.au] has joined #ubuntu | ||
| seraphim | temporarily? | 01:13 |
| TSCHAK | you really don't wanna do that, UncleD.... | 01:13 |
| UncleD | Im only grabbing a single item | 01:13 |
| TSCHAK | UncleD, that is a recipe for certain destruction | 01:13 |
| phlaegel | TSCHAK: good to know it should work though... thanks | 01:14 |
| niki | my web browser appears to be running waaaay slow, especially compared to the speed my browser runs on my windows machine...is there something i can do to speed this up? | 01:14 |
| kyncani | UncleD: could not find the item in backports ? | 01:14 |
| TSCHAK | UncleD, you might as well switch repos and do apt-get dist-upgrade | 01:14 |
| UncleD | and switch from breezy to dapper? | 01:14 |
| MartinRandau | alsamixer: function snd_ctl_open failed for default: No such file or directory | 01:14 |
| MartinRandau | - Can someone help me with this? | 01:14 |
| === laffer-pt [n=laffer@bl6-207-199.dsl.telepac.pt] has joined #ubuntu | ||
| TSCHAK | UncleD, yup | 01:14 |
| UncleD | tschak, how likely is doing that to break stuff? | 01:14 |
| laffer-pt | hi.. can anyone tell me how do I know the firmware of my modem-router? | 01:15 |
| === Draconicus [n=ubuntu@c-24-131-173-31.hsd1.ma.comcast.net] has joined #ubuntu | ||
| === trainer [n=dave@65-117-135-105.dia.static.qwest.net] has left #ubuntu [] | ||
| TheFaction20 | hey guys...everything seems to work fine with the exception of my speakers | 01:15 |
| Draconicus | I need a way to directly copy the exact image of one harddrive to another. The drives are identical. | 01:15 |
| Skinux | haha, still there? | 01:15 |
| TSCHAK | UncleD, .... there's always a chance.. dapper changes rapidly, i get update requests at least once a day | 01:15 |
| zorba64 | UncleD: try it and find out...you know you get to keep both pieces when it breaks | 01:15 |
| haha | yup | 01:15 |
| kyncani | Drac[Server] : dd ? partimage ? | 01:15 |
| Draconicus | TheFaction20, it is possible that your sound card is not supported. | 01:15 |
| TheFaction20 | draconicus | 01:16 |
| === poningru [n=poningru@n128-227-55-122.xlate.ufl.edu] has joined #ubuntu | ||
| TheFaction20 | woops | 01:16 |
| Skinux | haha, sorry ... have to reboot the windows box | 01:16 |
| Draconicus | kyncani, again, the EXACT IMAGE, not a partition. | 01:16 |
| TheFaction20 | draconicus:its creative | 01:16 |
| TSCHAK | UncleD, but I run dapper on both my home machine, and my work laptop, and it seems to run fine. | 01:16 |
| UncleD | TSCHAK: ah. | 01:16 |
| kyncani | Draconicus: dd. | 01:16 |
| haha | skinux , what? | 01:16 |
| === SoapBath [n=daniel@85-210-56-185.dsl.pipex.com] has joined #ubuntu | ||
| SoapBath | Hey | 01:16 |
| UncleD | TSCHAK: how much of a download is the upgrade? | 01:16 |
| === physicsmastah [n=admin@81-236-27-26-no47.tbcn.telia.com] has joined #ubuntu | ||
| Skinux | haha, reboot MY windows box ... I use jetdirect | 01:16 |
| SoapBath | How do I upgrade from Hedgehog to Breezy? (I am a newbie) | 01:17 |
| Skinux | haha, most of the time! | 01:17 |
| TSCHAK | UncleD, don't know.. I'm gonna guess about 400 megs worth of stuff. I installed dapper from CD | 01:17 |
| Draconicus | kyncani, how, exactly? I need to copy the master boot record and such... I've looked over the dd manual, and I've still had no success. Mind helping me out? | 01:17 |
| Draconicus | Also, how do I unmount swap? | 01:17 |
| === Nakkel^ [n=nakkel@vektori.com] has joined #ubuntu | ||
| TSCHAK | UncleD, and i've had roughly about 400 megs worth of upgrades in the time since I upgraded. | 01:17 |
| === relbs [n=ubuntu@pdpc/supporter/student/relbs] has joined #ubuntu | ||
| TSCHAK | they're working on dapper at light speed. | 01:17 |
| physicsmastah | draconicus: umount /dev/hda2 if swap is on hda2 | 01:17 |
| kyncani | Draconicus: and do that from a live cd, so that no partition are write mounted | 01:17 |
| === ablyss [n=Foobar@71.81.22.108] has joined #ubuntu | ||
| kyncani | Draconicus: dd if=/dev/original_drive of=/dev/dest_drive | 01:18 |
| Draconicus | physicsmastah, I tried that... it said it wasn't mounted, but gparted says that it is. o_O | 01:18 |
| === Tamanoir [n=chouette@lns-bzn-58-82-251-225-127.adsl.proxad.net] has joined #ubuntu | ||
| === Pablo [n=Pablo@03.71.d1c4.cidr.airmail.net] has joined #ubuntu | ||
| SoapBath | How do I upgrade from Hedgehog to Breezy? Help would be loved :) | 01:19 |
| TSCHAK | i can't wait until somebody makes an intelligent drive imaging system for linux... | 01:19 |
| Tamanoir | Yo | 01:19 |
| haha | what is jetdirect? | 01:19 |
| TSCHAK | Norton Ghost works great. | 01:19 |
| Tamanoir | Can someone help me to make my headphones work :/ ? | 01:19 |
| physicsmastah | draconicus: check man swapoff | 01:19 |
| TSCHAK | haha, jetdirect is a way to talk to printers connected directly via a network cable | 01:19 |
| === IoFran [n=Iofran@200.52.78.2] has joined #ubuntu | ||
| Tamanoir | Sounds works but the headphones doesnt | 01:19 |
| haha | o ok | 01:19 |
| haha | thanx | 01:19 |
| nickrud | !tell SoapBath about upgrade | 01:19 |
| TSCHAK | haha, you see it typically on high end inkjets and laser printers. | 01:19 |
| haha | ok | 01:19 |
| UncleD | All i'm looking to do is install the version of ruby that comes with dapper. Any suggestions? | 01:19 |
| haha | thanx for the help and al | 01:19 |
| TSCHAK | haha, it's a very simple protocol that just shoves the print job to the printer, and asks for a status. | 01:19 |
| haha | all | 01:19 |
| nickrud | SoapBath, read the wiki page in the msg from ubotu | 01:20 |
| TSCHAK | haha, no problme. | 01:20 |
| SoapBath | Thanks :) | 01:20 |
| haha | but it didnt work.. o well | 01:20 |
| === IoFran [n=Iofran@200.52.78.2] has left #ubuntu ["Leaving"] | ||
| haha | ill try again later | 01:20 |
| Tamanoir | I wonder if there's driver or something, cause i didnt find anything on wiki or other forums | 01:20 |
| UncleD | TSCHAK: All i'm looking to do is install the version of ruby that comes with dapper. How can I change my sources temporarily to do that? | 01:20 |
| Draconicus | TSCHAK, sure, but only the newest, newest version can handle reiserfs. :| | 01:20 |
| haha | thanx tho bye | 01:20 |
| === mrpister [n=jlee@207-237-76-83.c3-0.nyr-ubr4.nyr.ny.cable.rcn.com] has joined #ubuntu | ||
| kyncani | UncleD: look in backports ? They may have a version high enough | 01:20 |
| UncleD | kyncani: where are they? | 01:20 |
| kyncani | UncleD: google -> ubuntu backports :) | 01:21 |
| TSCHAK | UncleD, trying to install Rails? :-D | 01:21 |
| physicsmastah | what's the likely alsa-driver if i'm running on an old pentium III with a Sounc Blaster 64 sticker on the box? I tried emu10k1 without success,I can't run alsamixer | 01:21 |
| Draconicus | Tamanoir, are you using one of those low-end Dells with a headphone jack mounted on the front of the computer? | 01:21 |
| UncleD | TSCHAK: Rails 1.1 breaks on ruby 1.8.3 | 01:21 |
| Tamanoir | nope, trust USB Draconius | 01:21 |
| ghosty | how do you save changed on vi from console | 01:21 |
| ghosty | sorry im new to linux | 01:21 |
| ghosty | save changes^ | 01:21 |
| === gabbah [n=gabbah@82.99.36.8] has joined #ubuntu | ||
| TSCHAK | UncleD, *nod* I need to figure out how to get a rails environment properly running on my laptop when i get a chance | 01:22 |
| kyncani | ghosty: use nano instead of vi then | 01:22 |
| trappist | ghosty: hit escape then :wq<enter> | 01:22 |
| TSCHAK | UncleD, but I've had to put my rails work on the back burner because my work load is insane. | 01:22 |
| Draconicus | Tamanoir, odd. It should detect most USB audio devices as such... | 01:22 |
| niki | my web browser appears to be running waaaay slow, especially compared to the speed my browser runs on my windows machine...is there something i can do to speed this up? | 01:22 |
| TSCHAK | UncleD, (I am developing an ecommerce engine in rails) | 01:22 |
| useruser | niki: try opera | 01:22 |
| UncleD | kyncani: how can backports help me? backports seem to be for breezy (which I already have?) | 01:22 |
| Draconicus | niki, I wouldn' | 01:22 |
| UncleD | TSCHAK: interesting. substruct is the only one ive seen so far. | 01:22 |
| === niki blinks | ||
| physicsmastah | my experience is that opera takes even longer to startup than firefox | 01:23 |
| TSCHAK | UncleD, substruct isn't really all that interesting.... | 01:23 |
| useruser | niki: firefox is a lot slower under linux than windows | 01:23 |
| UncleD | TSCHAK: nope, it's pretty limited. It's the only one ive seen though. | 01:23 |
| useruser | physicsmastah: long time to start, but fast to use | 01:23 |
| TSCHAK | UncleD, it's really an embeddable engine meant for existing rails projects. | 01:23 |
| niki | useruser, ok...i'll give it a shot, thanks :) | 01:23 |
| kyncani | UncleD: backports offer higher versions of packages compiled for breezy. With any luck, the package you're looking for may be available in a version high enough | 01:23 |
| niki | Draconicus, what would you suggest though, if not opera? | 01:23 |
| TSCHAK | UncleD, I'm writing one which uses AJAX extensively for in-place editing of most common functions on the page itself. | 01:23 |
| physicsmastah | useruser: i agree | 01:23 |
| kozhy | somebody has tried to install Xgl with ATI in Breezy or only in Drapper ? | 01:23 |
| Tamanoir | Draconius : do you think it can be a bad sound device setting ? | 01:23 |
| Draconicus | niki, I wouldn't listen to users of other browsers, if I were you. You'll get the most out of Mozilla browsers. Firefox is oddly resource taxing on Linux. Nobody seems to know why. Classic Mozilla browsers should support the embedded multimedia packages, though. | 01:24 |
| TSCHAK | UncleD, with a floating administration menu (using what I call a floater icon, which stays in window at all times) | 01:24 |
| UncleD | kyncani: W: Couldn't stat source package list http://archive.ubuntu.com breezy-backports/main Packages (/var/lib/apt/lists/archive.ubuntu.com_ubuntu_dists_breezy-backports_main_binary-i386_Packages) - stat (2 No such file or directory) | 01:24 |
| === Istario [n=[tgn] cok@63.201.14.135] has joined #ubuntu | ||
| Tamanoir | I let my device on autodetect...theres more and i dont know if i should try another one of these | 01:24 |
| Draconicus | Tamanoir, please use tab completion. Also, I don't know, at this point. | 01:25 |
| === insidious|zzz [n=dont@24-205-239-49.dhcp.snlo.ca.charter.com] has joined #ubuntu | ||
| useruser | niki: yeah, epiphany is another option, but I've found all gecko browsers slower than opera to some extent. | 01:25 |
| === thoffmeyer is now known as thoffmeyer|AFK | ||
| illusions | i am was looking on ubuntu forums and i lost the link to a app that is like a auto installer | 01:25 |
| illusions | i am just trying to install skype prity much | 01:25 |
| physicsmastah | Does anybody know what kind of sound card "AT-style speaker" in Device Manager sound could be? I'm trying to get alsa running and I'm getting quite desperate | 01:25 |
| UncleD | what's up with this? | 01:25 |
| UncleD | Failed to fetch http://archive.ubuntu.com/ubuntu/breezy/dists/main/restricted/binary-i386/Packages.gz 404 Not Found [IP: 82.211.81.151 80] | 01:25 |
| Tamanoir | Where is usb tab completion ? | 01:26 |
| kyncani | UncleD: well, i don't have a breezy sources.list with backports right now with me, but you should find the exact repo line somewhere on the net | 01:26 |
| niki | useruser, does epiphany support tabbed browsing? | 01:26 |
| useruser | niki: yes | 01:26 |
| Draconicus | Tamanoir, what? | 01:26 |
| illusions | any takers? want to help? :/ | 01:26 |
| Draconicus | niki, epiphany will also be more limited than gecko browsers. | 01:26 |
| TSCHAK | illusions, the best way to install skype is this: | 01:26 |
| physicsmastah | AT-style speaker? Anyone? | 01:26 |
| TSCHAK | illusions, (1) grab the fedora core RPM | 01:26 |
| Skinux | haha, not having too much luck! let me try one more thing | 01:26 |
| useruser | Draconicus: epiphany is a gecko browser | 01:27 |
| illusions | ok | 01:27 |
| TSCHAK | illusions, (2) install the alien package from synaptic | 01:27 |
| Draconicus | useruser: ...Oh. >_> | 01:27 |
| niki | :P | 01:27 |
| === jdon [n=jordan@pool-141-156-94-121.res.east.verizon.net] has joined #ubuntu | ||
| TSCHAK | illusions, (3) in a terminal type alien --install skype_whatever_the_package_is.rpm | 01:27 |
| TSCHAK | illusions, done. | 01:27 |
| useruser | Draconicus: you want a non-gecko browser which is lightning fast, try dillo | 01:27 |
| Draconicus | niki, ignore my last moment of ignorance. I know little about epiphany. I just don't like how it performs. | 01:27 |
| UncleD | How do I fix this error: Failed to fetch http://archive.ubuntu.com/ubuntu/breezy/dists/main/multiverse/binary-i386/Packages.gz 404 Not Found [IP: 82.211.81.151 80] | 01:27 |
| === j4k [i=j4k@putty.ca] has joined #ubuntu | ||
| Draconicus | useruser, who said I wanted a non-gecko browser? I want embedded media. | 01:27 |
| useruser | Draconicus: i know :) | 01:28 |
| niki | Draconicus, ok, so what would you suggest then, as a replacement for firefox? i want to try a few out, see which performs the best | 01:28 |
| illusions | thanks tschak | 01:28 |
| TSCHAK | illusions, np, the same procedure works well for limewire as well | 01:28 |
| === joha [n=joha@p549D60B1.dip.t-dialin.net] has joined #ubuntu | ||
| joha | Hi all! | 01:28 |
| jdon | im tryin to access files from my ubuntu computer on my windows pc and when i go to my netowrk places it shows the ubuntu computer there but when i click on it it asks for a user name and password and when i type it in nothing happens | 01:28 |
| illusions | nice :) | 01:28 |
| Draconicus | niki, I don't know, honestly. I use Firefox. I would maybe suggest Mozilla 1.x or something. | 01:28 |
| === johwil [n=orlando@h213n1fls34o811.telia.com] has joined #ubuntu | ||
| === Eleaf [n=ethan@71-208-126-224.hlrn.qwest.net] has left #ubuntu ["Leaving"] | ||
| === obontu [n=obontu@80.179.185.46.static.012.net.il] has joined #ubuntu | ||
| useruser | niki: your options are: epiphany, galeon, mozilla, opera, konqueror, ... | 01:29 |
| joha | Can somebody help me make WiFi work in Dapper? It worked during the installation, and also worked perfectly for Hoary, out of the box. | 01:29 |
| TSCHAK | i find it very ironic when commercial apps are concerned, that the rpm packages work better than the debian packages.. hehehe | 01:29 |
| ghosty | thanks for the help, sorted it out now .... nice soop and ds[de] | 01:29 |
| niki | thanks useruser :):) | 01:29 |
| === Eleaf [n=ethan@71-208-126-224.hlrn.qwest.net] has joined #ubuntu | ||
| jdon | im tryin to access files from my ubuntu computer on my windows pc and when i go to my netowrk places it shows the ubuntu computer there but when i click on it it asks for a user name and password and when i type it in nothing happens | 01:29 |
| obontu | hello, i just installed ubuntu,dual booting with xp, and i can see my xp partitions on my desktop, how can i make them go away for good? | 01:29 |
| ghosty | is it me or does ubuntu look really boring !!! | 01:29 |
| === estudio [n=estudio@138.red-62-57-7.user.auna.net] has joined #ubuntu | ||
| useruser | ghosty: it's just you, but don't worry about it. :) | 01:29 |
| jdon | i need sum help please | 01:29 |
| TSCHAK | ghosty, well, in my opinion, Windows looks like a circus clown got hit by a bus. | 01:30 |
| ghosty | useruser.... hahaha | 01:30 |
| === beefsprocket [n=beefspro@74.12.74.148] has left #ubuntu ["left] | ||
| obontu | how do i make my ubuntu not displaying the windows xp partitions on it's desktop? | 01:30 |
| === johwil [n=orlando@h213n1fls34o811.telia.com] has left #ubuntu [] | ||
| jdon | im tryin to access files from my ubuntu computer on my windows pc and when i go to my netowrk places it shows the ubuntu computer there but when i click on it it asks for a user name and password and when i type it in nothing happens | 01:30 |
| ds[de] | ghosty; no problem | 01:30 |
| jdon | i need sum help please | 01:30 |
| === cmatheson [n=cmatheso@71-35-228-30.slkc.qwest.net] has joined #ubuntu | ||
| === mrpister [n=jlee@207-237-76-83.c3-0.nyr-ubr4.nyr.ny.cable.rcn.com] has left #ubuntu [] | ||
| ghosty | i just insatlled unbuntu on an old pc that i just build back up ... its on a AMD 400mhz | 01:30 |
| Amaranth | ok | 01:31 |
| TSCHAK | ghosty, cool | 01:31 |
| jdon | im tryin to access files from my ubuntu computer on my windows pc and when i go to my netowrk places it shows the ubuntu computer there but when i click on it it asks for a user name and password and when i type it in nothing happens | 01:31 |
| Amaranth | ghosty: how is it? | 01:31 |
| joha | ghosty: Dapper at least looks anything but boring. Plus, there's always the option of changing the default looks. Well, on a 400MHz box you're borked anyway. | 01:31 |
| === jk- [n=jk@bh02i525f01.au.ibm.com] has joined #ubuntu | ||
| jdon | i need sum help please | 01:31 |
| ghosty | trying to type in the dark with a black keyboard... so typo might be bad... hahaha | 01:31 |
| Amaranth | !ask | 01:31 |
| Amaranth | arg, who made ask so huge? | 01:31 |
| Sergi0 | TSCHAK about NX, witch client u use for dapper, im trying an test driver from nomachine at the mo | 01:32 |
| === jk- [n=jk@bh02i525f01.au.ibm.com] has left #ubuntu [] | ||
| jdon | dudes i need help!! | 01:32 |
| TSCHAK | Sergi0, the nomachine NX Client | 01:32 |
| joha | HELP, please? | 01:32 |
| ghosty | i need one of them keyboards with backlights in the keys | 01:32 |
| Draconicus | joha, I run Dapper as a temporary X server on a 400Mhz box at my school. :) | 01:32 |
| === thoffmeyer|AFK is now known as thoffmeyer | ||
| Sergi0 | TSCHAK :P i figured that out :) but i have some isues installing the deb | 01:32 |
| === carthik [n=carthik@user-0cej755.cable.mindspring.com] has joined #ubuntu | ||
| TSCHAK | Sergi0, I alien-install the fedora core RPMs, and it works best. | 01:32 |
| TSCHAK | Sergi0, don't use the deb | 01:32 |
| === Randy [n=andrew@203.184.36.229] has joined #ubuntu | ||
| TSCHAK | Sergi0, i doesn't work | 01:33 |
| jdon | guys, im tryin to access files from my ubuntu computer on my windows pc and when i go to my netowrk places it shows the ubuntu computer there but when i click on it it asks for a user name and password and when i type it in nothing happens, can somone please help me | 01:33 |
| Draconicus | joha: And it's a celeron. XP | 01:33 |
| === axl000 [n=axl@93-51-89.adsl.terra.cl] has left #ubuntu ["Leaving"] | ||
| === seraphim [n=seraphim@dslb-088-072-196-174.pools.arcor-ip.net] has joined #ubuntu | ||
| Sergi0 | TSCHAK oh, does debian does rpm then? (thats new to me) | 01:33 |
| === honkzilla is now known as honk|afk | ||
| Skinux | haha, still there? | 01:33 |
| === swoop [n=swoop@cm-bnas1-tic-C8B18806.dynamic.brdterra.com.br] has joined #ubuntu | ||
| jdon | skinux, i changed my name | 01:34 |
| jdon | to jdon | 01:34 |
| === iGotNoTime [n=joshua@cpe-65-189-240-199.woh.res.rr.com] has joined #ubuntu | ||
| === Fenixx [n=c9d0c8a9@usal.ssl-connection.com] has joined #ubuntu | ||
| torque | aaaaaaaaaa | 01:34 |
| swoop | hi... does anyone could explain me how to install nvidia's driver in ubuntu? | 01:34 |
| iGotNoTime | Can I please get some sound device help? | 01:34 |
| === duelboot [n=duelboot@72-255-86-124.client.stsn.net] has joined #ubuntu | ||
| jdon | someone please help me im tryin to access files from my ubuntu computer on my windows pc and when i go to my netowrk places it shows the ubuntu computer there but when i click on it it asks for a user name and password and when i type it in nothing happens | 01:34 |
| Draconicus | iGotNoTime, do you have time? :P | 01:35 |
| === cafuego_ [n=cafuego@202.155.163.65] has joined #ubuntu | ||
| kyncani | swoop: it's all explained in ubuntu wiki :) | 01:35 |
| === TSCHAK2 [n=thomas@24-53-91-155.clspco.adelphia.net] has joined #ubuntu | ||
| ghosty | swoop: ndswrapper, i think its called lets you use windows .ini in linux | 01:35 |
| iGotNoTime | I bought a new USB headtset and it works, but I can't change the audio device in Skype or any SIP phone devices | 01:35 |
| jdon | im tryin to access files from my ubuntu computer on my windows pc and when i go to my netowrk places it shows the ubuntu computer there but when i click on it it asks for a user name and password and when i type it in nothing happens | 01:35 |
| jdon | im tryin to access files from my ubuntu computer on my windows pc and when i go to my netowrk places it shows the ubuntu computer there but when i click on it it asks for a user name and password and when i type it in nothing happens | 01:35 |
| jdon | im tryin to access files from my ubuntu computer on my windows pc and when i go to my netowrk places it shows the ubuntu computer there but when i click on it it asks for a user name and password and when i type it in nothing happens | 01:35 |
| jdon | im tryin to access files from my ubuntu computer on my windows pc and when i go to my netowrk places it shows the ubuntu computer there but when i click on it it asks for a user name and password and when i type it in nothing happens | 01:35 |
| TSCHAK2 | jdon, calm down | 01:35 |
| niki | ack | 01:35 |
| ghosty | i think thats what its called | 01:35 |
| iGotNoTime | bye jdon | 01:35 |
| TSCHAK2 | jdon, CALM DOWN | 01:35 |
| LadyNikon | ok | 01:35 |
| jdon | ok | 01:35 |
| TSCHAK2 | jdon, are you sharing anythng? | 01:35 |
| niki | it's cool, dude! :D | 01:35 |
| jdon | yes | 01:35 |
| swoop | kyncani, sorry, but, what is it? :( | 01:36 |
| LadyNikon | In order to build the VPN kernel module, you must have theI need to answer this question.. | 01:36 |
| LadyNikon | kernel headers for the version of the kernel you are running. | 01:36 |
| kyncani | swoop: it's all explained in ubuntu wiki :) | 01:36 |
| Fenixx | somebody can say to me since I make to know the amount megas that I am lowering in a connection to Internet I talk about to a connection via moden external connected to the computer by network cable | 01:36 |
| === ptlo [n=senko@83-131-77-16.adsl.net.t-com.hr] has joined #ubuntu | ||
| === arrick [n=arrick@198.110.32.2] has joined #ubuntu | ||
| cafuego_ | vpn kernel module? | 01:36 |
| Tamanoir | Where are the USB settings in KDE please ? | 01:36 |
| TSCHAK2 | jdon, you've right clicked a folder, and gone into Share Folder ? | 01:36 |
| LadyNikon | jdon: wt.. | 01:37 |
| jdon | yes | 01:37 |
| IdleOne | Fenixx, where are you from? what country? | 01:37 |
| TSCHAK2 | jdon, hmm | 01:37 |
| swoop | what is ubuntu wiki? | 01:37 |
| ghosty | this old machine is slow as crap!!!!!, makes me see how much computers have come on since the time i had this computer years ago | 01:37 |
| cafuego_ | wiki.ubuntu.com | 01:37 |
| swoop | thanks! ;) | 01:37 |
| === relbs [n=ubuntu@pdpc/supporter/student/relbs] has left #ubuntu [] | ||
| duelboot | help...I can't get the mic working. I was able to get the speakers working, but mic still won't. Made some changes, but think it just may be a bad setting that can be fixed in alsamixer...anyone have an answer? | 01:37 |
| IdleOne | swoop, wiki is a collection of helpfull web pages wiki.ubuntu.com | 01:38 |
| === Kanalal [n=Kanalal@ACBC4A56.ipt.aol.com] has joined #ubuntu | ||
| LadyNikon | does anyone know? | 01:38 |
| === gabbah_ [n=gabbah@82.99.36.8] has joined #ubuntu | ||
| cafuego_ | duelboot: make sure the input isn't muted and turn the gain up a bit | 01:38 |
| === thomas [n=thomas@c-68-33-228-218.hsd1.md.comcast.net] has joined #ubuntu | ||
| swoop | IdleOne ok! thanks ;) | 01:38 |
| duelboot | checking cafuego | 01:38 |
| thomas | anyone here know how to use samba? | 01:38 |
| === gabbah [n=gabbah@82.99.36.8] has joined #ubuntu | ||
| iGotNoTime | duelboot: I am here with sound problems too :( | 01:38 |
| ghosty | yey! got nmap :) love it | 01:38 |
| arrick | !samba | 01:38 |
| ubotu | I guess samba is https://wiki.ubuntu.com/SettingUpSamba or https://wiki.ubuntu.com/MountWindowsSharesPermanently | 01:38 |
| ghosty | anyways im off laterzzzzzzz | 01:38 |
| iGotNoTime | thomas that is a big question :) | 01:38 |
| arrick | thomas, this is for you !samba | 01:39 |
| thomas | i need a bit of help viewing windows comps on network/share my stuff im running on linux | 01:39 |
| arrick | !samba | 01:39 |
| Fenixx | idleone: I am of Venezuela, excuses if my ingles is not very clear | 01:39 |
| duelboot | cafuego_ any suggestions for the best interface...is alsamixer okay | 01:39 |
| === Kanalal [n=Kanalal@ACBC4A56.ipt.aol.com] has left #ubuntu [] | ||
| === amphi [n=amphi@unaffiliated/amphi] has joined #ubuntu | ||
| cafuego_ | duelboot: whatever changes alsa settings is fine | 01:39 |
| IdleOne | Fenixx, non te preocupas amigo escribe /j #ubuntu-es por ajuda | 01:39 |
| cafuego_ | hrm | 01:40 |
| LadyNikon | bleh | 01:40 |
| cafuego_ | LadyNikon: Does anyone know what? | 01:40 |
| Fenixx | Idleone: gracias | 01:40 |
| LadyNikon | it seems I dont have a /usr/src/linux directory | 01:40 |
| cafuego_ | LadyNikon: What are you compiling? | 01:40 |
| LadyNikon | i am trying to get vpnc up and running | 01:40 |
| arrick | How do I get a .jpg to automatically insert every time I send a new email? | 01:40 |
| LadyNikon | kernel headers for the version of the kernel you are running. | 01:40 |
| arrick | it's a business card | 01:40 |
| TheFaction20 | hey guys i seem to have just about everything working with the exception of my speakers. i have a creative sound card | 01:41 |
| LadyNikon | it wants to know ^ | 01:41 |
| arrick | in the evolution program | 01:41 |
| cafuego_ | May I recommend openvpn? (No kernel stuff required) | 01:41 |
| === ubuntu [n=ubuntu@c-24-23-86-103.hsd1.tx.comcast.net] has joined #ubuntu | ||
| LadyNikon | cafuego_: my company requires certain thing | 01:41 |
| cafuego_ | LadyNikon: ANyway, you'd need 'kernel-headers-$(uname -r)' | 01:41 |
| === Fenixx [n=c9d0c8a9@usal.ssl-connection.com] has left #ubuntu [] | ||
| === new_2_ubuntu [n=master@c-67-191-86-100.hsd1.fl.comcast.net] has joined #ubuntu | ||
| === s0ciopath [n=user@net34-155.netkaster.ca] has joined #ubuntu | ||
| === Dann0 [n=danny@gndrnfxa-13-142163017046.nf.sympatico.ca] has joined #ubuntu | ||
| duelboot | cafuego_ no luck...mic is unmuted, but don't get sound...I get sound with my media players so it's some other input issue | 01:42 |
| LadyNikon | cafuego_: is that what i run? | 01:42 |
| LadyNikon | or is that what I put in there? | 01:42 |
| TheFaction20 | hey guys i seem to have just about everything working with the exception of my speakers. i have a creative sound card | 01:43 |
| LadyNikon | heh | 01:43 |
| LadyNikon | sound + linux | 01:43 |
| thomas | how do i get into smb thru nautilus anyone know the command offhand? | 01:43 |
| thomas | i remember somethign like | 01:43 |
| === amphi wonders why ubuntu lacks alsaconf | ||
| === LeeJunFan [n=junfan@adsl-69-210-207-5.dsl.klmzmi.ameritech.net] has joined #ubuntu | ||
| === folki [n=folki@foxik.ynet.sk] has joined #ubuntu | ||
| arrick | How do I get a .jpg to automatically insert every time I send a new email? I want to insert a business card, and I'm using the evolution program in ubuntu. | 01:44 |
| thomas | nautilus smb:// or somethign in the terminal | 01:44 |
| duelboot | TheFaction20, I got my speakers to work by using alsamixer...change headphone to Rear Jac and the rear jack to mixer output...it worked for me anyway, but my mic still doesn't work | 01:44 |
| === ep [n=mdr@ip68-97-122-135.ok.ok.cox.net] has joined #ubuntu | ||
| LadyNikon | cafuego_: i get Directory "kernel-headers-2.6.12-10-386" doesn't exist | 01:45 |
| === ep [n=mdr@ip68-97-122-135.ok.ok.cox.net] has left #ubuntu ["Left] | ||
| IdleOne | arrick, in evolution settings you can setup a signature. not sure exactly where but it is in there | 01:45 |
| === panzer [n=panzer@130-126-246-201.adsl.terra.cl] has joined #ubuntu | ||
| folki | does anybody use dapper draker? | 01:45 |
| IdleOne | !dapper | 01:45 |
| ubotu | Dapper Drake will be the next release of Ubuntu - due June 1 (see: http://tinyurl.com/qyrkq). Join channel #ubuntu+1 for discussion :) | 01:45 |
| TheFaction20 | duelboot:where do i find/get alsamixer? | 01:45 |
| arrick | ok,thanks idelone | 01:45 |
| amphi | TheFaction20: alsa-utils IIRC | 01:46 |
| folki | yes but alpha version exists | 01:46 |
| === stpere [n=stpere@ts1-136.f1232.ts.globetrotter.net] has joined #ubuntu | ||
| niki | help! after installing allegro, i got a thing at the end...something about adding it to my path before i can run an allegro app..can someone help me with this? | 01:46 |
| IdleOne | folki, join #ubuntu+1 for help with dapper ( flight5 ) | 01:47 |
| TSCHAK2 | thomas, two ways... (1) connect to server inside the Go menu | 01:47 |
| TSCHAK2 | thomas, or Open Location.. then smb://computer/share | 01:47 |
| thomas | i figured it out | 01:48 |
| === harre [i=xircon@ua-83-227-135-153.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| TheFaction20 | amphi:i dont seem to understand | 01:48 |
| duelboot | TheFaction20: sudo apt-get install gnome-alsamixer | 01:48 |
| === new-2-ubuntu [n=master@c-67-191-86-100.hsd1.fl.comcast.net] has joined #ubuntu | ||
| panzer | sudo apt-get install gnome-alsamixer???? what is? | 01:49 |
| duelboot | panzer: app for setting up sound | 01:49 |
| harre | I have a issue with my LCD monitor, when I try to install ubuntu I only get a flickering screen, but it works perfectly with my CRT monitor, anyone know how to fix it? | 01:49 |
| LadyNikon | its the alsa mixer for gnome? | 01:49 |
| duelboot | LadyNikon yes | 01:49 |
| LadyNikon | harre: settings. | 01:49 |
| new-2-ubuntu | hello, I need too know how 2 allow access 2 my smb shares.. I got em shared but need a login | 01:49 |
| amphi | TheFaction20: the alsa-utils package contains alsamixer, I believe | 01:50 |
| panzer | duelboot ok | 01:50 |
| new-2-ubuntu | I forgot how :( | 01:50 |
| harre | LadyNikon: what setting? | 01:50 |
| TheFaction20 | amphi:it says package not found | 01:50 |
| new-2-ubuntu | my monithor doesnt go under 1024 768 anymore, might be monitor problems | 01:50 |
| niki | help! after installing allegro, i got a thing at the end...something about adding it to my path before i can run an allegro app..can someone help me with this? | 01:50 |
| Sergi0 | TSCHAK2 i've installed the deb, looking around on an testserver, the speed is real nice | 01:51 |
| === [1] wenko [n=wenko@142.232.8.200] has joined #ubuntu | ||
| amphi | TheFaction20: you have your sources.list set up properly? | 01:51 |
| === unf [n=unf@ZMMMDCXL.dsl.saunalahti.fi] has joined #ubuntu | ||
| cmatheson | i'm using maildrop to filter mail from my imap account into various folders... for some reason i can't access them all though. if i try to open the 'Backup' folder for example, it says that the "Mailbox does not exist, or must be subscribed to" | 01:51 |
| TheFaction20 | amphi:idk | 01:51 |
| new-2-ubuntu | I am runnning ubuntu gnome on breezy badger, how do I make a login for networking?? Ihad 2 re-install & forgot how :( | 01:51 |
| amphi | TheFaction20: ? | 01:52 |
| === panzer [n=panzer@130-126-246-201.adsl.terra.cl] has left #ubuntu ["Abandonando"] | ||
| new-2-ubuntu | I have the folder shared | 01:52 |
| new-2-ubuntu | smb share | 01:52 |
| TheFaction20 | amphi:im not familiar with my source list | 01:52 |
| TheFaction20 | amphi:ive barely been using this for a week | 01:52 |
| amphi | !sources.list | 01:52 |
| ubotu | To enable Universe and Multiverse see http://wiki.ubuntu.com/AddingRepositoriesHowto - Official sources.lists here: http://paste.ubuntu-nl.org/6047 (Breezy) or http://paste.ubuntu-nl.org/6666 (Dapper) see also !easysource | 01:52 |
| bimberi | new-2-ubuntu: not sure what you mean. do you want to log in from another computer? | 01:52 |
| amphi | TheFaction20: ^^ | 01:52 |
| new-2-ubuntu | yes | 01:52 |
| === fiendskull9 [n=clayton@12-201-47-48.client.mchsi.com] has joined #ubuntu | ||
| new-2-ubuntu | cannot login from a windows box | 01:53 |
| fiendskull9 | how do i set gaim to use /dev/dsp instead of dsp0? | 01:53 |
| harre | LadyNikon: what setting? | 01:53 |
| === ctooley [n=ctooley@rrcs-24-227-212-172.sw.biz.rr.com] has joined #ubuntu | ||
| new-2-ubuntu | I have a smb share established but forgot how 2 make the login for it | 01:53 |
| bimberi | new-2-ubuntu: do you want a GUI or command-line access? | 01:53 |
| === ruggy [n=Rulon@66.199.118.2] has left #ubuntu ["Leaving"] | ||
| new-2-ubuntu | I know there is a setting 2 specify users & pass for the share but forgot how | 01:54 |
| TheFaction20 | amphi:what do i do with this | 01:54 |
| TSCHAK2 | Sergi0, :-) | 01:54 |
| new-2-ubuntu | gui | 01:54 |
| new-2-ubuntu | I dont like the terminal :( | 01:54 |
| niki | help! after installing allegro, i got a thing at the end...something about adding it to my path before i can run an allegro app..can someone help me with this? i just need to know how to edit my path i think...i pasted the output, it's at http://paste.ubuntu-nl.org/11075 | 01:54 |
| bimberi | new-2-ubuntu: ahh, 'sudo smbpasswd -a <username>' | 01:54 |
| === munkie2 [n=munkie2@70.230.149.88] has joined #ubuntu | ||
| harre | I have a issue with my LCD monitor, when I try to install ubuntu I only get a flickering screen, but it works perfectly with my CRT monitor, anyone know how to fix it? | 01:55 |
| === regeya [n=shane@dialup-4.159.59.164.Dial1.Chicago1.Level3.net] has joined #ubuntu | ||
| duelboot | help: speakers working, but mic input is not...any suggestions? | 01:55 |
| new-2-ubuntu | ok got it thx | 01:56 |
| blacknight | duelboot, I have the same issue :) | 01:56 |
| new-2-ubuntu | now how do Ido that for printers? | 01:56 |
| new-2-ubuntu | I got networked printer | 01:57 |
| amphi | TheFaction20: I'm not on ubuntu ATM - if apt-cache search alsa-utils shows no such package, you need to fix up your sources.list & run apt-cache update, I expect - ask uboto about easysource | 01:57 |
| bimberi | new-2-ubuntu: XP? | 01:57 |
| new-2-ubuntu | do Ijust use smbpasswd ?? | 01:57 |
| new-2-ubuntu | hell no | 01:57 |
| bimberi | lol | 01:57 |
| new-2-ubuntu | xp = gaynes :p I use windows 2000 | 01:57 |
| TheFaction20 | amphi:it found it | 01:57 |
| === j_ack [n=nico@p508D9211.dip0.t-ipconnect.de] has joined #ubuntu | ||
| TheFaction20 | amphi:now how do i access it? | 01:57 |
| bimberi | new-2-ubuntu: hmmk. I think this is still applicable ... | 01:58 |
| bimberi | !xpprint | 01:58 |
| ubotu | Printing from ubuntu to an XP connected printer - https://wiki.ubuntu.com/WindowsXPPrinter. Printing from XP to an ubuntu connected printer - https://wiki.ubuntu.com/NetworkPrintingFromWinXP | 01:58 |
| === nazty [n=fed@24.115.208.241.res-cmts.sth.ptd.net] has joined #ubuntu | ||
| amphi | TheFaction20: did you install the package? | 01:58 |
| === dennis999 [n=dennis@dialup-4.235.196.126.Dial1.Orlando1.Level3.net] has joined #ubuntu | ||
| new-2-ubuntu | another problem it has hp photosmart 7960 not 7900 will it matter?? | 01:58 |
| nazty | can anyone help me out with my gcc compiler? | 01:58 |
| === whyami [n=john@ip68-102-185-15.ks.ok.cox.net] has joined #ubuntu | ||
| niki | help! after installing allegro, i got a thing at the end...something about adding it to my path before i can run an allegro app..can someone help me with this? i just need to know how to edit my path i think...i pasted the output, it's at http://paste.ubuntu-nl.org/11075 | 01:58 |
| === harre [i=xircon@ua-83-227-135-153.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| amphi | TheFaction20: otherwise, do apt-get install alsa-utils to install it | 01:59 |
| munkie2 | nazty, whats the problem? | 01:59 |
| nazty | im trying to compile the latest version of epic5 | 01:59 |
| nazty | and when i sh configure | 01:59 |
| nazty | configure: error: installation or configuration problem: C compiler cannot create executables. | 01:59 |
| === omer [n=omer@toronto-HSE-ppp4329650.sympatico.ca] has joined #ubuntu | ||
| TheFaction20 | amphi:i found that it was installed apparently | 01:59 |
| nazty | heres the whole | 01:59 |
| nazty | checking for gcc... gcc | 01:59 |
| nazty | checking whether the C compiler (gcc ) works... no | 01:59 |
| nazty | configure: error: installation or configuration problem: C compiler cannot create executables. | 01:59 |
| bimberi | new-2-ubuntu: yes try the nearest driver, usually works OK. If not search for a PPD file at HP's website or linuxprinting.org | 01:59 |
| Falstius | nazty: did you install the compiler? | 02:00 |
| nazty | yes | 02:00 |
| amphi | TheFaction20: so what's the problem? if you type alsamixer in a term, you get an error? | 02:00 |
| nazty | off synaptics | 02:00 |
| nazty | gcc4 | 02:00 |
| === LathropWells [n=bill@cpe-72-134-66-177.socal.res.rr.com] has joined #ubuntu | ||
| Falstius | nazty, you should install "build-essential" | 02:00 |
| nazty | its there | 02:00 |
| bimberi | nazty: install 'build-essential' and retry | 02:00 |
| nazty | ok | 02:01 |
| new-2-ubuntu | Gah I cannot access my printer from a pc upstairs... do I sue that pc's network login or must use one I made for smb | 02:01 |
| kbrooks | Mirrored - avoiding centralization: centraization is a central point of failure: #mirrored | 02:01 |
| === gfxstyler [n=gfxstyle@i577A5D09.versanet.de] has joined #ubuntu | ||
| gfxstyler | hi there | 02:01 |
| nazty | ok im installing right now | 02:01 |
| gfxstyler | is the icon for the gnome-battery-monitor hardcoded? i can't seem to find it anywhere | 02:02 |
| nazty | ahhhh | 02:02 |
| Falstius | nazty, did you notice how much space it said it would use? | 02:02 |
| nazty | you guys are great | 02:02 |
| arrick | IdleOne, I got the signature created with the jpg in it, and inserted it, and I dont see it when I open the email I sent to myself as a test message | 02:02 |
| arrick | what next | 02:02 |
| nazty | it got past the part in configure | 02:02 |
| === mklebel [n=mklebel@206.9.88.86] has joined #ubuntu | ||
| arrick | !pastebin | 02:02 |
| ubotu | well, pastebin is a site where you can post large texts and screenshots so you don't flood the channel. You can find it at http://paste.ubuntu-nl.org - You can install webboard for easy pasting from the gnome taskbar | 02:02 |
| === Chris_Tucker [n=ChrisTuc@stjhnf01-22-142163031164.nf.sympatico.ca] has joined #ubuntu | ||
| IdleOne | arrick, I really dont know I dont use any signatures | 02:03 |
| arrick | ok | 02:03 |
| ctooley | I'm having trouble trying to isntall to a haddrive. It says it can't find /dev/ram when I choose "Install to a hard disk" and gives me a shell | 02:03 |
| arrick | Anyone good with evolution? | 02:03 |
| Falstius | arrick: it is entirely possible that pictures embedded in email are blocked. | 02:03 |
| new-2-ubuntu | I have pinter installed but failes 2 print :( | 02:03 |
| new-2-ubuntu | fails* | 02:03 |
| bimberi | new-2-ubuntu: so you're printing from a W2K box to a printer connected to your ubuntu box? | 02:04 |
| nazty | thanks a;pt guys | 02:04 |
| nazty | thanks alot | 02:04 |
| nazty | ! | 02:04 |
| ubotu | Not a clue. Try searching at http://ubuntu.cc.com.au/, nazty | 02:04 |
| arrick | even If I set it up as html and enable the html from internet? | 02:04 |
| === spadilla [n=spadilla@cable200-116-216-17.epm.net.co] has joined #ubuntu | ||
| bimberi | nazty: np :) | 02:04 |
| === kiwinz [n=kiwinz@222-152-108-174.jetstream.xtra.co.nz] has joined #ubuntu | ||
| new-2-ubuntu | no I got priter on w2k box trying 2 print from ubuntu box | 02:04 |
| new-2-ubuntu | printer* | 02:04 |
| arrick | new-2-ubuntu, what kind of printer? | 02:04 |
| new-2-ubuntu | hp photosmart 7900 | 02:05 |
| === NickGarvey [n=NickGarv@cpe-24-195-249-41.nycap.res.rr.com] has joined #ubuntu | ||
| === ds[de] [n=dome@p54ABE7AA.dip.t-dialin.net] has left #ubuntu [] | ||
| new-2-ubuntu | its plugged in correcty I can print from w2k box | 02:05 |
| Falstius | new-2-ubuntu: aahhh ... evil printers. | 02:05 |
| new-2-ubuntu | somthing 2 do with login & pass. I dont think windos understands it | 02:05 |
| Skinux | new-2-ubuntu : print sharing enabled on W2K | 02:05 |
| arrick | install samba and set it to send password unencrypted | 02:06 |
| TSCHAK2 | new-2-ubuntu, use guest as username no password | 02:06 |
| arrick | !samba | 02:06 |
| ubotu | rumour has it, samba is https://wiki.ubuntu.com/SettingUpSamba or https://wiki.ubuntu.com/MountWindowsSharesPermanently | 02:06 |
| arrick | that too | 02:06 |
| NickGarvey | mm samba is good stuff | 02:06 |
| TSCHAK2 | I'm pissed that the Share Folder function | 02:06 |
| TSCHAK2 | in ubuntu | 02:06 |
| TSCHAK2 | is basically useless | 02:06 |
| === robenroute [n=rob@p2153-adslbkksp4.C.csloxinfo.net] has joined #ubuntu | ||
| arrick | huh? | 02:06 |
| bimberi | new-2-ubuntu: sorry was checking wiki pages, looks like you're getting good advice :) | 02:06 |
| TSCHAK2 | so insanely stupid that you would go through the trouble of being able to easily set up a share | 02:06 |
| === vitriol [n=vitriol@pool-71-124-124-25.chi01.dsl-w.verizon.net] has joined #ubuntu | ||
| === ubuntu [n=ubuntu@200-158-156-28.dsl.telesp.net.br] has joined #ubuntu | ||
| new-2-ubuntu | I disable guest for security purposes | 02:06 |
| TSCHAK2 | yet you have to run smbpasswd | 02:07 |
| === vitriol [n=vitriol@pool-71-124-124-25.chi01.dsl-w.verizon.net] has left #ubuntu ["Leaving"] | ||
| ubuntu | ls | 02:07 |
| TSCHAK2 | just to add a user who can use it | 02:07 |
| new-2-ubuntu | yes | 02:07 |
| arrick | yep | 02:07 |
| === [1] wenko is now known as wenko | ||
| TSCHAK2 | that's insanely stupid, people | 02:07 |
| new-2-ubuntu | i got a smpusername & pass | 02:07 |
| TSCHAK2 | SHORT SIGHTED!!!! | 02:07 |
| ubuntu | join | 02:07 |
| === sugarfree [n=sugarfre@c-24-18-0-216.hsd1.wa.comcast.net] has joined #ubuntu | ||
| arrick | smbpasword | 02:07 |
| new-2-ubuntu | must I set machin upstairs with same username & pass?? cus printer oes specify username & pass I am using the user printer account on it | 02:07 |
| === Engla [n=ulrik@kr-lun-116-144-233-83.3.cust.bredband2.com] has joined #ubuntu | ||
| Cyorxamp | you mean 'machine' | 02:08 |
| Cyorxamp | machin sets my trigger off :S | 02:08 |
| TSCHAK2 | I've been a linux user since 1991... a Samba user since 1996.... and the fact that even though we have nice UIs to handle shares now.... you STILL have to do this, is .... insanely stupid | 02:08 |
| TSCHAK2 | does nobody care? | 02:08 |
| amphi | TSCHAK2: no ;) | 02:08 |
| duelboot | help: speakers working, but mic input is not...any suggestions? | 02:08 |
| === lakin [n=lakin@dsl-hill-66-18-228-60-cgy.nucleus.com] has joined #ubuntu | ||
| new-2-ubuntu | new mic :P | 02:08 |
| arrick | complain in off-topic please | 02:08 |
| biovore | duelboot: what sound card? | 02:09 |
| new-2-ubuntu | How do I get this box 2 login 2 printer? | 02:09 |
| arrick | !samba | 02:09 |
| ubotu | from memory, samba is https://wiki.ubuntu.com/SettingUpSamba or https://wiki.ubuntu.com/MountWindowsSharesPermanently | 02:09 |
| new-2-ubuntu | brb tryin sumthing | 02:09 |
| === Suture_ [n=suture@63-231-21-223.tukw.qwest.net] has joined #ubuntu | ||
| TSCHAK2 | how are we supposed to attract new users | 02:09 |
| duelboot | biovore...hold one | 02:09 |
| === leagris [n=leagris_@mama.noiraude.net] has joined #ubuntu | ||
| amphi | samba could also be http://www.oreilly.com/catalog/samba2/book/toc.html | 02:09 |
| TSCHAK2 | if we still have to do insanely arcane stuff like this? | 02:09 |
| bimberi | TSCHAK2: https://launchpad.net/distros/ubuntu/+source/samba/+filebug :) | 02:09 |
| TSCHAK2 | bimberi, already been filed | 02:09 |
| TSCHAK2 | bimberi, nobody seems to care. | 02:10 |
| === seraphim [n=seraphim@dslb-088-072-206-066.pools.arcor-ip.net] has joined #ubuntu | ||
| bimberi | TSCHAK2: by you? if not add a comment | 02:10 |
| amphi | TSCHAK2: submit a suitable patch? | 02:10 |
| new-2-ubuntu | I can only see one networked machine?? | 02:10 |
| arrick | yeah | 02:10 |
| arrick | you need to enable ntfs to be seen | 02:10 |
| === we2by [n=jiji@h8441153081.dsl.speedlinq.nl] has joined #ubuntu | ||
| we2by | hi guys | 02:10 |
| arrick | !ntfs | 02:10 |
| ubotu | hmm... ntfs is the filesystem used in Windows NT and newer; to automatically mount your NTFS partition: https://wiki.ubuntu.com/AutomaticallyMountMSWindowsPartitions | 02:10 |
| we2by | I have a mobo with nvidia chipset | 02:10 |
| new-2-ubuntu | under shared folders? | 02:10 |
| j4k | Would you install dapper on a production system? | 02:10 |
| === Hollowman8904 [n=alex@MW-ESR1-72-49-67-231.fuse.net] has joined #ubuntu | ||
| arrick | yeah | 02:11 |
| we2by | and i can't get X working | 02:11 |
| new-2-ubuntu | I am using smb & it worked bfore | 02:11 |
| Hollowman8904 | how can i mount a network share so that media programs think its local | 02:11 |
| Sergi0 | j4k at the moment not yet | 02:11 |
| Hollowman8904 | or to the point, how can i play networked music? | 02:11 |
| MrCollins | I cant login to my sshd account on my ubuntu box... could it be I need to reset a certificate of some kind? | 02:11 |
| we2by | is there a preocmpiled kernel with nvidia drivers for the mainboard (it got onbaord video) | 02:11 |
| arrick | new-2-ubuntu, what did yo change recently? | 02:11 |
| j4k | Sergio0: Meh, thanks | 02:11 |
| MrCollins | or is it an issue with my putty client on my win32 box? | 02:11 |
| Sergi0 | j4k, there are alot of updates comming true, but its almost there | 02:11 |
| === panzer [n=panzer@130-126-246-201.adsl.terra.cl] has joined #ubuntu | ||
| === monzie [n=manish@220.226.37.52] has joined #ubuntu | ||
| bimberi | TSCHAK2: btw i agree with you :) | 02:12 |
| duelboot | bivore: Intel ICH5 SigmaTel STAC9758,59 | 02:12 |
| arrick | Hollowman8904, share the folder on the network | 02:12 |
| new-2-ubuntu | I re-installed my sudo & su didnt start anymore :( it was f'ed up | 02:12 |
| duelboot | biovore Intel ICH5 SigmaTel STAC9758,59 | 02:12 |
| biovore | ich5.. on board audio? | 02:12 |
| new-2-ubuntu | I am starting fresh | 02:12 |
| duelboot | biovore: laptop | 02:12 |
| j4k | Sergio0: Say I installed it and worked with it until the final version is released. Will I be able to update the OS with the update utility? | 02:12 |
| arrick | help someone with more experience please | 02:12 |
| biovore | some laptops have problems.. | 02:12 |
| TheFaction20 | have any of you installed ubuntu on a external hard drive? | 02:13 |
| arrick | yeah I have | 02:13 |
| Hollowman8904 | arrick: nvm i found the problem... the share name had a space in it (windows box) and linux doesn't like that apparently | 02:13 |
| biovore | duelboot: try using alsamixer on the cli | 02:13 |
| arrick | yeah you have to use an underscore for it | 02:13 |
| Sergi0 | j4k, sure, i do it :) | 02:13 |
| === alteroo [n=alteroo@port0002-abm-adsl.cwjamaica.com] has joined #ubuntu | ||
| duelboot | biovore: I got it to work once in Mandriva...changed some options in alsamixer and it worked...put in ubuntu and now I don't know those settings | 02:13 |
| biovore | biovore: use f5 so adjust values untill it works | 02:14 |
| duelboot | biovore: I've tried almost every imaginable option in alsamixer...no luck (yet) | 02:14 |
| Hollowman8904 | arrick, one more thing though... im trying to use kaffeine, but I can't browse the network with it.. how can i make it work? or what was that other program that resembles winamp? | 02:14 |
| new-2-ubuntu | I cannot see my own pc. wait might be on diffrent workgroup gggrr.. | 02:14 |
| === Gus_ [n=ubuntu@201.137.3.207] has joined #ubuntu | ||
| biovore | duelboot: no clue then.. I have a SB Live and it works fine.. | 02:14 |
| === Gus_ [n=ubuntu@201.137.3.207] has left #ubuntu ["Leaving"] | ||
| duelboot | biovore thx anyway | 02:14 |
| arrick | you can browse the network, by going through the media folder | 02:14 |
| new-2-ubuntu | mshome | 02:14 |
| === sl0th [n=miguel@80.172.138.103] has joined #ubuntu | ||
| new-2-ubuntu | lol I almost enter mshomo as wrkgroup name bua, ha ha \ | 02:15 |
| Hollowman8904 | all i have in my media folder is cdrom and cdrom0 | 02:15 |
| === xorian` [i=obbie@dD5E0052E.access.telenet.be] has joined #ubuntu | ||
| arrick | you must mount the drive you want to play from then | 02:15 |
| new-2-ubuntu | brbresetting pc's with mshme workgroup | 02:16 |
| arrick | ok | 02:16 |
| === panzer [n=panzer@130-126-246-201.adsl.terra.cl] has left #ubuntu ["Abandonando"] | ||
| arrick | what kind of partition is your music on? | 02:16 |
| === leonel [n=leonel@201.123.96.222] has joined #ubuntu | ||
| arrick | Hollowman8904, that last question was for you | 02:16 |
| MrCollins | did anyone see my question earlie | 02:16 |
| === im [n=null@g624-9034.itee.uq.edu.au] has joined #ubuntu | ||
| === Ganja [n=ganja@i05v-87-90-158-133.d4.club-internet.fr] has joined #ubuntu | ||
| === nico__ [n=nico@d83-177-205-207.cust.tele2.fr] has joined #ubuntu | ||
| bimberi | MrCollins: check that the sshd is running 'ps aux | grep sshd' | 02:17 |
| arrick | if you have a ntfs file you need to wnable them to be seen as well | 02:17 |
| === JoaoJoao [n=joao@201.22.37.160.adsl.gvt.net.br] has joined #ubuntu | ||
| === Ganja is now known as Ganja_Man | ||
| amphi | MrCollins: putty should work fine; sudo netstat -plunt should show sshd listening on 22 | 02:18 |
| bimberi | amphi: another 'plunt'er :) | 02:18 |
| === wastrel [n=wastrel@dsl254-127-242.nyc1.dsl.speakeasy.net] has joined #ubuntu | ||
| JoaoJoao | hello | 02:18 |
| amphi | bimberi: heh | 02:18 |
| MrCollins | lol | 02:19 |
| bimberi | amphi: i find it easy to remember | 02:19 |
| MrCollins | weird | 02:19 |
| MrCollins | i try to login as my user | 02:19 |
| MrCollins | its sitting there | 02:19 |
| MrCollins | no password attempt | 02:19 |
| wastrel | my precious | 02:19 |
| dereks | if i want to watch a dvd in my computer, i have to replace gstreamer with xine (i am using dapper) | 02:19 |
| dereks | ? | 02:19 |
| JoaoJoao | Is there a pitfdll deb available for dapper somewhere (using gst 0.10) | 02:20 |
| bur[n] er | !dvd | 02:20 |
| ubotu | DVD playing is possible in ubuntu. You may need libdvdcss2, which is available via http://wiki.ubuntu.com/SeveasPackages (section extras) | 02:20 |
| === kiwinz [n=kiwinz@222-152-108-174.jetstream.xtra.co.nz] has left #ubuntu ["Leaving"] | ||
| === bj01_ [n=bj01@217.97.185.5] has joined #ubuntu | ||
| dereks | bur[n] er: that wasn't my question :) | 02:20 |
| bur[n] er | u don't "have" to | 02:20 |
| bur[n] er | but xine plays it a little better | 02:20 |
| wastrel | dereks: supposably gstreamer is fixed in dapper, might want to ask in the dapper chan. | 02:20 |
| bur[n] er | dereks: #ubuntu+1 ;) | 02:20 |
| amphi | MrCollins: does ssh $USER@localhost work on the linux box work? | 02:21 |
| wastrel | dereks: alls i know is that xine works much better in breezy | 02:21 |
| dereks | wastrel: bur[n] er: let me ask there | 02:21 |
| dereks | thanks | 02:21 |
| MrCollins | amphi i cant even login | 02:21 |
| amphi | MrCollins: on localhost? is sshd running? | 02:21 |
| MrCollins | amphi | 02:22 |
| MrCollins | i cant lgin to the linux box | 02:22 |
| MrCollins | im on win32 box now | 02:22 |
| amphi | MrCollins: not from the console? | 02:23 |
| MrCollins | nope | 02:23 |
| LathropWells | after installing "Build-Essential" - do i get " ./configure "? is there a link in ubuntu forum/wiki to help? | 02:23 |
| Hollowman8904 | arrick, sorry for not answering.... how do i mount it.. i dont know how to mount network stuff | 02:23 |
| === Toadstool is now known as ToadZzZztool | ||
| MrCollins | at the actual console. | 02:24 |
| MrCollins | let me go back | 02:24 |
| MrCollins | yeah | 02:24 |
| MrCollins | its just sitting there | 02:24 |
| munkie2 | LathropWells, no idea but you could try searching both sites | 02:24 |
| illusions | TSCHAK2 you there? | 02:24 |
| UncleD | how can i fix this: Failed to fetch http://archive.ubuntu.com/ubuntu/breezy/dists/main/multiverse/binary-i386/Packages.gz 404 Not Found [IP: 82.211.81.182 80] | 02:25 |
| wastrel | i r having a mail problem, when i send a message with more than one recipient, irritating error message is received (mutt is MUA masqmail is MTA) Error is : 550 sorry, I don't accept bounce messages with more than one | 02:25 |
| wastrel | +recipient. Go read RFC2821. (#5.7.1) | 02:25 |
| === iGotNoTime [n=joshua@cpe-65-189-240-199.woh.res.rr.com] has left #ubuntu [] | ||
| wastrel | any idears? | 02:25 |
| === p01n7 [n=p01n7@mctnnbsa31w-156034251238.nb.aliant.net] has joined #ubuntu | ||
| illusions | TSCHAK ? | 02:25 |
| TSCHAK2 | illusions, am about to leave, what's up? | 02:25 |
| === beyond [n=beyond@200-161-58-9.dsl.telesp.net.br] has joined #ubuntu | ||
| illusions | TSCHAK how i longin to root | 02:25 |
| TheFaction20 | how can i find out all the storage devices ubuntu sees? | 02:25 |
| illusions | TSCHAK2 i got evrything done | 02:26 |
| illusions | TSCHAK2 but root | 02:26 |
| LathropWells | hollowman - for me samba was working from the start without tweaking it at all. this command opened a second drive across my lan "nautilus smb://machine/d/" | 02:26 |
| illusions | TSCHAK2 illusions@comcast:~$ alien install skype-1.2.0.18-fc3.i586.rpm | 02:26 |
| illusions | Must run as root to convert to deb format (or you may use fakeroot). | 02:26 |
| illusions | illusions@comcast:~$ | 02:26 |
| === im is now known as null | ||
| munkie2 | UncleD, correct me if im wrong...try looking at http://ubuntuguide.org/#extrarepositories | 02:26 |
| swoop | what is the difference between Breezy Badger and Dapper Drake? | 02:27 |
| kbrooks | munkie2, | 02:27 |
| kbrooks | !ubuntuguide | 02:27 |
| ubotu | ubuntuguide is, like, out of date, reported to break a lot and generally a bad source for information. Use help.ubuntu.com or wiki.ubuntu.com instead | 02:27 |
| TheFaction20 | how can i find out all the storage devices ubuntu sees? | 02:27 |
| bimberi | TheFaction20: sudo fdisk -l | 02:27 |
| munkie2 | ah, sorry, did not know : ) | 02:27 |
| Hollowman8904 | yea but that doesn't show up in my media programs | 02:27 |
| illusions | TSCHAK2 can i go to root throw treminal? | 02:27 |
| === Ganja_Man [n=ganja@i05v-87-90-158-133.d4.club-internet.fr] has left #ubuntu ["Leaving"] | ||
| MrCollins | so.... | 02:27 |
| kbrooks | munkie2, the ubuntu guide says 5.04. THAT old | 02:27 |
| LathropWells | The faction fdisk -l will show partitions and there is a utility to auto matically edit fstab and mount them on each boot called "mounter' or 'winmac_fstab.sh" | 02:27 |
| MrCollins | why does my login just sit there.... | 02:28 |
| thomas | anyone know a program like cedega but free? | 02:28 |
| === gabbah [n=gabbah@82.99.36.8] has joined #ubuntu | ||
| arrick | !pastebin | 02:28 |
| ubotu | pastebin is, like, a site where you can post large texts and screenshots so you don't flood the channel. You can find it at http://paste.ubuntu-nl.org - You can install webboard for easy pasting from the gnome taskbar | 02:28 |
| === Kyn [n=Kyn@207.65.228.47] has joined #ubuntu | ||
| thomas | that can run windows games | 02:28 |
| Xenguy | thomas: wine | 02:28 |
| Yango | has had anyone success with evolution with IMAP over ssh tunnel? I have a tunnel to the IMAP server, configured Evolution to connect to the IMAP server through the tunnel and then I get no new messages, when I check the messages in the server with mutt I see the new messaqges | 02:28 |
| swoop | bimberi, is it easy to change the ID of a partition in ubuntu's fdisk? I'm having problems with one partitions, RAW :( | 02:28 |
| amphi | MrCollins: hard to say - what did you do? ;) | 02:28 |
| TSCHAK2 | illusions, you must either use sudo, or do sudo passwd root and set a root password, you can then su to root | 02:28 |
| Xenguy | thomas: cedega is based on wine | 02:28 |
| === redir [n=Reed@208-58-195-117.c3-0.grg-ubr2.lnh-grg.md.cable.rcn.com] has joined #ubuntu | ||
| MrCollins | i tried to ftp in from cmd line here on my win32 box | 02:28 |
| thomas | really? how does games run on wine? is it really slow compared to windows native? | 02:28 |
| MrCollins | to test my ftp daemon | 02:28 |
| Xenguy | illusions: sudo -i | 02:28 |
| bimberi | swoop: no idea sorry :| | 02:28 |
| Hollowman8904 | how do i mount a network share as a local drive? my media players will only allow me to scan local drives | 02:29 |
| MrCollins | after that, after I failed the logins.... | 02:29 |
| MrCollins | it wont let me login with SSH or actual console... | 02:29 |
| swoop | bimberi, ok! ;) i have to recover all office files in that partition :( i'm getting mad :/ | 02:29 |
| Xenguy | thomas: dunno I'm not a gamer :-) See frankscorner.org (NOTE: a bit bit dated now I'm told, but you'll get the idea) | 02:29 |
| illusions | TSCHAK2 that worked thanks | 02:29 |
| swoop | why am i having problems with dpkg when trying to install Skype? | 02:29 |
| === jhawk [n=jhawk@c-68-59-61-186.hsd1.fl.comcast.net] has joined #ubuntu | ||
| illusions | TSCHAK2 sudo -i worked thank you sir | 02:29 |
| === master_ [n=master@c-67-191-86-100.hsd1.fl.comcast.net] has joined #ubuntu | ||
| amphi | MrCollins: how curious | 02:30 |
| MrCollins | yeah my thoughts exactly. | 02:30 |
| arrick | Hollowman8904, sorry, had to take a break, as I am in class at college rigth now | 02:30 |
| Hollowman8904 | arrick, understandable | 02:30 |
| Xenguy | MrCollins: ftp shouldn't affect ssh though | 02:30 |
| MrCollins | ive been tinkering/working with linux for... 3-4 years | 02:30 |
| illusions | TSCHAK2 one more thing should it look like this alien install skype-1.2.0.18-fc3.i586.rpm | 02:30 |
| MrCollins | never seen this | 02:30 |
| LathropWells | http://smorgasbord.net/files/winmac_fstab << - this a wonderful script to find all available parttions and edit fstab for auto mounting of drives. (seveas wrote it. | 02:31 |
| TheFaction20 | has anyone used the BREEZY on external drive guide? | 02:31 |
| === Installer36 [n=chris@71-209-133-13.phnx.qwest.net] has joined #ubuntu | ||
| swoop | illusions, sudo install skype-1.2.0.l8-fc3.i586.rpm ? | 02:31 |
| Hollowman8904 | hmm... so far I have not been able to play any music that has a space in the FOLDER name, but if its in the FILE name its fine | 02:31 |
| MrCollins | maybe I should try a reboot? | 02:31 |
| === Sanne [n=Sanne@p548D9D4E.dip0.t-ipconnect.de] has joined #ubuntu | ||
| arrick | yeah | 02:32 |
| illusions | swoop ok lets try that ok lets try that | 02:32 |
| LathropWells | hollowman - hm - quirky. | 02:32 |
| Xenguy | MrCollins: shouldn't be necessary, but can't hurt either | 02:32 |
| Hollowman8904 | ex, I can't play /music/Linkin Park/Papercut.mp3, but I can play /music/down with the sickness.mp3 | 02:32 |
| swoop | illusions, thanks! ;) i'll try it now :D just let me download the rpm file | 02:32 |
| arrick | Hollowman8904, what kind of partition is the network share on? | 02:32 |
| Xenguy | Hollowman8904: avoid spaces in *nix; it;s just a hassle | 02:32 |
| Kyn | Does anyone have a workaround for the KVM switch / erratic mouse problem? | 02:32 |
| illusions | lol | 02:32 |
| amphi | MrCollins: at this stage, that seems the only option | 02:32 |
| illusions | swoop wait | 02:32 |
| Hollowman8904 | arrick, FAT32 | 02:33 |
| arrick | ok, hang on | 02:33 |
| === torque arrick (resp message): arrick | ||
| illusions | i was told to install aiean | 02:33 |
| Hollowman8904 | and im not going to go through all of my folders and rename them to no spaces | 02:33 |
| === samalex [n=samalex@pdpc/supporter/student/rlangly] has joined #ubuntu | ||
| arrick | yeah torque whats up? | 02:33 |
| swoop | illusions, i had a problem while trying to do: sudo dpkg --install skype_1.2.0.18-2_i386.deb | 02:33 |
| amphi | Hollowman8904: escape the space | 02:33 |
| master_ | ? | 02:33 |
| samalex | hey g uys -- anyone running ubuntu on a Mac? I'm installing on an imac G3 now, so just curious | 02:33 |
| === concept10 [n=concept1@c-67-166-167-125.hsd1.tx.comcast.net] has joined #ubuntu | ||
| swoop | illusions, that's why i've asked another way | 02:33 |
| === master_ is now known as new-2-ubuntu | ||
| illusions | swoop so it would work if use alien | 02:34 |
| new-2-ubuntu | darn thing | 02:34 |
| arrick | Hollowman8904, are all these files mp3? | 02:34 |
| swoop | illusions, sorry, but, what is alien? | 02:34 |
| new-2-ubuntu | ok stuff shared now 2 test printer | 02:34 |
| illusions | swoop well thats what i was told any way i am a noob | 02:34 |
| Hollowman8904 | mp3's and wma's | 02:34 |
| new-2-ubuntu | its a little green man that omes from another planet | 02:34 |
| === Skinux [n=scot@24.151.118.124] has joined #ubuntu | ||
| arrick | have you installed the 32's | 02:34 |
| new-2-ubuntu | He wishes for you too take im too your leader :P | 02:34 |
| amphi | Hollowman8904: not that changing the spaces to underscores would be hard; find and tr would be a painless way to do it | 02:34 |
| Hollowman8904 | arrick, nvm on the space thing.. it just wont play WMAs | 02:34 |
| illusions | swoop install the alien package from synaptic | 02:34 |
| arrick | !tell Hollowman8904 about wma | 02:34 |
| swoop | illusions, ok.. let me try to do it ;) | 02:34 |
| Xenguy | Hollowman8904: have a look at installing 'krename'; it might help with the file renaming | 02:35 |
| new-2-ubuntu | lmfao | 02:35 |
| arrick | !restricted | 02:35 |
| === Nafai [n=nafai@rrcs-24-73-247-70.sw.biz.rr.com] has joined #ubuntu | ||
| === unL33Tn00b [n=unL33Tn0@c-24-21-54-126.hsd1.or.comcast.net] has joined #ubuntu | ||
| ubotu | it has been said that restricted is https://wiki.ubuntu.com/RestrictedFormats Most of the formats listed here can be replaced by !FreeFormats | 02:35 |
| sl0th | "illusions michael!" | 02:35 |
| arrick | follow the guide here, it helped me Hollowman8904 | 02:35 |
| === bk [i=bk@144.138.54.83] has joined #ubuntu | ||
| illusions | sloth hello | 02:35 |
| sl0th | hey | 02:35 |
| sl0th | :) | 02:35 |
| illusions | :P | 02:35 |
| arrick | thats why I went to BMPx instead of kaffiene | 02:36 |
| === ulrik [n=ulrik@kr-lun-116-144-233-83.3.cust.bredband2.com] has joined #ubuntu | ||
| illusions | Sloth how are you doing today | 02:36 |
| arrick | soundray you in here? | 02:36 |
| === I_am_the_cure [n=S0ul@c-67-191-86-100.hsd1.fl.comcast.net] has joined #ubuntu | ||
| sl0th | i'm doing ok, and you? | 02:36 |
| TheFaction20 | Has anyone installed ubuntu on a external drive? | 02:36 |
| === GutterPunk [n=steven@d51526A3E.access.telenet.be] has joined #ubuntu | ||
| arrick | TheFaction20, yeah I have | 02:37 |
| TheFaction20 | arrick:did u use the tutorial on the forums? | 02:37 |
| illusions | i am ok thank you | 02:37 |
| arrick | yeah | 02:37 |
| sl0th | nice | 02:37 |
| sl0th | :P | 02:37 |
| arrick | TheFaction20, yeah | 02:37 |
| thomas | whats cmd to install .deb files? | 02:38 |
| === ic56 [n=ic@CPE0080c6e96fe2-CM000a73a108f3.cpe.net.cable.rogers.com] has joined #ubuntu | ||
| bimberi | !deb | 02:38 |
| ubotu | To install a .deb file: sudo dpkg -i filename.deb (but note that the program you want might be installable using !apt from the !repos) | 02:38 |
| thomas | k | 02:38 |
| Skinux | thomas dpkg -i | 02:38 |
| LathropWells | sudo dpkg -i yourfile.deb | 02:38 |
| arrick | and then had to come here for help TheFaction20 | 02:38 |
| sl0th | just a question: does anybody have high definition audio on an asus? | 02:38 |
| arrick | brenner you here tonight? | 02:38 |
| TheFaction20 | arrick:if u dual boot would it just load up xp if u dont have ur drive in? | 02:38 |
| bimberi | !tell swoop about skype | 02:38 |
| sl0th | can't get the headphones to have sound | 02:38 |
| sl0th | :S | 02:38 |
| arrick | yeah | 02:38 |
| === monthiel [n=monthiel@201-1-14-99.dsl.telesp.net.br] has joined #ubuntu | ||
| === bk is now known as brenner | ||
| UncleD | How do I actually clear my archives for apt-get? | 02:38 |
| illusions | Sloth i wish i did :P | 02:38 |
| LadyNikon | How do I turn off frame buffer suppor inthe kernel. | 02:38 |
| brenner | arrick: yep :) hello | 02:38 |
| sl0th | hehe | 02:39 |
| new-2-ubuntu | Why is it so hard 2 network a printer? | 02:39 |
| new-2-ubuntu | gggrr... | 02:39 |
| LadyNikon | I think its lagging down my machine. | 02:39 |
| sl0th | so i'm not the only one | 02:39 |
| Kritical | I'm running a gateway server for my subnet 10.10.10.1/28 using eth0 and eth0:1 ... anyone know a program which can monitor bandwidth for it? | 02:39 |
| sl0th | that sucks | 02:39 |
| sl0th | :S | 02:39 |
| illusions | Asus thats nice | 02:39 |
| arrick | brenner, can you help out TheFaction20 with his install, dualboot with external for his ubuntu drive | 02:39 |
| sl0th | really nice | 02:39 |
| sl0th | can't complain at all | 02:39 |
| swoop | bimberi, thanks ;) | 02:39 |
| arrick | brenner, good evening to you, how goeth it? | 02:39 |
| thomas | i just tried to install wine and it gave me a error | 02:39 |
| === paulproteus [n=paulprot@pool-141-157-43-33.balt.east.verizon.net] has joined #ubuntu | ||
| LathropWells | The channel is really jumping with questions1 ;0 | 02:39 |
| sl0th | they have good reputation and are worth it | 02:40 |
| brenner | ubotu: tell TheFaction20 about dualboot | 02:40 |
| === AskHL [n=ask@82.211.196.49] has joined #ubuntu | ||
| new-2-ubuntu | lol whay did it wine about | 02:40 |
| === overrider [n=override@unaffiliated/overrider] has joined #ubuntu | ||
| new-2-ubuntu | u did sudo apt-get install wine right? | 02:40 |
| brenner | arrick, TheFaction20: is that sufficient? | 02:40 |
| thomas | its really slow when i get try to get it thru synaptc | 02:40 |
| arrick | for me, yes | 02:40 |
| thomas | or apt-get | 02:40 |
| thomas | its the same thing same repositories.. | 02:40 |
| === Suture [n=suture@63-231-21-223.tukw.qwest.net] has joined #ubuntu | ||
| I_am_the_cure | no u have 2 use sudo | 02:41 |
| thomas | i got it somewere quicker i just need to install it now... | 02:41 |
| thomas | i used sudo | 02:41 |
| TheFaction20 | brenner: well im wondering if like i dont have the usb drive plugged in will it just load up xp? | 02:41 |
| brenner | arrick: bit nervous today actually, going for a job interview in about an hour | 02:41 |
| arrick | also when Hollowman8904 gets done with wiki, he needs help with wma's like I did, I sent him to the one | 02:41 |
| === zenmac [n=zenwhen@h153.202.28.71.ip.alltel.net] has joined #ubuntu | ||
| arrick | I just got done with one this morning | 02:41 |
| thomas | anyone mind me msgin them the error and maybe they can find out my problem? | 02:41 |
| arrick | Got a job at a school as a network admin | 02:41 |
| new-2-ubuntu | brb seeing if the midget is online | 02:41 |
| arrick | 7000 user system | 02:41 |
| new-2-ubuntu | eer my other pc :P | 02:42 |
| brenner | TheFaction20: if you don't have it plugged in, i assume ubuntu's boot will fail. xp should be fine assuming you install grub to the MBR | 02:42 |
| === bigironandy [n=andy@67-41-74-65.clsp.qwest.net] has joined #ubuntu | ||
| === Engla [n=ulrik@kr-lun-116-144-233-83.3.cust.bredband2.com] has joined #ubuntu | ||
| Xenguy | brenner: good luck - remember to breathe, and shine like the sun :-) | 02:42 |
| brenner | arrick: congrats | 02:42 |
| arrick | brenner, what you interviewing for? | 02:42 |
| arrick | thanks | 02:42 |
| TheFaction20 | brenner:the mbr of the external correct? | 02:42 |
| === madewokherd [n=urk@VRP5000.rhbd.psu.edu] has joined #ubuntu | ||
| brenner | arrick: just a basic computer operator | 02:42 |
| munkie2 | is there a built in .rar extractor? | 02:42 |
| bimberi | swoop: np :) there are issues with the package on the skype website which Seveas has fixed with the version in his repo | 02:42 |
| arrick | Just got my associates, now working on my bachelors | 02:42 |
| brenner | Xenguy: thank you. yeah, i hope i don't pass out :) | 02:43 |
| UncleD | I did apt-get install ruby and it installed properly, except it doesn't seem to be in my path properly. -bash: /usr/bin/ruby: No such file or directory <-- any suggestions on how to make it so apt-get installs into the proper path? | 02:43 |
| Xenguy | brenner: heheh | 02:43 |
| swoop | bimberi, maybe that's the problem i am having now | 02:43 |
| arrick | brenner, working with microsoft programs? | 02:43 |
| illusions | Swoop | 02:43 |
| === Fiscal [n=pscabral@20151147195.user.veloxzone.com.br] has joined #ubuntu | ||
| swoop | yes? | 02:43 |
| brenner | munkie2: no, install unrar and/or unrar-nonfree | 02:43 |
| illusions | swoop sudo alien install skype-1.2.0.18-fc3.i586.rpm | 02:43 |
| illusions | File "install" not found. | 02:43 |
| Xenguy | brenner: that's what a nice calm adreneline rush is for - to keep you alert ;-) | 02:43 |
| arrick | or open source? | 02:43 |
| swoop | ooh!! | 02:43 |
| swoop | yes!! :D i didn't know how to use alien | 02:43 |
| swoop | let me try | 02:43 |
| swoop | bimberi, illusions thanks :D | 02:44 |
| illusions | I download the file to my desktop | 02:44 |
| TheFaction20 | brenner:the mbr of the external correct? | 02:44 |
| Xenguy | .oO(trick questio ;-) | 02:44 |
| brenner | arrick: well, it said experience w/ ms office is a plus :P | 02:44 |
| arrick | of the normal boot part | 02:44 |
| bimberi | swoop: alien might work, but getting the .deb is a better way | 02:44 |
| thomas | anyone got a xchat system info script? that tells channel your uptime cpu/ram/hd stats | 02:44 |
| arrick | haha | 02:44 |
| arrick | and you ben playing in here? | 02:44 |
| === Fiscal [n=pscabral@20151147195.user.veloxzone.com.br] has left #ubuntu ["Leaving"] | ||
| illusions | Swoop well i am new and i dont think i got it right | 02:44 |
| brenner | TheFaction20: i would think the internal one, otherwise, how are you gonna boot the system if you take away the bootloader | 02:44 |
| illusions | Swoop I need to point it to file path/ directoery i beleave | 02:45 |
| munkie2 | brenner, thanks | 02:45 |
| TheFaction20 | brenner: well i have the ability to boot from usb | 02:45 |
| swoop | bimberi, i've downloaded the .deb and tried, but it says something about dpkg | 02:45 |
| === vidchi [n=vidchi@216.75.2.64] has joined #ubuntu | ||
| illusions | Swoop but not sure how | 02:45 |
| swoop | illusions, no problem ;) | 02:45 |
| swoop | hmm | 02:45 |
| UncleD | apt-get clean isn't working. any ideas? | 02:45 |
| illusions | sodu dpkg install file name maybe? | 02:45 |
| === Juan [n=santi@OL126-58.fibertel.com.ar] has joined #ubuntu | ||
| arrick | aotitude UncleD | 02:45 |
| brenner | TheFaction20: i think you should consult arrick really, i've done dualboot systems, but not one w/ an external removable drive | 02:45 |
| arrick | aptitude UncleD | 02:46 |
| amphi | UncleD: in what way 'not working'? | 02:46 |
| UncleD | amphi: it's not cleaning any packages | 02:46 |
| ic56 | twn thomas | 02:46 |
| === p01n7 [n=p01n7@mctnnbsa31w-156034251238.nb.aliant.net] has joined #ubuntu | ||
| UncleD | all my packages are still there. | 02:46 |
| === Lane [n=laish@81-178-64-113.dsl.pipex.com] has joined #ubuntu | ||
| bimberi | swoop: you can paste the error here if it's 1 line, otherwise use the pastebin - http://paste.ubuntu-nl.org/ | 02:46 |
| amphi | UncleD: from where? | 02:46 |
| Xenguy | UncleD: sudo ? | 02:46 |
| UncleD | I used sudo. | 02:46 |
| swoop | illusions, bimberi i've tried this: sudo dpkg --install skype_1.2.0.l8-2_i386.deb | 02:46 |
| DBO | I am having a problem with evolution-data-server | 02:46 |
| DBO | it is eating a whole lot of ram | 02:47 |
| swoop | but the error is writen in portuguese... | 02:47 |
| swoop | :P | 02:47 |
| DBO | at 368MB right now | 02:47 |
| DBO | what can I do? | 02:47 |
| amphi | UncleD: apt-get clean removes debs from /var/cache/apt/archives | 02:47 |
| wastrel | hi | 02:47 |
| carthik | illusions, bimberi, swoop : https://ubuntu.wordpress.com/2005/09/23/installing-using-an-rpm-file/ | 02:47 |
| bimberi | swoop: try me, i can always use babelfish :) | 02:47 |
| === Lorvija [n=lorvija@dsl-lprgw5-fecdf900-132.dhcp.inet.fi] has joined #ubuntu | ||
| === btdown [n=btdown@66.89.118.70.cfl.res.rr.com] has joined #ubuntu | ||
| === Lorvy [n=lorvija@dsl-lprgw5-fecdf900-132.dhcp.inet.fi] has joined #ubuntu | ||
| swoop | bimberi, it says something like: dpkg: status data base is blocked for(or by) other process | 02:47 |
| arrick | TheFaction20, the answer to your question is yes to a dualboot with ubuntu on external drive, it will tell you that ubuntu is not available, and then send you to xp in 10 seconds | 02:48 |
| illusions | carthik thanks | 02:48 |
| swoop | bimberi, :) cool :P | 02:48 |
| bimberi | swoop: close synaptic | 02:48 |
| swoop | carthik, wow :D let me see! thanks! | 02:48 |
| arrick | at least it does on mine | 02:48 |
| swoop | that's a good idea hahah | 02:48 |
| swoop | closed.. let me try | 02:48 |
| TheFaction20 | arrick:should i put grub on the external? | 02:48 |
| arrick | nope | 02:48 |
| arrick | put it in the internal | 02:49 |
| arrick | grub is your boot loader | 02:49 |
| TheFaction20 | ok | 02:49 |
| swoop | bimberi, it is saying now that i have to install the following packages: libqt3-mt, libqt3cl02-mt and libstdc++5 | 02:49 |
| LadyNikon | hey is bookwarez down? | 02:49 |
| === Ap4ch3 [n=coco@appleboy.claranet.co.uk] has joined #ubuntu | ||
| swoop | bimberi, shall i go back to synaptic and look for these packages? | 02:50 |
| LadyNikon | woops | 02:50 |
| === Suture__ [n=suture@63-231-21-223.tukw.qwest.net] has joined #ubuntu | ||
| bimberi | swoop: yep | 02:50 |
| === Juan is now known as PuMp | ||
| === Khisanth [n=Khisanth@pool-71-247-81-57.nycmny.east.verizon.net] has joined #ubuntu | ||
| illusions | well your getting ferther then me on this swoop lol | 02:50 |
| === bob_ [n=bob@pool-72-72-129-241.hrbgpa.dsl-w.verizon.net] has joined #ubuntu | ||
| brenner | LadyNikon: uhmmaaa :P | 02:50 |
| thomas | hey anyone here manage to install f.e.a.r. thru wine on ubuntu? | 02:50 |
| swoop | illusions, thanks! ahha lol ;) | 02:51 |
| === monthiel [n=monthiel@201-1-14-99.dsl.telesp.net.br] has joined #ubuntu | ||
| illusions | swoop so what did you do? | 02:51 |
| === gotaq [n=icebreak@l85-130-132-165.broadband.actcom.net.il] has joined #ubuntu | ||
| TheFaction20 | arrick:if i installed grub on the external id need to have the external in at all times? | 02:51 |
| swoop | illusions, last time i've tried to do something with linux was with slackware 3.33 , i don't remember anything..... it was in 1997 | 02:51 |
| === GNULinuxGeek [n=ralph@cpe-66-66-152-74.rochester.res.rr.com] has joined #ubuntu | ||
| arrick | yeah | 02:51 |
| swoop | let me re-open synaptic | 02:51 |
| TheFaction20 | hmmmm | 02:51 |
| carthik | swoop, after you convert the rpm to a .deb, $sudo dpkg -i name-of-deb.deb skhould install it, with all dependencies | 02:52 |
| thomas | Xenguy: hey man when i try to install fear(windows game iso) the installer starts up i click next but when i try to agree with the terms and agreements it doesnt let me click accept.. for some weird reason is it a installer issue? | 02:52 |
| TheFaction20 | arrick:just cuz its still a family computer. and i should be getting a laptop soon so that wouldnt even be a problem. but i really dont want to keep using the live cd and having to fix everything everytime | 02:52 |
| GNULinuxGeek | HELP !! Links in Thunderbird no longer open Firebird | 02:52 |
| swoop | carthik, nice, let me try | 02:52 |
| === PuMp [n=santi@OL126-58.fibertel.com.ar] has left #ubuntu [] | ||
| === torque [n=torque@unaffiliated/sgrgc] has left #ubuntu [] | ||
| arrick | if you have xp on your internal, perform a norma dual boot with the external plugged in and turned on and tell ubuntu to boot from the hard drive. | 02:52 |
| === tiagovaz [n=tiago@MTL-HSE-ppp181381.qc.sympatico.ca] has joined #ubuntu | ||
| carthik | GNULinuxGeek, firebird is not firefox ;) | 02:53 |
| arrick | or you could back up your settings on disc til you get the other puter | 02:53 |
| TheFaction20 | u mean install ubuntu on the internal?> | 02:53 |
| swoop | carthik, didn't work | 02:53 |
| === seth [n=seth@ubuntu/member/seth] has joined #ubuntu | ||
| === gfxstyler [n=gfxstyle@i577A5D09.versanet.de] has joined #ubuntu | ||
| TheFaction20 | just cuz thats what im trying to avoid | 02:53 |
| arrick | then after boot put the isc in and wallah | 02:53 |
| bimberi | carthik: dpkg doesn't install dependencies | 02:53 |
| Xenguy | thomas: I've actually seen that before with wine; maybe you want to /join #winehq ? | 02:53 |
| swoop | bimberi, now synaptic is saying that i have one broken package | 02:53 |
| gfxstyler | how can i apply bold fonts just to the gnome-panel or other menu-bars? | 02:53 |
| TheFaction20 | arrick:otherwise im not following | 02:53 |
| arrick | hang on | 02:54 |
| GNULinuxGeek | <carthik> Sorry forgot... but it still doesn't open in Firefox | 02:54 |
| thomas | sure | 02:54 |
| === Sergi0 [n=serge@ip227-28-166-62.adsl.versatel.nl] has left #ubuntu ["Konversation] | ||
| LathropWells | /etc/init.d/cups - what is the command to start this service? | 02:54 |
| bimberi | swoop: that's ok, that's from your attempt to install skype, it'll go away once it is installed | 02:54 |
| swoop | hmm ok ;) | 02:54 |
| === nekostar [n=nekostar@unaffiliated/starscalling] has joined #ubuntu | ||
| Xenguy | LathropWells: append a 'start' (no quotes) | 02:54 |
| carthik | GNULinuxGeek, try $sudo update-alternatives --list x-www-browser | 02:54 |
| LKRaider | ubotu: tell LKRaider about codecs | 02:54 |
| LathropWells | xenguy - Thank You. | 02:55 |
| === mattcraigschultz [n=matt@adsl-70-241-132-149.dsl.hstntx.swbell.net] has joined #ubuntu | ||
| carthik | GNULinuxGeek, that will list options, and then the --set option will help you set it | 02:55 |
| LKRaider | ubotu: tell desousa2 about codecs | 02:55 |
| ic56 | gfxstyler: doesn't taskbar>System>preferences>menu... do it? | 02:55 |
| === llusser [n=rwecker@c-24-91-82-166.hsd1.ma.comcast.net] has joined #ubuntu | ||
| Xenguy | LathropWells: yw - you can check for options with /etc/init.d/cups --help | 02:55 |
| carthik | gfxstyler, system->prefs->fonts | 02:55 |
| mattcraigschultz | how do i export my KERNEL_PATH for make? | 02:55 |
| gfxstyler | ic56: no it doesn't :) | 02:55 |
| === cobalt [n=ubuntu@c-67-166-167-125.hsd1.tx.comcast.net] has joined #ubuntu | ||
| carthik | gfxstyler, tweak till pleased | 02:55 |
| wastrel | happy happy | 02:56 |
| gfxstyler | carthik: but that sets bold fonts to everything | 02:56 |
| ic56 | gfxstyler: ooops, I should of said ...>fonts | 02:56 |
| amphi | mattcraigschultz: KERNEL_PATH=/foo/bar make | 02:56 |
| mattcraigschultz | amphi: thanks | 02:56 |
| === bpont [n=bpont@216.220.64.226] has joined #ubuntu | ||
| GNULinuxGeek | <carthik> gives back /usr/bin/konqueror but that doesn't open either | 02:56 |
| carthik | gfxstyler, i have only window title font set to bold | 02:56 |
| cobalt | Im on a Breezy Live cd and I want to chroot into the Hard disk so I may format and partition it. Anyone know a resource on how to chroot? | 02:56 |
| amphi | mattcraigschultz: that sets it for that command; otherwise 'export KERNEL_PATH=/foo/bar | 02:56 |
| carthik | GNULinuxGeek, dunno what the problem might be.. | 02:57 |
| amphi | ' | 02:57 |
| gfxstyler | carthik: window title != menubars :) | 02:57 |
| ic56 | gfxstyler: you mean you want to set the font in the window title of a *particular* window? | 02:57 |
| carthik | GNULinuxGeek, what does it open in? | 02:57 |
| === dt [n=dt@sou-ts1-2600-164.tpgi.com.au] has joined #ubuntu | ||
| GNULinuxGeek | <carthik> nothing opens | 02:57 |
| gfxstyler | ic56: no, just for example gnome-panel or other menus .. i remember i need to change something in a .gtkrc file | 02:57 |
| === gotaq [n=icebreak@l85-130-132-165.broadband.actcom.net.il] has left #ubuntu ["Leaving"] | ||
| === loele [n=asda@200-55-116-154.dsl.prima.net.ar] has joined #ubuntu | ||
| carthik | GNULinuxGeek, oh. well, does thunderbird have an option to specify what to open links with? I think it does.. check the tb prefs | 02:57 |
| === llusser [n=rwecker@c-24-91-82-166.hsd1.ma.comcast.net] has left #ubuntu [] | ||
| brenner | cobalt: wouldn't it be easier to use say, the gparted livecd? | 02:57 |
| swoop | bimberi, installing the packages, but, i found only 2 of those 3 i needed | 02:58 |
| === p01n7 [n=p01n7@mctnnbsa31w-156034251238.nb.aliant.net] has joined #ubuntu | ||
| cobalt | brenner, dont have it | 02:58 |
| bpont | what is the command for outputting the startup messages into a text file...i know it's dmesg something... | 02:58 |
| swoop | bimberi, libqt3cl02-mt is missing.... :( | 02:58 |
| DBO | I am having a problem with evolution 1.4, I believe the bug is fixed in 1.5, is it safe to upgrade on breezey? | 02:58 |
| Xenguy | bpont: dmesg > file | 02:58 |
| cobalt | brenner, plus I need to get on that drive | 02:58 |
| bimberi | swoop: are you installing the .deb from Seveas' repository (or a mirror)? | 02:59 |
| === marcin [n=user@194.114.146.58] has joined #ubuntu | ||
| swoop | bimberi, nope :( | 02:59 |
| brenner | cobalt: well, don't know if it's relevant but: | 02:59 |
| brenner | ubotu: tell cobalt about chroot | 02:59 |
| illusions | its in the repository? | 02:59 |
| illusions | i download it from skype.com | 02:59 |
| bimberi | swoop: ah, yes the rpm and the deb from the skype website have the wrong dependencies. | 03:00 |
| illusions | son of a gun | 03:00 |
| illusions | doh! | 03:00 |
| GNULinuxGeek | <carthik> There are no Prefernces settings for that. My KDE settings show that Firefox is it. | 03:00 |
| === calamari [n=Kid@cb03.cs.arizona.edu] has left #ubuntu ["Leaving"] | ||
| swoop | bimberi, so... would you mind to paste that Seveas's link again? or, is it in skype's website? | 03:00 |
| Eleaf | How do I get php to run with root permissions? | 03:01 |
| amphi | GNULinuxGeek: perhaps look at /etc/mailcap | 03:01 |
| bimberi | swoop, illusions: http://wiki.ubuntu.com/SeveasPackages - go to one of the mirrors (the main machine is very slow) and find your way to the .deb (it's in extras) | 03:01 |
| amphi | GNULinuxGeek: or ~/.mailcap | 03:01 |
| illusions | thanks | 03:01 |
| ic56 | bpont: dmesg just displays an existing file -- /var/log/dmesg . However, if you insist on capturing the output of dmesg, do it like so: dmesg > myfile | 03:01 |
| === nomasteryoda [n=nomaster@ip24-252-193-86.mc.at.cox.net] has joined #ubuntu | ||
| swoop | bimberi, ok... let me try :) | 03:02 |
| === dj-fu [n=deejay@202-169-217-167.worldnet.co.nz] has joined #ubuntu | ||
| === gfxstyler [n=gfxstyle@i577A5D09.versanet.de] has left #ubuntu ["Leaving"] | ||
| === twirpie [n=twirpie@NTL208H101-76-170.nt.net] has joined #ubuntu | ||
| === witless [n=witless@68.118.176.249] has joined #ubuntu | ||
| wastrel | hmm what mail server do i have installed? | 03:03 |
| bimberi | swoop, illusions: here's a direct link - http://mirror.ubuntulinux.nl/pool/extras/skype_1.2.0.18-1ubuntu3_i386.deb | 03:03 |
| Eleaf | Anybody? | 03:03 |
| illusions | bimberi deb [WWW] http://seveas.ubuntulinux.nl/ breezy-seveas list_of_sections that looks about right ? | 03:03 |
| twirpie | ack geez im still getting nowhere with running games through wine and without, and also still having problems getting clamav up and running :( | 03:03 |
| Eleaf | Is it possible to get php to have root privelages? | 03:03 |
| amphi | wastrel: who can say? ;) | 03:03 |
| illusions | oh thanks | 03:03 |
| wastrel | amphi: i imagine apt, if i can figure out how to ask it | 03:04 |
| nickrud | I'd guess none | 03:04 |
| illusions | bimberi thank you so much | 03:04 |
| wastrel | nickrud: no mail server by default? how is local mail handled? | 03:04 |
| === gabbah [n=gabbah@82.99.36.8] has joined #ubuntu | ||
| bimberi | illusions: you _could_ add the repository but for this it's better to just download the .deb | 03:04 |
| === cafuego_ [n=cafuego@202.155.163.65] has joined #ubuntu | ||
| bimberi | illusions: np :) | 03:04 |
| illusions | Swoop after all this work your going to have to add me to skype lol | 03:04 |
| Xenguy | Eleaf: sounds like a bad idea | 03:04 |
| nickrud | wastrel, I have no idea, I popped exim in right away | 03:04 |
| swoop | illusions, hahahaaha sure!.. wait.. telehpone | 03:05 |
| amphi | wastrel: dpkg -l | grep mail perhaps | 03:05 |
| Eleaf | Xenguy, do you wanna hear my situation and reccomend an option? | 03:05 |
| wastrel | i've played around with a bunch, i forget what i settled with. | 03:05 |
| Xenguy | Eleaf: just ask the channel; what do I know ? :-) | 03:05 |
| Eleaf | lol | 03:05 |
| wastrel | ahh i have esmtp | 03:05 |
| wastrel | it's misbehaving :p | 03:06 |
| swoop | bimberi, all the links are for .deb files :O isn't it? | 03:06 |
| Eleaf | I have a php upload script, and a file is uploaded, and saved to a very permissive directory. The problem is, the file is saved with very low permissions and only root can edit it. In the php upload file i try to do a chown() and change the owner to something more permissive but php does not have the permission to change such a file. What should I do? | 03:06 |
| === dt is now known as dt-oz-gc | ||
| bpont | ic56: the output looks different than what i see on my screen when i boot up... | 03:07 |
| bimberi | swoop: use this - http://mirror.ubuntulinux.nl/pool/extras/skype_1.2.0.18-1ubuntu3_i386.deb | 03:07 |
| UncleD | amphi: I installed ruby using synaptic and everything went perfect. | 03:07 |
| ic56 | bpont: different how? | 03:07 |
| UncleD | amphi: I installed using the version from dappers source.list | 03:07 |
| swoop | bimberi, thanks :D:D | 03:07 |
| bimberi | swoop: the wiki page talks about adding the repository which is unnecessary for this | 03:07 |
| === trujass [n=erh@44.Red-83-42-153.dynamicIP.rima-tde.net] has joined #ubuntu | ||
| LadyNikon | brenner: ? | 03:07 |
| === s0ciopath [n=user@net34-155.netkaster.ca] has joined #ubuntu | ||
| Eleaf | Anybody? | 03:07 |
| ic56 | Eleaf: what do you mean very low perms? | 03:08 |
| bimberi | swoop: np :) | 03:08 |
| Xenguy | Eleaf: all I can suggest is that there might be a #php channel | 03:08 |
| amphi | UncleD: I don't know what you're trying to do - downgrade ruby? | 03:08 |
| brenner | LadyNikon: nvm | 03:08 |
| bpont | ic56: for example...there's an error message each time i boot up...something like resolve host....................FAIL / most other lines end with ...............OK | 03:08 |
| illusions | bimber so i have download on to my desk top what whould be my next step | 03:08 |
| ic56 | Eleaf: who owns the file and why do you need someone else to own it? | 03:08 |
| bpont | i'm looking for those messages | 03:08 |
| === Randy [n=andrew@203.184.36.229] has left #ubuntu ["Leaving"] | ||
| Eleaf | Xenguy, they banned me because I hit 'enter' to much. (I hit enter less than I am right now...) | 03:09 |
| === flodine [n=flodine@c-24-4-174-71.hsd1.ca.comcast.net] has joined #ubuntu | ||
| bimberi | illusions: open a terminal, 'cd Desktop' then 'sudo dpkg -i skype<tab>' | 03:09 |
| Eleaf | ic56, it is owned by www-data | 03:09 |
| Xenguy | bpont: that might be ntp sync; it's not critical | 03:09 |
| dt-oz-gc | Elaf, can the command 'sudo used?chown [newowner] [file] be | 03:09 |
| Eleaf | ic56, I need to file to be owned by 'blend' and be 777 (or the like) permissive for a python program | 03:09 |
| Xenguy | Eleaf: heh (/msg ubotu enter) | 03:09 |
| bimberi | illusions: you might get an error about missing dependencies, take note of what they are and install them using apt-get/synaptic | 03:09 |
| Eleaf | dt-oz-gc, in the python program? | 03:09 |
| Eleaf | Xenguy, yes I know | 03:09 |
| dt-oz-gc | Elaf, can the command 'sudo chown [newowner] [file] ' be used? | 03:09 |
| Eleaf | dt-oz-gc, it would have to be in the php file, I cannot be here to do it every time somethign is uploaded | 03:10 |
| bpont | Xenguy: OK...but why is the output of dmesg different than what i see on screen? (just curious) | 03:10 |
| === luigi [n=luigi@201.15.77.28] has joined #ubuntu | ||
| twirpie | im still getting nowhere with running games through wine and without, and also still having problems getting clamav up and running, any help please? | 03:10 |
| ic56 | bpont: that ..ok or ...fail output isn't logged, to my knowledge. However, you grep for where it's generated in /etc/rc?.d/* | 03:10 |
| amphi | Eleaf: the php script is running as www-data | 03:10 |
| Eleaf | hmm | 03:10 |
| GNULinuxGeek | Thanx, goodnight | 03:10 |
| === GNULinuxGeek [n=ralph@cpe-66-66-152-74.rochester.res.rr.com] has left #ubuntu ["Konversation] | ||
| Eleaf | it doesn't seem to have permission to edit those files though uploaded through itsself | 03:10 |
| DBO | does anybody know anything about evolution-data-server eating tons of RAM? | 03:11 |
| === swoop [n=swoop@cm-bnas1-tic-C8B18806.dynamic.brdterra.com.br] has joined #ubuntu | ||
| Xenguy | bpont: the dmesg output should simply be re-directed to a file | 03:11 |
| DBO | (im sorry, I cant find anything about this...) | 03:11 |
| swoop | bimberi, illusions the system had frozen :X | 03:11 |
| Eleaf | DBO, how much is tons? | 03:11 |
| brenner | twirpie: have you tried the wine channel? | 03:11 |
| === catalinux [n=catalinu@86.35.32.57] has joined #ubuntu | ||
| swoop | bimberi, would you mind to give me the link again? i've lost it... had to restart :O | 03:11 |
| DBO | Elead 380MB | 03:11 |
| twirpie | there is a channel? | 03:11 |
| bimberi | swoop: sure - http://mirror.ubuntulinux.nl/pool/extras/skype_1.2.0.18-1ubuntu3_i386.deb | 03:11 |
| swoop | bimberi, thanks :D | 03:11 |
| amphi | bpont: the message you are talking about is from an init script | 03:11 |
| amphi | bpont: it might be ntpdate failing, for example | 03:12 |
| swoop | now saving :D | 03:12 |
| === flodine [n=flodine@c-24-4-174-71.hsd1.ca.comcast.net] has left #ubuntu [] | ||
| dt-oz-gc | Eleaf, Do an ls -l of the file. Who is owner, group and what permissions show? | 03:12 |
| Eleaf | yar ic56, amphi dt-oz-gc . lol, any ideas? | 03:12 |
| Eleaf | dt-oz-gc, yes | 03:12 |
| brenner | twirpie: #winehq apparently | 03:12 |
| Eleaf | dt-oz-gc, hold on a sec. let me upload a file and check | 03:12 |
| illusions | bimberi sudo dpkg -i skype_1.2.0.18-1ubuntu3_i386.deb | 03:12 |
| illusions | dpkg: error processing skype_1.2.0.18-1ubuntu3_i386.deb (--install): | 03:12 |
| illusions | cannot access archive: No such file or directory | 03:12 |
| illusions | Errors were encountered while processing: | 03:12 |
| illusions | skype_1.2.0.18-1ubuntu3_i386.deb | 03:12 |
| twirpie | thanks | 03:13 |
| bpont | amphi: OK...can i take a look at it? | 03:13 |
| cafuego_ | Please don't paste | 03:13 |
| amphi | bpont: at what? | 03:13 |
| Eleaf | dt-oz-gc, owner, www-data | group, www-data | 03:13 |
| bpont | amphi: is there a log somewhere? of the error messages i saw at startup | 03:13 |
| ic56 | Eleaf: before we explore suid options, how about getting the blend user to chown the file to itself? Can the user who is running the program su to chown? | 03:13 |
| Eleaf | -r----x--t | 03:13 |
| amphi | bpont: init script messages are not stored for posterity AFAIK | 03:13 |
| === mattcraigschultz [n=matt@adsl-70-241-132-149.dsl.hstntx.swbell.net] has left #ubuntu [] | ||
| Eleaf | ic56, the blend user can't chown, it has the least amount of permissions. | 03:13 |
| I_am_the_cure | my pc upstairs is wireless How do I get network printer too work?? It does not print no matter what login & pass I use | 03:13 |
| bimberi | illusions: (1 line maximum paste, otherwise pastebin) is the file in the directory you ran the command in (confirm with 'ls')? | 03:14 |
| Eleaf | ic56, this is a public project, with random users connecting, I don't want to give them root privelages | 03:14 |
| Eleaf | ic56, (Think of it as a public ftp server) | 03:14 |
| ic56 | Eleaf: or how about having the creator of the file (php) changing the file perms to 777. would that be acceptable or do you need privacy? | 03:14 |
| illusions | bimberi i think my terminal is not set to desk top what was this comannd 'cd Desktop'? | 03:14 |
| dt-oz-gc | Eleaf, ok, that is expected for anything (ie a php script run by the webserver) | 03:14 |
| bpont | amphi: i just want to write down what i'm seeing, but it passes by too quickly...i can't find these same messages in the output of dmesg | 03:14 |
| Eleaf | alrigt | 03:14 |
| bimberi | illusions: yes, do that first | 03:14 |
| Eleaf | ic56, I tried | 03:14 |
| Eleaf | ic56, it doesn't have permission to do so ;( | 03:14 |
| ic56 | Eleaf: what runs as user `blend'? | 03:14 |
| amphi | bpont: they won't be there if they are caused by init scripts | 03:14 |
| I_am_the_cure | is there an easyer way 2 detect networked printer? | 03:15 |
| cafuego_ | bpont: the kernel ones are in `dmesg' | 03:15 |
| cafuego_ | bpont: The ones dispalyed by starting services are indeed not saved; though by restarting services you'll probably recreate them | 03:15 |
| Eleaf | ic56, the people who log remotely into the computer. | 03:15 |
| amphi | bpont: you could try ctrl-s when the message appears | 03:15 |
| illusions | bimberi just like this cd Desktop? | 03:15 |
| I_am_the_cure | alcaholics :P | 03:15 |
| ic56 | Eleaf: the creator of the file lacks permission to change file permissions? not possible. | 03:15 |
| bimberi | illusions: yep | 03:15 |
| bpont | amphi: OK...i'll try that | 03:15 |
| amphi | bpont: dunno if that works at that stage | 03:15 |
| Eleaf | it's weird, actually wait | 03:15 |
| bpont | amphi: what will ctrl-s do? | 03:15 |
| Eleaf | ic56, the php script can do a chmod(), I don't think it can to a chown() on the file. Is that possible? | 03:16 |
| illusions | bimberi ok lets see what happens | 03:16 |
| amphi | bpont: scroll lock - ctrl-q to release it | 03:16 |
| swoop | bimberi, now i must type: sudo dpkg --install skype_1.2.0.l8-lubuntu3_i386.deb ,right? | 03:16 |
| dt-oz-gc | Eleaf, cant you add into the php script a command to set the owner, group or permissions to whatever you want? I am not into php, but surely this is possible. | 03:16 |
| cafuego_ | bpont: The only real way would be to run the console on a serial port and capture any output there to a file via a nullmodem-connected cable. (or by hacking init scripts to dump all outout to file) | 03:16 |
| bpont | amphi: ahhhh...brilliant...ok...i'll try it | 03:16 |
| bimberi | swoop: yes | 03:16 |
| swoop | okkk let me try | 03:16 |
| cafuego_ | dt-oz-gc: No, you can't. | 03:16 |
| DBO | Eleaf, no ideas? | 03:16 |
| Eleaf | dt-oz-gc, you can do chown and chmod. It doesn't have permission to do chmod though | 03:16 |
| Eleaf | DBO, I'm not sure, I don't use it | 03:17 |
| DBO | :-/ | 03:17 |
| DBO | k | 03:17 |
| bpont | cafuego: thanks, but that's a bit beyond my abilities | 03:17 |
| amphi | cafuego_: scroll lock won't be working yet? | 03:17 |
| cafuego_ | dt-oz-gc: You can run php-cgi though and tell apache to run the php scripts as a specific user | 03:17 |
| Eleaf | muh? | 03:17 |
| cafuego_ | amphi: It should be, but it may also be completely ignored | 03:17 |
| Eleaf | how do you do that cafuego_ ? | 03:17 |
| ic56 | Eleaf: so the public users upload a file via the web, thus the file ends up being owned by www-data and then they login through some other facility as user ?eben? and need to access that same file? | 03:17 |
| amphi | cafuego_: heh - I've never tried it at that stage | 03:18 |
| === icone [n=luigi@201.15.77.28] has joined #ubuntu | ||
| cafuego_ | Eleaf: there'sa suid php thing (but it requires the php cgi, won't work with the module) | 03:18 |
| Eleaf | ic56, a file is uploaded through a web interface using php. The file is saved in to /home/blend and blend ftp's in. (the ftp stuff is done using python). It then needs to download the file, delete, and manipulate the file. | 03:18 |
| === cafuego_ fixed it by making all users the same uid and locking them in a chroot ;-) | ||
| ic56 | Eleaf: that's correct. chown to abritrary users can only be done by root on a unix system | 03:19 |
| ic56 | chmod can only be done by the file's owner. | 03:19 |
| === holobyted [i=holobyte@200.95.155.64.cableonline.com.mx] has joined #ubuntu | ||
| Eleaf | ic56, oh oh. | 03:19 |
| Eleaf | ic56, ok that makes sense. How should I go about changing the owner of the file then, without having to become root? | 03:19 |
| swoop | bimberi, what's next? | 03:19 |
| === goinup [n=goinup@129.10.248.205] has joined #ubuntu | ||
| bimberi | swoop: did it install? ok? | 03:20 |
| cafuego_ | Eleaf: Of course, you *could* write a small wrapper for chown in C and suid that. | 03:20 |
| swoop | bimberi, yes... maybe lol | 03:20 |
| Eleaf | cafuego_, hmm... | 03:20 |
| dt-oz-gc | Eleaf, so get the script to do a chmod u+wx ... I think it then has full control of the file, because its already the owner | 03:20 |
| ic56 | Eleaf: a better way would be to run the ftp daemon as www-data rather than as blend. | 03:20 |
| bimberi | swoop: Applications -> Internet -> Skype (I think) | 03:20 |
| Eleaf | dt-oz-gc, can it then chown then? | 03:20 |
| goinup | hi -- i am curious is there a version of ubuntu made to boot from a usb-hdd/cf card? | 03:20 |
| === micmac [n=bttb@4-010.vpn.RWTH-Aachen.DE] has joined #ubuntu | ||
| micmac | Hi all | 03:21 |
| Eleaf | ic56, I see. Or could I give the user "blend" permission to access files owned by www-data? | 03:21 |
| cafuego_ | Eleaf: OR... you ignore the user IDs and make sure the group can also move/deletye/edit the file. | 03:21 |
| swoop | yes! you're right :D | 03:21 |
| dt-oz-gc | Eleaf, read ic56 - I agree - chown to abritrary users can only be done by root on a unix system | 03:21 |
| micmac | What version of Wine does Ubuntu use? | 03:21 |
| ic56 | Eleaf: you didn't answer my earlier Q: do you mind making the file 777? | 03:21 |
| swoop | bimberi, yes!!! opened... let me test if it is ok! :) | 03:21 |
| cafuego_ | !info wine | 03:21 |
| ubotu | wine: (Microsoft Windows Compatibility Layer (Binary Emulator and Library)), section universe/otherosfs, is optional. Version: 0.0.20050725-0ubuntu1.1 (breezy), Packaged size: 14130 kB, Installed size: 55488 kB | 03:21 |
| === thomas [n=thomas@c-68-33-228-218.hsd1.md.comcast.net] has joined #ubuntu | ||
| Eleaf | ic56, I don't mind making the file 777 | 03:22 |
| treyh0 | why is the k3b setup tool window blank? | 03:22 |
| === liable_ [n=liable@pdpc/supporter/active/liable] has joined #ubuntu | ||
| Eleaf | thanks cafuego_ and dt-oz-gc | 03:22 |
| === pussfeller4real [n=pussfell@166-82-183-46.quickclick.ctc.net] has joined #ubuntu | ||
| === cafuego_ must disappear | ||
| swoop | bimberi, now i may install nvidia and nforce2 drivers :( | 03:22 |
| Eleaf | lol | 03:22 |
| Eleaf | bar | 03:22 |
| thomas | anyone here use cedega?im having a problem when i try to install a game setup.exe thru the install button i browse tot he cdrom and choose the setup.exe but wen i hit OK and go to click continue i see that i cannot click it only cancel flukeing my whole mood of installin windows game on linux | 03:23 |
| === pussfeller4real is now known as pussfeller | ||
| === iGotNoTime [n=joshua@cpe-65-189-240-199.woh.res.rr.com] has joined #ubuntu | ||
| bimberi | !tell swoop about nvidia | 03:23 |
| ic56 | Eleaf: then just do that. user blend will then be able to read/write/execute the file. If you want to restrict access a bit, you could also make users www-data and blend belong to a common group and restrict the file to 770. | 03:23 |
| === oneleaf [n=oneleaf@59.36.4.210] has joined #ubuntu | ||
| === zerokun [n=zerokun@165-101.35-65.tampabay.res.rr.com] has joined #ubuntu | ||
| === mahangu [n=mahangu@unaffiliated/mahangu] has joined #ubuntu | ||
| ic56 | Eleaf: (and the php script should chgrp the file) | 03:23 |
| treyh0 | !tell me about why k3b setup dialog is blank and i can't do anything in "k3bsetup2" | 03:23 |
| dt-oz-gc | Eleaf, chmod u+w is all your script should need.. Its written a file that it has only read permission on... Hmm, what is the original question? :-) | 03:23 |
| Eleaf | ic56, let me try and see if blend can access the files when it is 777 with what I need it to do. | 03:23 |
| iGotNoTime | can anyone help give information that is accurate about installing jre1.5 to ubuntu? | 03:23 |
| zerokun | sigh, got my problem solved, but i know people have complained about using dual head displays with gnome for tv usage, well my tv is displaying only about a quarter of the vide enlarged | 03:24 |
| zerokun | anyone know how to fix that? | 03:24 |
| swoop | bimberi, yes!! thanks!! :) | 03:24 |
| === byteshack [n=dansan@c-68-59-179-153.hsd1.tn.comcast.net] has joined #ubuntu | ||
| Eleaf | hold on ;_ | 03:24 |
| swoop | bimberi, now i'm talking with my friend in skype :P | 03:24 |
| illusions | bimberi ok i almost got it i beleave | 03:24 |
| byteshack | does dapper not have an mplayer package? | 03:24 |
| iGotNoTime | I have tried 5 different pages and it is not correct information | 03:24 |
| nickrud | iGotNoTime, java is pretty simple really | 03:24 |
| === flodine [n=flodine@c-24-4-174-71.hsd1.ca.comcast.net] has joined #ubuntu | ||
| byteshack | apt-cache search mplayer does not seem to find it | 03:24 |
| bimberi | swoop: yw :) | 03:24 |
| zerokun | i used add/remove for mplayer | 03:24 |
| illusions | Swoop rub it in why don't you!!! | 03:24 |
| zerokun | worked like a charm | 03:24 |
| bimberi | illusions: where are you at? | 03:25 |
| swoop | illusions, :D:D pilho.swp is my id | 03:25 |
| nickrud | iGotNoTime, (<Tab> means press the Tab Key) In the directory where you downloaded the sun jre, type sudo aptitude install java-package ; fakeroot make-jpkg jre<Tab> ; sudo dpkg -i sun<Tab> | 03:25 |
| byteshack | zerokun: add/remove? Is that a gnome thing? I have xfce | 03:25 |
| iGotNoTime | sudo apt-get install sun-j2re1.5 does not work | 03:25 |
| illusions | Swoop just put sault in my cuts | 03:25 |
| zerokun | ah | 03:25 |
| iGotNoTime | fakeroot :P | 03:25 |
| iGotNoTime | I missed that | 03:25 |
| zerokun | yeah, as far as i know, since i havent used xfce | 03:25 |
| Eleaf | yikes | 03:25 |
| swoop | bimberi, :) | 03:25 |
| iGotNoTime | thanks nickrud | 03:25 |
| Eleaf | ic56, permission denied, even when it is 777 | 03:25 |
| illusions | bimberi ok i am at the errors like you said | 03:25 |
| nickrud | iGotNoTime, yw | 03:25 |
| ic56 | Eleaf: what?? | 03:25 |
| swoop | bimberi, why doesn't ubuntu read ntfs partitions? | 03:25 |
| Eleaf | ic56, I think when it tries to remove the file | 03:25 |
| bimberi | illusions: 'sudo aptitude install libqt3-mt' | 03:26 |
| illusions | bimberi pl | 03:26 |
| ic56 | Eleaf: file removal is not controlled by the perms of the file itself but by the perms of its parent directory. | 03:26 |
| bimberi | swoop: it can. Here comes another factoid ... | 03:26 |
| Eleaf | does that seem to be 777? | 03:26 |
| bimberi | !tell swoop about ntfs | 03:26 |
| Eleaf | ic56, -r----x--t 1 www-data www-data 98008 2006-03-29 18:27 test.blend | 03:26 |
| dt-oz-gc | Eleaf, I agree with ic56, blend should be added to the group www-data, then the file should have 770 permissions,ie chmod ug+rwx, then blend can read and write the file by virtue of being in a group that has read and write permission. | 03:26 |
| === shrikant [n=shrikant@59.95.1.123] has joined #ubuntu | ||
| ic56 | Eleaf: to remove a file, you need *write* perm on the parent directory and *execute* perm on all the directories up to the root of the tree. | 03:26 |
| swoop | bimberi, good luck to me! :) | 03:26 |
| Eleaf | ic56, up to the root tree? | 03:27 |
| illusions | bimberi who are you ubuntu god! damn your good | 03:27 |
| === krbjljb [n=chatzill@12-240-47-110.client.mchsi.com] has joined #ubuntu | ||
| swoop | bimberi, thanks ahhaha and.... how can i use kde instead of gnome | 03:27 |
| swoop | ? | 03:27 |
| Eleaf | ic56, so you mean home would have to have it as well? | 03:27 |
| nickrud | ugly permissions ;) | 03:27 |
| === JulianoBastos [n=ubuntux@c-24-99-227-207.hsd1.ga.comcast.net] has joined #ubuntu | ||
| swoop | illusions, yes he is! ahhahaahaa | 03:27 |
| bimberi | illusions: no, i've just done this a few times myself :P | 03:27 |
| === micmac_ [n=bttb@0-025.vpn.RWTH-Aachen.DE] has joined #ubuntu | ||
| Eleaf | dt-oz-gc, alright, I'll try that next | 03:27 |
| illusions | bimberi will you marry me? | 03:27 |
| swoop | bimberi, lol haahaha | 03:27 |
| illusions | bimberi :P | 03:27 |
| bimberi | illusions: steady on :P | 03:27 |
| === Suture [n=suture@63-231-21-223.tukw.qwest.net] has joined #ubuntu | ||
| swoop | hhahaha | 03:28 |
| ic56 | Eleaf: if the file is in /home/blend/www/upload then you need execute perm on /home /home/blend /home/blend/www /home/blend/www/upload. | 03:28 |
| swoop | bimberi, you, god of ubuntu, is it true that google will make a linux based in ubuntu:? | 03:28 |
| Eleaf | yikes | 03:28 |
| ic56 | Eleaf: finally, you need write perm on just one directory: /home/blend/www/upload | 03:28 |
| ic56 | Eleaf: no yikes. Most directories have execute perm -- otherwise you wouldn't be able to ls them. | 03:29 |
| bimberi | swoop: (now cut that out!) they denied it, so it must be true! | 03:29 |
| Eleaf | ic56, will changing the permissions on home effect other user directories? such as /home/user1 /home/me | 03:29 |
| dt-oz-gc | Eleaf, ic56's advice is correct: to remove a file, blend needs *write* perm on the parent directory and *execute* perm on all the directories up to the root of the tree. If its in the group www-data, it should get that permission by virtue of being in that group. | 03:29 |
| swoop | bimberi, hmmm interestign | 03:29 |
| ic56 | Eleaf: /home is already 755. No change needed. | 03:30 |
| === Snake__ [n=Snake@ppp-69-223-204-203.dsl.bcvloh.ameritech.net] has joined #ubuntu | ||
| Snake__ | Any grub masters in here? | 03:30 |
| ic56 | Eleaf: yes, if you remove execute perm on /home , eg by setting it to 744 users will be unable to ls their own directories. | 03:30 |
| Eleaf | ic56, alright, how should I chmod this? /home = 775 /home/blend = 775 /home/blend/.... | 03:30 |
| Eleaf | ah | 03:31 |
| === bobbyd__ [n=rob@i-195-137-31-171.freedom2surf.net] has joined #ubuntu | ||
| === dj-fu [n=deejay@202-169-217-167.worldnet.co.nz] has joined #ubuntu | ||
| === rishi [n=rishi@c-67-173-80-222.hsd1.il.comcast.net] has joined #ubuntu | ||
| illusions | bimberi 'sudo aptitude install libqt3-mt' i did that and it says | 03:31 |
| === arrick [n=arrick@pool-71-115-130-42.gdrpmi.dsl-w.verizon.net] has joined #ubuntu | ||
| wastrel | drwxrwsr-x 4 root staff 4096 2005-01-14 23:51 /home/ | 03:31 |
| ic56 | Eleaf: why 775? Should 755. | 03:31 |
| wastrel | that's mine by default | 03:31 |
| Eleaf | oh | 03:31 |
| illusions | bimberi The following packages will be REMOVED: | 03:32 |
| illusions | skype | 03:32 |
| rishi | what's up ubuntites | 03:32 |
| illusions | y/n | 03:32 |
| bimberi | swoop: no i have no idea really - http://www.informationweek.com/news/showArticle.jhtml?articleID=178600189&subSection | 03:32 |
| LathropWells | Hi rishi | 03:32 |
| illusions | bimberi The following NEW packages will be installed: | 03:32 |
| illusions | libqt3-mt | 03:32 |
| rishi | i think i have installed ubuntu in some form about 10 times in the last week. | 03:33 |
| treyh0 | there's nothing on ubuntuforums.org about k3bsetup2 being broken, and i saw that the debian bts blames it on an ubuntu patc | 03:33 |
| === p01n7 [n=p01n7@mctnnbsa31w-156034251238.nb.aliant.net] has joined #ubuntu | ||
| ic56 | Eleaf: one cannot execute a directory the execute bit was reused. On a directory it implements *search* permission -- it controls the right of users to descend through that directory. | 03:33 |
| treyh0 | patch | 03:33 |
| === brandon_ [n=brandon@cpe-72-178-105-87.satx.res.rr.com] has joined #ubuntu | ||
| swoop | bimberi, hmm, ok!! i'll read it soon, just let me finish installing nvidia's driver | 03:33 |
| ic56 | Eleaf: one cannot execute a directory so the execute bit was reused. On a directory it implements *search* permission -- it controls the right of users to descend through that directory. | 03:33 |
| bimberi | illusions: hm, go ahead with it, you'll be installing skype again anyway | 03:33 |
| illusions | ok | 03:33 |
| arrick | Im back home now | 03:33 |
| dt-oz-gc | Eleaf, cd /home/blend ; chmod 750 www ; cd www ; chmod -R 750 * | 03:33 |
| rishi | hey you guys think i should install ATI's driver or fglrx | 03:33 |
| === pianoboy3333 [n=pianoboy@ool-43567d61.dyn.optonline.net] has joined #ubuntu | ||
| Eleaf | dt-oz-gc, ok.. | 03:34 |
| ic56 | dt-oz-gc, Eleaf: 750 bad idea | 03:34 |
| Eleaf | dt-oz-gc, should the chmod -R 750 * be on the last directory? | 03:34 |
| pianoboy3333 | Anyone here ever tried using/compiling gtivo? | 03:34 |
| === harisund [n=harisund@ip24-255-87-152.br.br.cox.net] has joined #ubuntu | ||
| === param [n=param@219.64.66.17] has joined #ubuntu | ||
| === gfxstyler [n=gfxstyle@i577A5D09.versanet.de] has joined #ubuntu | ||
| gfxstyler | ic56: hi again | 03:34 |
| === PwcrLinuxLive [n=DS_Staff@user-12l2q7f.cable.mindspring.com] has joined #ubuntu | ||
| ic56 | $u3: did you find the answer? | 03:34 |
| === Hobbsee [n=Hobbsee@ubuntu/member/hobbsee] has joined #ubuntu | ||
| ic56 | gfxstyler: did you find the answer? | 03:35 |
| PwcrLinuxLive | Hello | 03:35 |
| dt-oz-gc | Eleaf, make that 770. 750 does not give write access to a group. | 03:35 |
| nickrud | rishi, a good rule of thumb is to use the distro's packages wherever possible. If you don't *need* the latest driver from ati for your card, stick with fglrx | 03:35 |
| Eleaf | humm | 03:35 |
| brandon_ | Hello all novice user here looking for assistance with unresolvable "lib" dependencies | 03:35 |
| Eleaf | so confused! ;p | 03:35 |
| twirpie | im still getting nowhere with running games through wine and without, and also still having problems getting clamav up and running, any help please? | 03:36 |
| gfxstyler | ic56: yes | 03:36 |
| PwcrLinuxLive | How I can change the ppls's nick name so it's new version of Xchat, I wanted the same one in old version | 03:36 |
| gfxstyler | ic56: it was very easy actually | 03:36 |
| ic56 | Eleaf: typically a ~/www directory needs to be publically readable. If you make it 770 (no perm for other) your webserver will be unable to access it u | 03:36 |
| gfxstyler | ic56: but you have to edit the gtkrc of your current theme | 03:36 |
| Eleaf | ic56, that's not my web dir | 03:36 |
| === PwcrLinuxLive is running in Live Cd | ||
| Eleaf | ic56, my main web dir is /var/www. The php script just saves it to a directory in /home/blend | 03:36 |
| rishi | who would like to tell me if i should use ATI drivers or Fglrx? anyone? | 03:36 |
| Eleaf | the uploaded file | 03:36 |
| nickrud | PwcrLinuxLive, click on the name next to the text entry line? | 03:37 |
| PwcrLinuxLive | okay | 03:37 |
| illusions | bimberi ok that is done | 03:37 |
| illusions | bimberi now next step? | 03:37 |
| twirpie | use ati as fglrx is prolly what screwed up my system | 03:37 |
| PwcrLinuxLive | Oh that's for nickname changes... | 03:37 |
| === dark_light [n=dark@20132191161.user.veloxzone.com.br] has joined #ubuntu | ||
| === ankur [n=ankur@student185-169.wr.siue.edu] has joined #ubuntu | ||
| arrick | how to change the mouse settings to one click in ubuntu | 03:38 |
| arrick | ? | 03:38 |
| nickrud | brandon_, what libs? | 03:38 |
| rishi | twirpie: what? | 03:38 |
| === topyli is now known as bruford | ||
| ic56 | Eleaf: the php script runs as a certain user and group. That user and group needs search permission on the directories leading to where the file will be written. Unless ~blend belongs to that group or that user, then you have to give search permission for other. | 03:38 |
| === varicello [n=italo@201.12.17.88] has joined #ubuntu | ||
| varicello | .br | 03:38 |
| === varicello [n=italo@201.12.17.88] has left #ubuntu ["Fui] | ||
| rishi | arrick: it was in system > preferences? | 03:38 |
| === pino [n=pino@214-239-126-200.fibertel.com.ar] has joined #ubuntu | ||
| arrick | ok | 03:38 |
| rishi | wasn't* | 03:38 |
| brandon_ | libmad0, and linid3tag0 | 03:38 |
| wastrel | we hates it | 03:38 |
| brandon_ | libid3tag0 | 03:38 |
| arrick | rishi, helps if I look doesnt it? | 03:39 |
| arrick | thanks | 03:39 |
| rishi | haha perhaps | 03:39 |
| ic56 | gfxstyler: are you talking about ~/.gtkrc or about a file located somewhere else? | 03:39 |
| rishi | arrick: no prob | 03:39 |
| === Syco54645 [n=frank@24-54-145-55.pittpa.adelphia.net] has joined #ubuntu | ||
| === ccc__ [n=ccc@c-940f70d5.015-28-6c6b7010.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| nickrud | brandon_, libmad0 is in main, no problem, but linid3tag0 doesn't show up anywhere; why do you need it | 03:39 |
| === rishi feels left out | ||
| === p01n7 [n=p01n7@mctnnbsa31w-156034251238.nb.aliant.net] has joined #ubuntu | ||
| twirpie | how come i have desk top sounds and when playing videos and mp3s but not from the web like flash games? | 03:40 |
| Eleaf | ic56, alright. (Wonders if I should just add blend and www-data to a group) Will this be easier? | 03:40 |
| arrick | rishi there is not a setting for one click? | 03:40 |
| brandon_ | trying to instal gstreamer0.8-mad | 03:40 |
| arrick | what next | 03:40 |
| nazty | how can i add a binary to update-alternatives --config | 03:40 |
| nazty | ? | 03:40 |
| illusions | bimberi sudo aptitude install libmad0 | 03:40 |
| === bruford is now known as topyli | ||
| bimberi | illusions: sorry, was away, try reinstalling skype again | 03:40 |
| swoop | bimberi, illusions it was a pleasure to talk and be helped with both of you... thanks!!! | 03:40 |
| brandon_ | or any meadi player for that matter its diffrent "lib" dependecny all around | 03:40 |
| PwcrLinuxLive | nickrud: this one is new version Xchat and Ubuntu 5.10 Live CD... I had the Live CD 4.10 that excatly I want use same themes of Xchat nicknames for example White < blue nick white > I use white foreground and black background. | 03:40 |
| dt-oz-gc | Eleaf, ic56, Maybe I would write the the file to /var/.../ or /tmp/... not /home/blend, ie to a common directory that is the store for the application... Or is blend an 'application only' account? | 03:41 |
| nickrud | twirpie, there's a couple of possibilities; http://wiki.ubuntu.com/RestrictedFormats has some suggestions | 03:41 |
| === gotaq [n=icebreak@l85-130-132-165.broadband.actcom.net.il] has joined #ubuntu | ||
| rishi | twirpie: double click the volume icon and see if its all un muted | 03:41 |
| bimberi | swoop: cheers :) | 03:41 |
| === elkyne is now known as elkbuntu | ||
| rishi | what's everyone trying to install | 03:41 |
| PwcrLinuxLive | dark gray hard to see for my nick messages | 03:41 |
| gfxstyler | ic56: the file in your theme directory, for example /home/user/.themes/bla/gtk-2.0/gtkrc | 03:41 |
| gotaq | what is the regex for catching everything between /.cond1 to a .\ ?? | 03:41 |
| illusions | swoop no prob but i know i was not much help lol | 03:41 |
| rishi | what is this libmad0 or something | 03:41 |
| nazty | how can i add a entry to update-alternatives --config????? | 03:41 |
| gfxstyler | ic56: then you need to add a few lines, should i send them to you via pastebin? | 03:41 |
| === udk is now known as UdontKnow | ||
| swoop | illusions, but your intention was very nice! :) thanks!! | 03:41 |
| swoop | bimberi, :) later! | 03:41 |
| pianoboy3333 | Anyone ever heard of gnome-config? | 03:42 |
| Eleaf | dt-oz-gc, what do you mean? | 03:42 |
| === gotaq [n=icebreak@l85-130-132-165.broadband.actcom.net.il] has left #ubuntu ["Leaving"] | ||
| nickrud | PwcrLinuxLive, ah, colors :) You can set them in Settings-Preferences-Interface-Colors ; I changed a few of the 'other colors' for a black background | 03:42 |
| === bobbyd [n=bobby@i-195-137-31-171.freedom2surf.net] has joined #ubuntu | ||
| rishi | pianoboy3333: are you talking about gconf-editor | 03:42 |
| === t1n_l0tus [n=lotus@cpe-72-226-4-218.nycap.res.rr.com] has joined #ubuntu | ||
| illusions | bimberi sudo aptitude install libstdc++5' should i do that next? | 03:42 |
| nickrud | PwcrLinuxLive, and your text is color #30 | 03:42 |
| swoop | bye :) | 03:42 |
| PwcrLinuxLive | okay hang on | 03:42 |
| dt-oz-gc | My understanding of /home is that it is intended for real users. Application users, eg postgres for the package/app of that named, are homed in /var/lib/[packageName] | 03:42 |
| rishi | illusions: what are you trying to install? | 03:42 |
| bimberi | illusions: ah, yes (sorry forgot that one) | 03:43 |
| pianoboy3333 | rishi: I'm trying to compile gtivo, and it's looking for a /usr/bin/gnome-config | 03:43 |
| === Engla [n=ulrik@kr-lun-116-144-233-83.3.cust.bredband2.com] has joined #ubuntu | ||
| pianoboy3333 | rishi: this is when I run ./configure | 03:43 |
| ic56 | gfxstyler: my ~/.themes/ contains only . and .. Yes, config lines much appreciated. If < 30 lines, just /query ic56 and paste them to me via IRC. | 03:43 |
| illusions | rishi skype | 03:43 |
| rishi | pianoboy3333: i dunno, i've never messed with gtivo...you don't like mythtv? | 03:43 |
| rishi | illusions: ah... | 03:43 |
| pianoboy3333 | rishi: what does mythtv do? | 03:43 |
| nazty | how can i add a entry to update-alternatives --config????? | 03:43 |
| dt-oz-gc | Eleaf, What is 'blend'? | 03:43 |
| gfxstyler | ic56: http://www.gfxstyler.de/screenshots/Screenshot.jpg that's bold-menubars in action :D | 03:43 |
| gfxstyler | ic56: no its just 5 lines or something like that | 03:43 |
| rishi | pianoboy3333: essentially the same thing as a tivo? www.mythtv.org | 03:44 |
| Eleaf | dt-oz-gc, a user | 03:44 |
| illusions | bimberi so i think its just those 2 that need to be installed right? | 03:44 |
| DBO | am I supposed to have 20 or so "gnome-pty-helper" entries in my system monitor? | 03:44 |
| === ccc__ [n=ccc@c-940f70d5.015-28-6c6b7010.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| === Kelsey23 [n=Kelsey23@unaffiliated/kelsey23] has joined #ubuntu | ||
| t1n_l0tus | *emoemo* My sound stopped working T_T. My volume control reads out "No volume control elements and/or devices found" when I try to open volume control. I have tried sudo gst-register-0.8 and su;gst-register-0.8 and in both cases re-logged in, but to no avail. | 03:44 |
| dt-oz-gc | A real user/person? | 03:44 |
| Kelsey23 | Is the latest Ubuntu compatible with the HP PSC 2400 AIO | 03:44 |
| brandon_ | Nickrud let see if i can paste the error i get | 03:44 |
| pianoboy3333 | rishi: gtivo connects to the tivo box if it's hooked up wifi so you can get the programs that are on there... | 03:44 |
| nickrud | brandon_, , sorry I missed your messages; if sudo apt-get gstreamer0.8-mad fails, you have some sources errors | 03:44 |
| nickrud | brandon_, ok | 03:44 |
| brandon_ | gstreamer0.8-mad: | 03:44 |
| brandon_ | Depends: libid3tag0 (>=0.15.1b) but it is not installable | 03:44 |
| brandon_ | Depends: libmad0 (>=0.15.1b) but it is not installable | 03:44 |
| dt-oz-gc | ... or a 'package'/'service'/'utility' | 03:44 |
| bimberi | illusions: yes, anyway the attempt to install skype will let you know for sure :) | 03:44 |
| Kelsey23 | Is the latest Ubuntu compatible with the HP PSC 2400 AIO? | 03:44 |
| rishi | pianoboy3333: ohhhh...sorry dude, i don't even have a tivo | 03:44 |
| pianoboy3333 | rishi: oh... | 03:45 |
| Eleaf | lol | 03:45 |
| illusions | bimberi ok thats done whats the next step | 03:45 |
| rishi | kelsey23: go to the ubuntu website and check hardware compatibility, it probably is | 03:45 |
| nickrud | brandon_, two lines, right on the edge :) you definitely have sources.list errors, you should go to !easysources | 03:45 |
| nickrud | !easysource | 03:45 |
| ubotu | For an easy to use custom sources.list creator, visit http://ubuntulinux.nl/source-o-matic | 03:45 |
| === Kelsey23 [n=Kelsey23@unaffiliated/kelsey23] has left #ubuntu ["Leaving"] | ||
| brandon_ | ill give it a try | 03:45 |
| PwcrLinuxLive | nickrud: Hmm, I didn't find it, probably can be change in advanced settings, too complexited for me.. | 03:46 |
| pianoboy3333 | does http://www.gnome.org not work for anyone else? | 03:46 |
| LadyNikon | is there a .chm reader? | 03:46 |
| pianoboy3333 | LadyNikon: sudo apt-get install xchm | 03:46 |
| === overrider_ [n=override@unaffiliated/overrider] has joined #ubuntu | ||
| === loele [n=asda@200-55-116-154.dsl.prima.net.ar] has left #ubuntu [] | ||
| nickrud | brandon_, enable everything above unofficial sources on that page | 03:46 |
| t1n_l0tus | Any idea why my sound stopped working, anyone? I've tried google, but alas it helped me not. | 03:46 |
| illusions | bimberi sudo aptitude install libstdc++5 is installed | 03:46 |
| === Knight_Lord [n=filipe@c-67-164-78-248.hsd1.ca.comcast.net] has joined #ubuntu | ||
| rishi | t1n_l0tus: there's nothing like that in the wiki? | 03:46 |
| nickrud | PwcrLinuxLive, menu bar, settings-preferences. Colors is right there on the left, click it | 03:46 |
| Eleaf | hmm | 03:47 |
| nazty | how can i add a entry to update-alternatives --config????? | 03:47 |
| t1n_l0tus | rishi, nothing that I saw, but I can check again. | 03:47 |
| === tenshiKur0 [n=tenshiKu@24.84.47.187] has joined #ubuntu | ||
| bimberi | illusions: righto, try the dpkg command again | 03:47 |
| nickrud | nazty, from the man page: update-alternatives --install genname symlink altern priority [--slave genname symlink altern] ... | 03:48 |
| twirpie | bah this is way to anoying having to screw around with everything just to have one thing work properly. seems nothing works propperly without being tweaked or fixed.... im going back to windows..... thanks for all the help peeps take care | 03:48 |
| illusions | sudo dpkg install skype? | 03:48 |
| === sgratra [n=sgratra@pool-68-238-156-28.dllstx.fios.verizon.net] has joined #ubuntu | ||
| PwcrLinuxLive | nickrud: Foreground white and black background already in there for message boxes, nicklist and etc.. so need to change the channel nicknames like I am seeing your nick is dark green or something.. | 03:48 |
| dt-oz-gc | Eleaf, i gotta go soon. Pvt chat? | 03:48 |
| Eleaf | dt-oz-gc, humm | 03:48 |
| arrick | illusions, get with Seveas about skype | 03:48 |
| arrick | there were some bugs he fixed | 03:49 |
| === akamatos [n=lycklig@athedsl-35063.otenet.gr] has joined #ubuntu | ||
| nazty | nickrud: there is a symlink there already | 03:49 |
| nazty | for irssi | 03:49 |
| Eleaf | dt-oz-gc, you there? | 03:49 |
| === madewokherd [n=urk@VRP5000.rhbd.psu.edu] has joined #ubuntu | ||
| bimberi | illusions: 'sudo dpkg --install skype_1.2.0.l8-lubuntu3_i386.deb' (from the directory where the .deb is located. Desktop?) | 03:49 |
| illusions | arrick i went to his site and i think i got the new one | 03:49 |
| === TheFaction20 [n=ubuntu@ip70-188-172-184.ri.ri.cox.net] has joined #ubuntu | ||
| pianoboy3333 | !gnome-conf | 03:49 |
| ubotu | pianoboy3333: Not a clue. Try searching at http://ubuntu.cc.com.au/ | 03:49 |
| pianoboy3333 | !gnome-config | 03:49 |
| ubotu | pianoboy3333: I haven't a clue, try searching at http://ubuntu.cc.com.au/ | 03:49 |
| illusions | bimberi yes desktop | 03:49 |
| rishi | t1n_l0tus: what did you do just before your sound got effed? | 03:49 |
| arrick | ok | 03:49 |
| nazty | nickrud: update-alternatives --install epic5 irc ? | 03:49 |
| TheFaction20 | How can i find out if my sound cards detected if no sound is coming out? | 03:50 |
| === PwcrLinuxLive 's lappy fully compatible Unbuntu 5.10 and automounted drives | ||
| rishi | TheFaction20: double click the sound icon and see if your card is in the title | 03:50 |
| akamatos | hi, does anyone know where can i find skins for nautilus? | 03:50 |
| === gfxstyler [n=gfxstyle@i577A5D09.versanet.de] has left #ubuntu ["Leaving"] | ||
| nazty | nickrud: update-alternatives --config irc :already exists i just wanna add epic5 to it | 03:50 |
| nickrud | nazty, why do you want to change the alternative for irssi anyway? (I'm suprised there is one in the first place) | 03:50 |
| nazty | i use epic | 03:50 |
| nickrud | ah irc | 03:50 |
| nazty | i was using epic4 | 03:50 |
| dt-oz-gc | Eleaf, write into the pvt chat window/tab, not here. | 03:51 |
| brandon_ | Nickrud once I enabled all above unofficial and it generates the list what do i do? | 03:51 |
| nazty | and it placed epic4 in update-alternatives | 03:51 |
| === ankur is now known as ports- | ||
| === udk [i=udontkno@freenode/staff/udontknow] has joined #ubuntu | ||
| Eleaf | dt-oz-gc, you aren't registered | 03:51 |
| nazty | but i just compiled epic5 manually because there is no .deb for it | 03:51 |
| Eleaf | dt-oz-gc, identified | 03:51 |
| nazty | and i wanna add it | 03:51 |
| arrick | TheFaction20, did you get it going? | 03:51 |
| === justin_ [n=pelicanr@adsl-8-212-209.mia.bellsouth.net] has joined #ubuntu | ||
| === jgerace [n=justin@pool-71-245-80-238.syrcny.fios.verizon.net] has joined #ubuntu | ||
| TheFaction20 | arrick:i havent tried yet. im not sure what i wnat to do since it still is a family comp | 03:51 |
| TheFaction20 | arrick: i might use our secondary comp which is kinda messed up | 03:51 |
| Eleaf | dt-oz-gc, ??? | 03:52 |
| nickrud | brandon_, copy and paste the automatically generated sources.list to your desktop, and then sudo cp ~/Desktop/sources.list /etc/apt/sources.list | 03:52 |
| rishi | TheFaction20: what kind of soundcard do you have? | 03:52 |
| arrick | ok | 03:52 |
| TheFaction20 | rishi:creative | 03:52 |
| === Fiscal [n=pscabral@20151147195.user.veloxzone.com.br] has joined #ubuntu | ||
| pianoboy3333 | damnit! I wanna get on to gnome.org! | 03:52 |
| arrick | !language | 03:52 |
| ubotu | Please watch your language. We try to be nice and help but some of us don't like to see such things on our screen. | 03:52 |
| nazty | nickrud: how would you add a entry to the preexisting table for update-alternatives --config irc | 03:52 |
| === hyphenated [n=cgilmour@nzns1.eservglobal.co.nz] has joined #ubuntu | ||
| === orangey [n=orangey@67.71.143.31] has joined #ubuntu | ||
| nickrud | nazty, a sec | 03:52 |
| orangey | hey all! | 03:52 |
| rishi | TheFaction20: i think you just have to play with the controls...i have a live 5.1 and it worked fine/ | 03:53 |
| rishi | ? | 03:53 |
| PwcrLinuxLive | nickrud: did you get my last msg in here? | 03:53 |
| === ic56 [n=ic@CPE0080c6e96fe2-CM000a73a108f3.cpe.net.cable.rogers.com] has left #ubuntu [] | ||
| orangey | hey all | 03:53 |
| orangey | ! | 03:53 |
| TheFaction20 | rishi:are there any sample sounds on the live cd? | 03:53 |
| ubotu | parse error: Try searching at http://ubuntu.cc.com.au/, orangey | 03:53 |
| rishi | sup | 03:53 |
| orangey | : ) | 03:53 |
| === Fiscal [n=pscabral@20151147195.user.veloxzone.com.br] has left #ubuntu ["Leaving"] | ||
| === angustia [n=arrozcru@trindade.linhalivre.net] has joined #ubuntu | ||
| angustia | hello | 03:53 |
| rishi | sup | 03:53 |
| sgratra | Newbie question: Hi, can someone explaine the Ubuntu/Linux directory structure? I am used to windows and everything installing in C:\Program Files - is there an equivilant in Linux? | 03:53 |
| rishi | TheFaction20: to be honest..i have no idea..you might look in the system>preferences, maybe there's a sound menu | 03:54 |
| nickrud | PwcrLinuxLive, yes, on the text box preference page, untick colorized nicknames I think | 03:54 |
| wastrel | sgratra: most programs will be in /usr/bin/ | 03:54 |
| angustia | I just installed ubuntu, but I can't login... I most probably typed (and retyped) a password that's not the one I usually use. I don't feel like reinstalling the system, so I'm thinking of editing the passwd and shadow files | 03:54 |
| PwcrLinuxLive | okay hang on nick | 03:54 |
| nalioth | sgratra: you should always use your package manager to install things | 03:54 |
| === nemonic [n=fed@24.115.208.241.res-cmts.sth.ptd.net] has joined #ubuntu | ||
| === HighHopes [n=gsalvini@201.255.136.203] has joined #ubuntu | ||
| frank23 | sgratra: that was the most alien thing about linux when I started using it. There should be references about this online | 03:54 |
| illusions | bimberi ok dpkg: error processing skype_1.2.0.l8-lubuntu3_i386.deb (--install): | 03:54 |
| PwcrLinuxLive | .. | 03:54 |
| angustia | I have access to the files in windows. what should I change in passwd to have a known password to login in ubuntu? | 03:54 |
| HighHopes | Hello! I want to know how can I install "chkfontpath" in Ubuntu 5.10 | 03:54 |
| nickrud | nazty, i installed epic4, and sudo update-alternatives --config irc and select epic4 | 03:55 |
| illusions | bimberi cannot access archive: No such file or directory | 03:55 |
| illusions | Errors were encountered while processing: | 03:55 |
| illusions | skype_1.2.0.l8-lubuntu3_i386.deb | 03:55 |
| === martyv [n=marty@203-206-241-200.dyn.iinet.net.au] has joined #ubuntu | ||
| nemonic | nickrud: but i just compiled epic5 | 03:55 |
| PwcrLinuxLive | nickrud: my own nick and message still dark colors and others uses blue nicks and didn't have white < and > on it | 03:55 |
| bimberi | angustia: boot into recovery mode (at the grub menu) and use 'passwd <user>' to set a new password | 03:55 |
| nemonic | there is no alternative for it | 03:55 |
| nemonic | just irssi and epic4 | 03:55 |
| === ubuntu [n=ubuntu@p5492DF05.dip.t-dialin.net] has joined #ubuntu | ||
| === MdSalih3 [n=sd324fsd@host86-128-184-186.range86-128.btcentralplus.com] has joined #ubuntu | ||
| nemonic | thats because they were installed by synaptics | 03:55 |
| ubuntu | hallo | 03:55 |
| orangey | I'm trying to use firestarter, but it keeps flooding my /var/log/syslog file. | 03:55 |
| ubuntu | exit | 03:56 |
| orangey | how can i make it NOT talk to syslog? | 03:56 |
| nickrud | PwcrLinuxLive, then possibly xchat changed, I don't even remember the <> around nicks | 03:56 |
| nemonic | i just want to add /usr/local/bin/epic5 | 03:56 |
| bimberi | illusions: are you in the right directory? use 'ls' to make sure the file is there | 03:56 |
| angustia | bimberi: thanks... won't it ask me for the actual password? | 03:56 |
| frank23 | sgratra: programs in /usr/bin libraries in /usr/lib, configuration files in /etc, temp files in /tmp, all your personal config and data files in /home/user | 03:56 |
| === pitti [n=pitti@ubuntu/member/pitti] has joined #ubuntu | ||
| TheFaction20 | rishi:is there a way i can see what my sound card may be named? | 03:56 |
| bimberi | angustia: no - it goes straight to a superuser prompt | 03:56 |
| PwcrLinuxLive | nickrud: yea, that's i like old one.. | 03:56 |
| rishi | TheFaction20: does the computer currently work? without the live cd? | 03:56 |
| illusions | bimberi type ls in terminal? | 03:56 |
| TheFaction20 | yeh | 03:56 |
| angustia | bimberi: cool. that's kind of unsafe though... but ok. I'll try | 03:56 |
| === seth is now known as seth|away | ||
| nemonic | nickrud: any clue | 03:57 |
| Eleaf | bash: ./configure: /bin/sh^M: bad interpreter: No such file or directory | 03:57 |
| rishi | TheFaction20: the other thing is if you're running a live cd, it might have lil support for sound...but don't quote me | 03:57 |
| Eleaf | I'm getting this when trying to compile something | 03:57 |
| bimberi | illusions: yes, and see if the skype......deb file is there | 03:57 |
| _jason | Eleaf: that file was saved on a mac, you need to convert it | 03:57 |
| TheFaction20 | rishi: ok | 03:57 |
| illusions | bimberi illusions@comcast:~/Desktop$ ls | 03:57 |
| illusions | skype_1.2.0.18-1ubuntu3_i386.deb skype-1.2.0.18-fc3.i586.rpm | 03:57 |
| sgratra | frank23 - thanks! I also just did a search for file structure differences. | 03:57 |
| Eleaf | I searched in configure but didn't see anything regarding... | 03:57 |
| rishi | TheFaction20: what are you running on it natively? | 03:57 |
| Eleaf | _jason, oh really? | 03:57 |
| nickrud | nemonic, yeah a clue. a sec | 03:57 |
| illusions | bimberi yes it is | 03:57 |
| Eleaf | _jason, alright, what needs to be done? | 03:57 |
| TheFaction20 | rishi:xp | 03:57 |
| illusions | bimberi i beleave | 03:57 |
| rishi | TheFaction20: haha does that mean you don't know? | 03:58 |
| rishi | TheFaction20: well, does it normally run windows? | 03:58 |
| nemonic | prolly update-alternatives epic5 irc | 03:58 |
| TheFaction20 | rishi:yeah windows xp | 03:58 |
| wastrel | sgratra: https://wiki.ubuntu.com/LinuxFilesystemTreeOverview pretty basic but links to more detailed info | 03:58 |
| bimberi | illusions: gah, my pasted command was wrong ... try 'sudo dpkg -i skype_1.2.0.18-1ubuntu3_i386.deb' | 03:58 |
| _jason | Eleaf: make a backup first. The try converting the files with 'sed -i s/\r// file' or search google for the problem and verify the solution :) | 03:58 |
| rishi | TheFaction20: well, you can check what soundcard you have via XP by going to the device manager | 03:59 |
| Eleaf | _jason, I'll try. is file the "configure" file I need to convert? | 03:59 |
| === angelika [n=angelika@NEW-FOUR-O-SEVEN.MIT.EDU] has joined #ubuntu | ||
| sgratra | wastrel: beautiful - I appreciate it. | 03:59 |
| _jason | Eleaf: I don't know, probably all the text stuff | 03:59 |
| rishi | TheFaction20: in ubuntu, you might try system > Administration > Device Manager | 03:59 |
| illusions | bimberi ok its doing something lol | 03:59 |
| Eleaf | _jason, wha? every file then? lol | 03:59 |
| HighHopes | Hello! I want to know how can I install "chkfontpath" in Ubuntu 5.10... please.. somebody can help me? | 04:00 |
| _jason | Eleaf: I have no idea, what are you compiling? | 04:00 |
| Eleaf | I still get that error | 04:00 |
| rishi | !chkfontpath | 04:00 |
| ubotu | I haven't a clue, try searching at http://ubuntu.cc.com.au/, rishi | 04:00 |
| Eleaf | _jason, the emulator "gens" | 04:00 |
| === mangz74 [n=aliwas@c-68-54-172-69.hsd1.md.comcast.net] has joined #ubuntu | ||
| HighHopes | !chkfontpath | 04:00 |
| angelika | Hi Anybody know how to make Ubuntu work with my Audigy 2 NX? | 04:00 |
| === Versed [n=Versed@c-69-253-173-154.hsd1.nj.comcast.net] has joined #ubuntu | ||
| rishi | HighHopes: try looking through the wiki | 04:00 |
| rishi | i've never heard of that | 04:00 |
| illusions | bimberi ok no errors now | 04:01 |
| _jason | Eleaf: you can try dos2unix command, maybe that works despite it's name :) | 04:01 |
| illusions | bimberi I see it in applications>internet | 04:01 |
| HighHopes | rishi, no info in the wiki :( | 04:01 |
| === FliesLikeALap [n=Ryan@vpnwl-228-125.net.rpi.edu] has joined #ubuntu | ||
| frank23 | Eleaf: for genesis? did you try dgen? it's in the repos. I never tried it though | 04:01 |
| === [SEAWOLF] [n=seawolf@host166-57.pool8261.interbusiness.it] has joined #ubuntu | ||
| PwcrLinuxLive | for ppl who own the Sony Vaio PCG GRZ610, it's everything fully compatible 5.10.. but mousepad need be turn off the ALPS.. I'm using USB mouse for awhile.. (using a live CD while my lappy HD's dead and plan to get new HD) | 04:02 |
| rishi | did you try sudo apt-get install chkfontpath? | 04:02 |
| pianoboy3333 | Anyone know where to get the package/rpm of gnome-libs-devel or gnome-config? | 04:02 |
| Eleaf | frank23, I tried other genesis emulators and they work fine. I need gens's netplay ability though ;/ | 04:02 |
| HighHopes | rishi, yes... no package available. | 04:02 |
| nickrud | nemonic, try sudo update-alternatives --install /usr/bin/irc irc /usr/bin/epic5 50 | 04:02 |
| Eleaf | _jason, lol | 04:02 |
| rishi | HighHopes, have you opened up all the repositories? | 04:02 |
| wastrel | dos2unix should work for removing windowsish newlines | 04:02 |
| brandon_ | Nickrud, let me show you what I typed and the error it gave me | 04:02 |
| _jason | wastrel: how about macs with ^M's | 04:02 |
| nickrud | nemonic, been a while since I looked at it, had to read the manpage agian | 04:02 |
| brandon_ | brandon@LinuxToshiba:~$ sudo cp ~/desktop/sources.list /etc/apt/sources.list | 04:02 |
| brandon_ | cp: cannot stat `/home/brandon/desktop/sources.list': No such file or directory | 04:02 |
| frank23 | Eleaf: maybe look in the forums for a post about gens | 04:02 |
| Eleaf | hmm, ok. | 04:03 |
| bimberi | pianoboy3333: install libgnome-dev (tip: contents search on http://packages.ubuntu.com) | 04:03 |
| wastrel | _jason: think so not sure | 04:03 |
| nickrud | brandon_, desktop with a Capital D , and I hope you saved the file as sources.list :) | 04:03 |
| HighHopes | rishi, yes... | 04:03 |
| _jason | I'll try making one :) | 04:03 |
| === ubuntu [n=ubuntu@64.237.243.41] has joined #ubuntu | ||
| pianoboy3333 | bimberi: THANKS~ | 04:03 |
| === gilianima [n=yanimax_@lab75-3-82-235-26-179.fbx.proxad.net] has joined #ubuntu | ||
| brandon_ | nickrud yes i saved it =) and thanks (my mind is still windows) | 04:03 |
| rishi | HighHopes: so you have universe and multiverse repos? | 04:03 |
| rishi | HighHopes: how about downloading it from whatever site you found it | 04:04 |
| === _tester_ [n=yz@ool-182c08d1.dyn.optonline.net] has joined #ubuntu | ||
| HighHopes | rishi, let me see... how can I be sure of that? | 04:04 |
| PwcrLinuxLive | nickrud: does the dapper will be release in the future will have a mouse settings for ALPS (tapping/scroll sides)? | 04:04 |
| nickrud | brandon_, np, that's something we all do (I have a symlink from desktop to Destop just for that error) | 04:04 |
| Eleaf | I guess somebody make a deb file frank23 . should I trust it? ;p. I just want a binary, I don't want to install it system wide. | 04:04 |
| rishi | sudo gedit /etc/apt/sources.list | 04:04 |
| Xenguy | _jason: if you have vi or vim, :%s/Ctrl-V Enter//g ? | 04:04 |
| === nickrud looks over his shoulder | ||
| === mangz74 is now known as aliwas | ||
| _jason | Xenguy: ctrl-v M right? | 04:04 |
| nickrud | PwcrLinuxLive, I have not a clue, I'm not an ubuntite :) | 04:04 |
| rishi | booyah! | 04:04 |
| PwcrLinuxLive | nickrud: okay :) | 04:05 |
| === pete_ [n=pete@24-178-33-146.dhcp.sprn.tx.charter.com] has joined #ubuntu | ||
| === scotty [n=scotty@63-226-215-196.tukw.qwest.net] has joined #ubuntu | ||
| _jason | Xenguy: ctrl-v ctrl-m rather | 04:05 |
| HighHopes | rishi, I read /etc/apt/sources.list and yes... multiverse and universe are enabled as repos... | 04:05 |
| Xenguy | _jason: no, press Enter key instead (if like on d0ze) | 04:05 |
| pete_ | hey everyone. I need some help badly | 04:05 |
| Xenguy | _jason: that works too | 04:05 |
| === __zen__ [n=Vincent@59.108.23.194] has joined #ubuntu | ||
| === flat [n=gerhard@85-124-56-246.dynamic.xdsl-line.inode.at] has joined #ubuntu | ||
| rishi | nickrud, you are an ubuntite, just a fellow newbie like me maybe | 04:05 |
| _jason | Xenguy: ah I see, that generates too. Cool, never knew that | 04:05 |
| pete_ | like, literally holding my hand in the process kind of help | 04:05 |
| Xenguy | _jason: :-) | 04:05 |
| nickrud | nemonic, I forgot one thing, I assumed the location and name for epic5 | 04:05 |
| illusions | bimberi I think it worked | 04:05 |
| rishi | HighHopes: have you tried trying to just download one from the internet? | 04:05 |
| brandon_ | Nickrud, when i typed it that time and pressed enter brandon@LinuxToshiba:~$ sudo cp ~/Desktop/sources.list /etc/apt/sources.list | 04:05 |
| brandon_ | brandon@LinuxToshiba:~$ | 04:05 |
| === Sir_Fawnpug [n=raving@adsl-065-013-184-082.sip.shv.bellsouth.net] has joined #ubuntu | ||
| bimberi | illusions: :) | 04:06 |
| === giruz [n=giruz@c220-237-7-137.randw1.nsw.optusnet.com.au] has joined #ubuntu | ||
| nickrud | brandon_, looks good then. sudo aptitude update, then try installing gstreamer0.8-mad | 04:06 |
| === paolob [n=donpaolo@pri-214-b7.codetel.net.do] has joined #ubuntu | ||
| === nazty1 [n=fed@24.115.208.241.res-cmts.sth.ptd.net] has joined #ubuntu | ||
| HighHopes | yes but there are only RPM .. not DEB files | 04:06 |
| nazty1 | nickrud: i just totally messed it up ;) | 04:06 |
| nickrud | rishi, I never even signed the coc, that's a first step I think | 04:06 |
| Sir_Fawnpug | Greetings everybody, I have a question about the Acer Aspire 3004WLCi's wireless (Broadcom 3418) | 04:06 |
| rishi | HighHopes: well you should be able to turn that into a .deb | 04:06 |
| illusions | bimberi add me oldyoda69 | 04:06 |
| === AngryElf [n=AngryElf@ip68-100-101-98.dc.dc.cox.net] has joined #ubuntu | ||
| brandon_ | wee all kinda of things are happening | 04:06 |
| rishi | nickcrud: i don't even know what coc is? | 04:07 |
| === aliwas is now known as mangz74 | ||
| nickrud | nazty1, how? | 04:07 |
| === rubso [n=please@195.39.180.119] has joined #ubuntu | ||
| AngryElf | hey all, what's a quick way to find out the total size of all the files in a directory? | 04:07 |
| rubso | Hi :) | 04:07 |
| giruz | Hi everybody, I'm using an ubuntu live and I'm trying to connect to my wifi network but it doesn't work. I'm following what the wiki says here: https://wiki.ubuntu.com/WirelessNetworking | 04:07 |
| nickrud | rishi, Code of Conduct | 04:07 |
| PwcrLinuxLive | AngryElf: df in terminal box | 04:07 |
| arrick | What are some good accouting programs for ubuntu? | 04:07 |
| giruz | do I have to do something after? | 04:07 |
| === tanuki [n=tanuki@adsl-69-155-139-115.dsl.hstntx.swbell.net] has joined #UBUNTU | ||
| rishi | nickrud: apparently i haven't either then, haha. | 04:08 |
| bimberi | illusions: haha, ok, i don't have skype here though | 04:08 |
| === tanuki_ [n=tanuki@adsl-69-155-139-115.dsl.hstntx.swbell.net] has joined #UBUNTU | ||
| nickrud | arrick, most of the good ones cost money, but gnucash & grisbi are ok | 04:08 |
| brandon_ | Nickrud, I LOVE YOU | 04:08 |
| === billytwowilly [n=billy@S0106000c413a2c0c.ed.shawcable.net] has joined #ubuntu | ||
| rubso | Hi guys, i like using KDE, and i want to download Kubunut, i'm wondering if Kubuntu supports all GNOME/GTKs Applications? thanks. | 04:08 |
| Sir_Fawnpug | Basically I'm having compiler issues with acer_acpi, which regurgitates FATAL: Error inserting acer_acpi (/lib/modules/2.6.12-9-386/extra/acer_acpi.ko): No such device | 04:08 |
| Sir_Fawnpug | " | 04:08 |
| arrick | thnks | 04:08 |
| Sir_Fawnpug | Err, sorry about the extra \n | 04:08 |
| nickrud | brandon_, I take it that means success :) | 04:08 |
| Sir_Fawnpug | And whoops, it ain't a compiler issue either, haha | 04:09 |
| brandon_ | =) | 04:09 |
| paolob | Hi guys! I want to execute a gnome program on a computer of my lan, but as another user. I'm the principal user (the one that can use sudo) on both my computer and the other, but I don't know the password of the user I want to run the program. I tried something like "ssh -Yf otherpc gksudo gksuexec nautilus", but I can't have it work. Any idea? | 04:09 |
| AngryElf | PwcrLinuxLive, that gives the whole file system, what about a specific directory? | 04:09 |
| === rubso Hi guys, i like using KDE, and i want to download Kubunut, i'm wondering if Kubuntu supports all GNOME/GTKs Applications? thanks. | ||
| rishi | nickrud: what's the difference between aptitude and apt-get, any idea? | 04:09 |
| Sir_Fawnpug | paolob, sudo can be useful for that. | 04:09 |
| paolob | clearly both pc are ubuntu | 04:09 |
| === edcorcoran [n=ed@ip70-178-215-66.ks.ks.cox.net] has joined #ubuntu | ||
| rishi | rubso: what? | 04:09 |
| wastrel | AngryElf: du -sh /some/directory | 04:09 |
| Sir_Fawnpug | err, whoops, I responded too quickly. | 04:09 |
| === ralpho [n=root@ip68-108-209-84.ph.ph.cox.net] has joined #ubuntu | ||
| paolob | Sir_Fawnpug, how? | 04:09 |
| PwcrLinuxLive | Anger: try df -? for help information | 04:10 |
| rubso | rishi, kubuntu supports all GNOME/GTKs apps ? | 04:10 |
| illusions | bimberi it works i am on voise with a friend now thanks you so much | 04:10 |
| rishi | rubso: kubuntu is kde | 04:10 |
| edcorcoran | I'm having trouble getting Ubuntu Breezy Badger to recognize my soundcard, which is a Soundblaster Live. | 04:10 |
| AngryElf | wastrel, thanx | 04:10 |
| bimberi | illusions: enjoy! :) | 04:10 |
| _jason | rishi: aptitude keeps track of the dependencies that get installed with packages and it also has an interface if you just run 'aptitude'. There is probably a lot more but that is all I know :) | 04:10 |
| nickrud | rishi, aptitude tracks the packages that were installed as dependencies of things that you explicitly installed; if a dependency is no longer needed (you removed the program you installed) aptitude will also uninstall the dependencies. | 04:10 |
| rubso | rishi i'm waiting -_- | 04:10 |
| nickrud | rishi, it also has really nice sorting & searching functions built in | 04:10 |
| rishi | nickrud: but doesn't apt-get do that? | 04:10 |
| === pianoboy3333 [n=pianoboy@ool-43567d61.dyn.optonline.net] has left #ubuntu ["111RAMBLE] | ||
| nickrud | rishi, not the removal of unused dependencies, no | 04:11 |
| rishi | hmm...really? | 04:11 |
| Sir_Fawnpug | Well I can't reember if sudo requires you're in wheel or not, this is my first serious ubuntu installation and things are probably different. | 04:11 |
| illusions | bimberi only one bug i cant see any of my friends online but oh well lol | 04:11 |
| rishi | interestign | 04:11 |
| Kritical | Something is using 100% of my processor and I cant see it in the tasks list... any help? =( | 04:11 |
| _jason | rishi: nope, if you install something like kubuntu-desktop and then remove it, it won't remove all of the dependencies that got installed if you use apt-get | 04:11 |
| rubso | who's using Kubuntu here? | 04:11 |
| nickrud | rishi, and I absolutely love the interactive ncurses interface :) | 04:11 |
| _jason | rubso: #kubuntu has a lot of kubuntu users :) | 04:11 |
| giruz | Hi everybody, I'm using an ubuntu live and I'm trying to connect to my wifi network but it doesn't work. I'm following what the wiki says here: https://wiki.ubuntu.com/WirelessNetworking . I see interface ath0 active but I'm unable to use internet... | 04:11 |
| rubso | ok | 04:11 |
| Sir_Fawnpug | If I'm not making any sense it's because I've been drinking. | 04:11 |
| bimberi | illusions: yes i don't know if the linux skype is a full blown version (i haven't used the windows one) | 04:11 |
| ralpho | k when g is so fast | 04:11 |
| === nazty [n=fed@24.115.208.241.res-cmts.sth.ptd.net] has joined #ubuntu | ||
| rishi | Sir_Fawnpug: i hear you | 04:11 |
| === nto-ubu [n=nto@h52n2fls31o290.telia.com] has joined #ubuntu | ||
| === rikai [n=rikai@pool-72-65-103-67.ptldme.east.verizon.net] has joined #ubuntu | ||
| Sir_Fawnpug | giruz, what chipset? You and I may be trying to get the same thing working. | 04:12 |
| nickrud | rishi, but if you did install kubuntu-desktop with aptitude, then removed it, all of the stuff that was pulled in would be uninstalled. | 04:12 |
| rishi | nickrud: obviously you are a lil more apt at this than i am, i don't know what ncurses is either :( | 04:12 |
| giruz | Sir_fawnpug: is intel centrino (bg2200) | 04:12 |
| edcorcoran | Anybody have any advice on getting Ubuntu to recognize a soundcard? | 04:12 |
| Sir_Fawnpug | giruz, ahh | 04:12 |
| rishi | nickrud: oh for real? that's awesome...i shall use that instead of apt-get now | 04:12 |
| giruz | Sir_Fawnpug: did I miss something: | 04:13 |
| giruz | Sir_Fawnpug: did I miss something? | 04:13 |
| nickrud | rishi, a text based screen writing & keyboard/mouse input library | 04:13 |
| nickrud | rishi, that was a lousy pun ;( | 04:13 |
| brandon_ | Nickrud, yes yes yes nickrud thanks so much all is working well im off to set the system up =) | 04:13 |
| rishi | nickrud: what do you need that for? | 04:13 |
| rishi | haha | 04:13 |
| nickrud | brandon_, you should be set for everything in the repos now, enjoy | 04:13 |
| === TSCHAK [n=thomas@71-208-166-27.hlrn.qwest.net] has joined #ubuntu | ||
| TSCHAK | is there a metapackage for installing build stuff? | 04:14 |
| bimberi | TSCHAK: build-essential | 04:14 |
| illusions | bimberi ok well this still works for sound and thats really what i need it for so its all good | 04:14 |
| illusions | bimberi ok thanks again | 04:14 |
| bimberi | illusions: yw :) | 04:14 |
| rishi | can anyone tell me if Dapper has the good ATI drivers by default? or do i have to install them? | 04:14 |
| nickrud | rishi, type aptitude on a command line, you're looking at ncurses | 04:14 |
| rishi | ok, hold up | 04:15 |
| === teldo [n=teldo@200.103.92.87] has joined #ubuntu | ||
| Sir_Fawnpug | giruz, not at all. I got a phone call. Isn't bg2200 the chipset intel wrote drivers for? | 04:15 |
| teldo | ola.......... alguem a usa o ubuntu??????????/ | 04:15 |
| frank23 | !es | 04:16 |
| ubotu | Hispanohablantes: Por favor usen #ubuntu-es, #kubuntu-es o #edubuntu-es, alli obtendran mas ayuda. | 04:16 |
| === we0 [n=weo@p5499C387.dip0.t-ipconnect.de] has joined #ubuntu | ||
| === Paul__ [n=paul@enigma.id.au] has joined #ubuntu | ||
| teldo | anybody else use ubuntu????????? | 04:16 |
| nto-ubu | is there netlimiter like program for linux? | 04:16 |
| rishi | teldo: i'm pretty sure everyone here uses ubuntu | 04:16 |
| === pianoboy3333 [n=pianoboy@ool-43567d61.dyn.optonline.net] has joined #ubuntu | ||
| ablyss | net limiter? | 04:16 |
| === bimberi is away (and only saying so because i've been active) | ||
| Sir_Fawnpug | teldo, I'm slowly beginning to use it, I'm from gentoo and decided I didn't want to compile everything on my laptop. | 04:16 |
| nickrud | teldo, well I think it's safe to say that 500 are | 04:16 |
| pianoboy3333 | Can someone help me with a ./configure issue here: http://paste.ubuntu-nl.org/11079 | 04:17 |
| === dip[x] [n=dip@ool-4573944e.dyn.optonline.net] has joined #ubuntu | ||
| ablyss | occasionly i use windows in here.. but normally ubuntu | 04:17 |
| === shadou [n=deejay@202-169-217-167.worldnet.co.nz] has joined #ubuntu | ||
| Sir_Fawnpug | ablyss, I went about two years using linux and then ended up using windows because of itunes, haha. | 04:17 |
| === TimmyJ [n=tim@resnet229-97.resnet.buffalo.edu] has joined #ubuntu | ||
| === scramblesend [n=scramble@218-168-185-114.dynamic.hinet.net] has joined #ubuntu | ||
| _jason | pianoboy3333: did you install the gnome dev packages? | 04:18 |
| giruz | Sir_Fawnpug: I don't know...just installed ubunt..Everything seems to work...except my stupid internet connection...I see ath0 active but I cannot ping even my router...I don;t know | 04:18 |
| arrick | ok guys im gonna go study wiki for a while | 04:18 |
| === therealphoenix [n=lx45803@c-24-56-215-118.chrlmi.cablespeed.com] has joined #ubuntu | ||
| scramblesend | hello | 04:18 |
| pianoboy3333 | _jason: can you tell me what they are? I think I have them though... | 04:18 |
| Sir_Fawnpug | giruz, if I'm not mistaken, wlan0 should be your wireless adapter. | 04:18 |
| === mking_ [n=mking@c-69-250-15-130.hsd1.md.comcast.net] has joined #ubuntu | ||
| TimmyJ | quick question, does anyone know if dapper drake will have out of box beagle integration? | 04:18 |
| scramblesend | can anyone tell me how to update ubuntu breezy. | 04:18 |
| teldo | I have some problems in use ubuntu. There are anybody to helpe me??? | 04:18 |
| PwcrLinuxLive | alright, I might come back.. Thank for help :) | 04:18 |
| _jason | pianoboy3333: libgnome-dev probably | 04:18 |
| Sir_Fawnpug | giruz, are you installing on a laptop? eth0 might refer to your 100BaseTX | 04:18 |
| Installer36 | Later Arrick | 04:19 |
| nto-ubu | my gf's brother are complaining course im "stealing" all the bandwith, is there a simple way for me to limit my use of the bandwith?? | 04:19 |
| teldo | I am from Brazil... | 04:19 |
| rishi | teldo: just type out the problem, someone probably can | 04:19 |
| arrick | I'll still be watching, ut later Installer36 | 04:19 |
| Installer36 | lol | 04:19 |
| Sir_Fawnpug | teldo, what kind of problems? I haven't used this distro much but I might be able to hel pyou. | 04:19 |
| giruz | Sir_Fawnpug: no...I'm right..I got the same screen as here https://wiki.ubuntu.com/WirelessNetworking | 04:19 |
| scramblesend | help please. | 04:19 |
| Sir_Fawnpug | giruz, well I haven't messed around with wireless too much so I'm not sure what the trend it. | 04:19 |
| giruz | but when even Ath0 says that I'm connected I'm still unable to ping my router... | 04:20 |
| Installer36 | ! Tell Installer36 about apptitude | 04:20 |
| ubotu | Installer36: Huh? Try searching at http://ubuntu.cc.com.au/ | 04:20 |
| === __zen__ [n=Vincent@59.108.23.194] has joined #ubuntu | ||
| _jason | teldo: se tu antes queres ajuda em portugues escreve: /join #ubuntu-br | 04:20 |
| === logical_mark [n=mark@24-179-41-206.dhcp.leds.al.charter.com] has joined #ubuntu | ||
| === aleNava [n=diego@200.77.215.66] has joined #ubuntu | ||
| IamEthos | hey | 04:20 |
| teldo | Fawnpug, How I can be able to get the root's password??? | 04:20 |
| AngryElf | scramblesend, apt-get upgrade | 04:20 |
| ablyss | nto-ubu, what type of connection do u use? wired or wireless? | 04:20 |
| === Paul__ [n=paul@enigma.id.au] has left #ubuntu [] | ||
| therealphoenix | Hi. My monitor can't handle the default resolution that Ubuntu uses when it first starts. How do I change it? | 04:20 |
| scramblesend | thanx AngryElf. | 04:21 |
| rishi | !aptitude | 04:21 |
| Sir_Fawnpug | teldo, the root password is hashed, so you can't reverse it. But, you can set it with the administration tools. | 04:21 |
| aleNava | alguien habla espanol? | 04:21 |
| wastrel | !es | 04:21 |
| ubotu | Hispanohablantes: Por favor usen #ubuntu-es, #kubuntu-es o #edubuntu-es, alli obtendran mas ayuda. | 04:21 |
| Sir_Fawnpug | teldo, actually that's the only thing I don't like about this distro so far, is the gratuitous use of sudo. | 04:21 |
| aleNava | ok | 04:21 |
| _jason | teldo: ubuntu's root password is locked. It is preferred that you use sudo. Check your private messages from ubotu for more info | 04:21 |
| _jason | ubotu: tell teldo about root | 04:21 |
| IamEthos | I have all of the SynapticsTouchpad lines commented out | 04:21 |
| pianoboy3333 | _jason: libgnome-dev is the newest vers | 04:21 |
| IamEthos | and yet it still works | 04:21 |
| AngryElf | Sir_Fawnpug, sudo -i ? | 04:21 |
| ablyss | the root pass isn't lock | 04:21 |
| IamEthos | can someone help me stop this damn thing | 04:21 |
| rishi | !tell teldo about root | 04:21 |
| _jason | pianoboy3333: check the README or INSTALL files for all the depends | 04:22 |
| _jason | ablyss: ? | 04:22 |
| pianoboy3333 | ok | 04:22 |
| Installer36 | ! Tell Installer36 about aptitude | 04:22 |
| ubotu | NO SPEAKE ENLISH! Try searching at http://ubuntu.cc.com.au/, Installer36 | 04:22 |
| teldo | thanks so much | 04:22 |
| === SkippyX [n=Thangleb@69.151.35.18] has joined #ubuntu | ||
| _jason | ubotu: tell Installer36 about apt | 04:22 |
| Installer36 | Thanks | 04:22 |
| Sir_Fawnpug | AngryElf, eh, it's just a personal preference of mine. | 04:22 |
| ablyss | _jason, the root pass can be set, just have to log in as super user terminal and change it | 04:23 |
| _jason | ablyss: yes, but it's locked by default :) | 04:23 |
| ablyss | yes | 04:23 |
| === kiwinz [n=kiwinz@222-152-108-174.jetstream.xtra.co.nz] has joined #ubuntu | ||
| === seth|away is now known as seth | ||
| therealphoenix | Does anyone know how to change the default screen resolution? | 04:23 |
| AngryElf | therealphoenix, system -> prefs -> screen res | 04:24 |
| Sir_Fawnpug | therealphoenix, you can change it in xorg.conf | 04:24 |
| jbroome | !resolution | 04:24 |
| ubotu | well, resolution is at https://wiki.ubuntu.com/FixVideoResolutionHowto | 04:24 |
| Sir_Fawnpug | Or I guess that, haha. | 04:24 |
| therealphoenix | Thank you | 04:24 |
| ablyss | i tried webmin off ubuntu synaptic list.. had hard time running it w/ out root pass.. finally figure out webmin uses root login by default | 04:24 |
| AngryElf | !life | 04:24 |
| ubotu | AngryElf: My cat's name is Mittens! Try searching at http://ubuntu.cc.com.au/ | 04:24 |
| AngryElf | lol | 04:24 |
| _jason | ubotu: tell ablyss about webmin | 04:24 |
| nickrud | !42 | 04:25 |
| ubotu | parse error: Try searching at http://ubuntu.cc.com.au/, nickrud | 04:25 |
| Sir_Fawnpug | Anybody familiar with acer_acpi? I'm having trouble getting it working. | 04:25 |
| ablyss | thanks _jason but i fixerd it long time ago | 04:25 |
| AngryElf | who names their cat Mittens anyways? | 04:25 |
| _jason | AngryElf: ubotu does apparently | 04:26 |
| nickrud | ablyss, you can set users allowed to use webmin in it's config I believe, that way you can get away from root there also :) | 04:26 |
| === mrios [n=mrios@c-24-61-12-141.hsd1.ma.comcast.net] has joined #ubuntu | ||
| === Engla [n=ulrik@kr-lun-116-144-233-83.3.cust.bredband2.com] has joined #ubuntu | ||
| === paolob [n=donpaolo@pri-214-b7.codetel.net.do] has left #ubuntu ["ci] | ||
| === gil- [n=gil@201.153.117.93] has joined #ubuntu | ||
| === britto [n=britto@c-71-196-91-49.hsd1.fl.comcast.net] has joined #ubuntu | ||
| === jariep1_ [n=a@adsl-68-91-26-173.dsl.eulstx.swbell.net] has joined #ubuntu | ||
| === Eleaf [n=ethan@71-208-126-224.hlrn.qwest.net] has joined #ubuntu | ||
| === Mastastealth [n=mastaste@adsl-153-167-129.mia.bellsouth.net] has joined #ubuntu | ||
| === Installer36 [n=chris@71-209-133-13.phnx.qwest.net] has joined #ubuntu | ||
| Eleaf | hello? | 04:28 |
| britto | hello | 04:28 |
| === TSCHAK [n=thomas@71-208-166-27.hlrn.qwest.net] has joined #ubuntu | ||
| Mastastealth | hi | 04:28 |
| britto | i am a newview to ubuntu | 04:28 |
| britto | i would like to upgrade my kernel to the latest version how would i do that? | 04:28 |
| Eleaf | ipfw, ?? | 04:29 |
| britto | can somebody help me? | 04:29 |
| Eleaf | who was just helping me? lol | 04:29 |
| === crxyem [n=dennis@c-71-234-187-45.hsd1.ct.comcast.net] has joined #ubuntu | ||
| SkippyX | K - got a weird configuration issue. I installed ubuntu. used automatix to nab the fonts. got repositories from the unofficial ubuntu starter guide (for breezy) from (I think ) linuxquestions.org. D/Led KDE 3.5. I like KDE and like gtk-based apps. Now the gtk apps fonts look like crap. | 04:29 |
| Sir_Fawnpug | britto, do you want to compile a new kernel or use a stock one? I can tell you how to do the former, I'm new to ubuntu too. | 04:29 |
| mrios | I have this wireless card and the source for the driver. I can't find the driver pre-compiled. Can anyone help me with some compile issues? | 04:29 |
| === [SEAWOLF] [n=seawolf@host166-57.pool8261.interbusiness.it] has joined #ubuntu | ||
| SkippyX | Tried to fix it through KDE's controls....no go. | 04:29 |
| === sH4 [n=foo@220.74.17.76] has joined #ubuntu | ||
| wastrel | !automatix | 04:29 |
| ubotu | methinks automatix is unsafe, it overwrites configuration files, and does things like "echo -e 'y\nY\n'" that are considered risky. Please do not use it. There are alternative applications, but it's often best to read the documentation. | 04:29 |
| === eobanb_ [n=eoban@156-56-151-125.dhcp-bl.indiana.edu] has joined #ubuntu | ||
| Sir_Fawnpug | Hmm, I wonder... | 04:30 |
| Installer36 | jason_ what I was wondering was the diference between apt-get and aptitude?....If any.. | 04:30 |
| Sir_Fawnpug | !acer_acpi | 04:30 |
| ubotu | Sir_Fawnpug: Some people juggle geese. Try searching at http://ubuntu.cc.com.au/ | 04:30 |
| britto | i would like to compile a new kernel | 04:30 |
| Sir_Fawnpug | Haha, oh well, was worth a shot. | 04:30 |
| Sir_Fawnpug | Ok britto, the first step is to download the kernel sources. | 04:30 |
| _jason | Installer36: aptitude keeps track of dependencies that get install with packages, apt-get doesn't. | 04:30 |
| Mastastealth | Intaller: aptitude is an apt-get client, like Synaptic, but for commandline | 04:30 |
| nto-ubu | ablyss, wired | 04:30 |
| === eobanb_ [n=eoban@156-56-151-125.dhcp-bl.indiana.edu] has joined #ubuntu | ||
| _jason | Installer36: that's the biggest difference | 04:30 |
| === me2win [n=me2win@adsl-69-152-254-245.dsl.snantx.swbell.net] has joined #ubuntu | ||
| ablyss | nto-ubu what? | 04:31 |
| Installer36 | Thank You | 04:31 |
| sHaDe | n8 all | 04:31 |
| britto | ok what else? | 04:31 |
| nto-ubu | ablyss, u asked what connection i used | 04:31 |
| Sir_Fawnpug | I assume you're using 2.6.* because that's what seems to be installd on the version I got. | 04:31 |
| === iGotNoTime [n=joshua@cpe-65-189-240-199.woh.res.rr.com] has left #ubuntu [] | ||
| Sir_Fawnpug | Britto, you can find your current kernel configuration in /proc/config.gz, I would recommend backing that up before you do anything. | 04:32 |
| britto | yes i have 2.6.* as well ... but i think there is an easier way to do this | 04:32 |
| === therealphoenix [n=lx45803@c-24-56-215-118.chrlmi.cablespeed.com] has joined #ubuntu | ||
| === eobanb_ [n=eoban@156-56-151-125.dhcp-bl.indiana.edu] has joined #ubuntu | ||
| britto | i believe there is an apt-get ... but i am searching for that one ... | 04:32 |
| Sir_Fawnpug | Britto, well I'm not sure but there may be like a stock kernel for i386 that they give you, I didn't pay much attention during the install process. | 04:32 |
| ablyss | nto-ubu oh okay, get yourself a windows 98 machine and do network sharing.. that will surely slow u down :P | 04:32 |
| Sir_Fawnpug | britto, there are kernel sources in the ubuntu tree you can download | 04:33 |
| bimberi | !tell Sir_Fawnpug about wireless | 04:33 |
| === Skippy_X [n=Thangleb@69.151.35.67] has joined #ubuntu | ||
| === crxyem [n=dennis@c-71-234-187-45.hsd1.ct.comcast.net] has left #ubuntu ["Konversation] | ||
| wastrel | when you apt-get upgrade the newest kernel should be installed, unless i'm mistaken | 04:33 |
| nto-ubu | ablyss, :P | 04:33 |
| Sir_Fawnpug | himberi, thank you. | 04:33 |
| britto | ok ... going through the forums it seems that i686 is more stable | 04:33 |
| bimberi | britto: linux-source-2.6.12 | 04:33 |
| britto | thats the reason I would like to upgrade it | 04:33 |
| Skippy_X | what a time for my dial-up to quit...... | 04:33 |
| bimberi | Sir_Fawnpug: np :) | 04:33 |
| === mauro [n=mauro@201.152.87.113] has joined #ubuntu | ||
| Skippy_X | anybody post a suggestion while I was reconnecting? | 04:34 |
| bimberi | britto: you can install linux-686 to get a 696 kernel | 04:34 |
| bimberi | *686 | 04:34 |
| === diego [n=diego@200.77.215.66] has joined #ubuntu | ||
| therealphoenix | how do you change the screen res used at the login screen? | 04:34 |
| === niki [n=juztin@68-184-136-55.dhcp.stbr.ga.charter.com] has joined #ubuntu | ||
| niki | what command would i use to print the contents of a directory into a text file? | 04:34 |
| wastrel | britto: uname -r | 04:34 |
| rishi | britto: sudo apt-get install linux-686 | 04:34 |
| pianoboy3333 | niki: ummm | 04:34 |
| ablyss | niki ls > textfile.txt | 04:34 |
| === p01n7 [n=p01n7@mctnnbsa31w-156034251238.nb.aliant.net] has joined #ubuntu | ||
| _jason | niki: ls > /path/to/textfile | 04:34 |
| niki | thanks _jason, ablyss | 04:34 |
| pianoboy3333 | niki: or folder/folder/* > file.txt | 04:35 |
| _jason | pianoboy3333: that wouldn't work :) | 04:35 |
| pianoboy3333 | _jason: why not? | 04:35 |
| britto | I have 2.6.12-10-386 | 04:35 |
| _jason | pianoboy3333: try it | 04:35 |
| britto | wastrel | 04:35 |
| niki | pianoboy3333, he's right | 04:36 |
| niki | pianoboy3333, i just tried, it didn't work...but thx anyway :) | 04:36 |
| britto | rishi i tried apt-get install linux-686 | 04:36 |
| ablyss | ls "/home/$whoami/docs/*" > textfile | 04:36 |
| _jason | pianoboy3333: you need to do something like echo /path/to/* > ok | 04:36 |
| Sir_Fawnpug | bimberi, well actually ndiswrapper works with the driver, I just have one of those wireless buttons that I apparently need kernel hooks for. | 04:36 |
| pianoboy3333 | ok | 04:36 |
| britto | but i get the message unable to lock the list | 04:36 |
| pianoboy3333 | _jason: ur right.... | 04:36 |
| pianoboy3333 | oz welz | 04:36 |
| === TimmyJ [n=tim@resnet229-97.resnet.buffalo.edu] has left #ubuntu ["Leaving"] | ||
| niki | :D:D | 04:36 |
| rishi | britto: did you capitalize the L | 04:36 |
| === __zen__ [n=Vincent@59.108.23.194] has joined #ubuntu | ||
| therealphoenix | How do you change the screen res used at the login screen? | 04:37 |
| === lbf [n=lbf@58.246.81.170] has joined #ubuntu | ||
| pianoboy3333 | _jason: do you know what to do about http://paste.ubuntu-nl.org/11079 ? | 04:37 |
| britto | yes i did rishi | 04:37 |
| Sir_Fawnpug | bimberi, and additionally, the module that accepts those scancodes doesn't want to load with lsmod. | 04:37 |
| Sir_Fawnpug | err | 04:37 |
| Sir_Fawnpug | modprobe, my bad. | 04:37 |
| rishi | hmm..that's weird | 04:37 |
| Sir_Fawnpug | I guess it would be kind of hard to load a module with lsmod. | 04:37 |
| _jason | pianoboy3333: you showed me that before | 04:37 |
| britto | i am logged in as root thouugh | 04:37 |
| rishi | wait | 04:37 |
| britto | hold i know the reason | 04:37 |
| rishi | then did you put sudo before it all | 04:37 |
| rishi | ? | 04:37 |
| pianoboy3333 | _jason: I know, do you know how I can fix it though, to make it work? | 04:38 |
| britto | i am running an instance of Automatix.. | 04:38 |
| rishi | britto: did you use sudo | 04:38 |
| britto | i don't use sudo. ... | 04:38 |
| _jason | pianoboy3333: make sure you have all the deps | 04:38 |
| bimberi | Sir_Fawnpug: ah, can't help there sorry, sometimes that wiki page has hints for particular cards ( :) at your subsequent posts) | 04:38 |
| britto | i logg in as root | 04:38 |
| rishi | in ubuntu? | 04:38 |
| rishi | i thought you couldn't | 04:38 |
| britto | i am old school and dont like the sudo | 04:38 |
| === p01n7 [n=p01n7@mctnnbsa31w-156034251238.nb.aliant.net] has joined #ubuntu | ||
| pianoboy3333 | _jason: /me does, it's some screwy thing with gnomemm | 04:38 |
| rishi | britto: you're lucky haha. | 04:38 |
| === ulrik [n=ulrik@kr-lun-116-144-233-83.3.cust.bredband2.com] has joined #ubuntu | ||
| niki | britto, i think with ubuntu you pretty much _have_ to use sudo :P | 04:38 |
| britto | rishi the reason is that I am running an instance of Automatix | 04:38 |
| Sir_Fawnpug | bimberi, no problem. I have one of those acer laptops that apparently the french love. | 04:39 |
| rishi | oh okay | 04:39 |
| britto | well you can get away with sudo ... do sudo passwd root | 04:39 |
| therealphoenix | Does anyone know how to change the screen resolution used when you start your computer? | 04:39 |
| _jason | pianoboy3333: google the error, you will probably get some hits | 04:39 |
| pianoboy3333 | ok | 04:39 |
| britto | and change the passwd to your new pwd ... and guess what from that point onwards | 04:39 |
| === pianoboy3333 [n=pianoboy@ool-43567d61.dyn.optonline.net] has left #ubuntu ["111RAMBLE] | ||
| britto | u get access to root | 04:39 |
| Sir_Fawnpug | therealphoenix, check /etc/X11/xorg.conf | 04:39 |
| bimberi | Sir_Fawnpug: well no wonder :P | 04:39 |
| rishi | niiice | 04:39 |
| === CuriousCat [n=CuriousC@203.177.88.26] has joined #ubuntu | ||
| === ^Odd^ [n=shane@24-177-148-2.dhcp.mrqt.mi.charter.com] has joined #ubuntu | ||
| ablyss | wonder why ls /home/$whoami/docs > file didn't work :'-( | 04:39 |
| rishi | therealphoenix: try the wiki, i don't know how to | 04:39 |
| Sir_Fawnpug | ablyss, has to be surrounded in backticks I think. | 04:40 |
| _jason | ablyss: ls /home/$(whoami)/docs > file might | 04:40 |
| bimberi | ablyss: $(whoami) | 04:40 |
| === Jivemonkey [n=Kevin@72.24.228.149] has joined #ubuntu | ||
| Sir_Fawnpug | or $(whoami) | 04:40 |
| ablyss | oh | 04:40 |
| bimberi | consensus is achieved on that one :) | 04:40 |
| === pete_ [n=pete@24-178-33-146.dhcp.sprn.tx.charter.com] has joined #ubuntu | ||
| niki | ok, how do i rename file.txt to file2.txt? | 04:40 |
| === mangz74 [n=aaron@c-68-54-172-69.hsd1.md.comcast.net] has joined #ubuntu | ||
| Sir_Fawnpug | niki, mv | 04:41 |
| === TheDracle [n=DerDracl@sbthomas.dsl.xmission.com] has joined #ubuntu | ||
| niki | Sir_Fawnpug, that's right...thx :P | 04:41 |
| Sir_Fawnpug | mv file.name file.new.name | 04:41 |
| TheDracle | Hm, I'm trying to netcat on a port on my machine, using "netcat -l 5000". | 04:41 |
| === reggaemanu_ [n=manu@ARennes-257-1-114-32.w86-210.abo.wanadoo.fr] has joined #ubuntu | ||
| britto | niki u can use link 2 | 04:41 |
| TheDracle | I then try to telnet to that port: telnet 127.0.0.1 5000 | 04:41 |
| ablyss | the program PrefixSuffix works nice to renaming multip files too | 04:41 |
| niki | britto, link? | 04:41 |
| TheDracle | And it blocks me. | 04:41 |
| TheDracle | telnet: Unable to connect to remote host: Connection refused | 04:41 |
| britto | yes link will create a second name to the first file | 04:42 |
| TheDracle | Is there some kind of firewall running by default on Ubuntu? | 04:42 |
| niki | britto, ah ok...but...it also leaves the old file | 04:42 |
| britto | it is kinda cool ... the inode is changed | 04:42 |
| Sir_Fawnpug | Is anybody familiar with acer_acpi? I'm having problems getting the module to load on my Acer 3004WLCi | 04:42 |
| Sir_Fawnpug | niki, did you type mv or cp? | 04:42 |
| === LathropWells [n=bill@cpe-72-134-66-177.socal.res.rr.com] has joined #ubuntu | ||
| britto | us mv as sirfwnpug says | 04:42 |
| jbroome | TheDracle: no FW 'cuase there's nothing listening by default | 04:42 |
| britto | it is easier | 04:42 |
| niki | Sir_Fawnpug, i used mv, it worked :) ... i was talking about when i used link | 04:43 |
| Sir_Fawnpug | Ahh | 04:43 |
| === kRaKoN [n=krakon@201.145.198.137] has joined #ubuntu | ||
| pete_ | heya... I need some help BADLY. I just switched from Windows XP to Ubuntu 5.10 today, but I have no idea what I'm doing. Can someone help answer some questions for me? | 04:43 |
| Sir_Fawnpug | Yeah, link basically stores a reference to the file. | 04:43 |
| === niki is learning some new console commands today :) | ||
| TheDracle | jbroome: netcat -l 5000 | 04:43 |
| TheDracle | jbroome: I have that running in the background, shouldn't that be listening? | 04:43 |
| Sir_Fawnpug | niki, I have a copy of the UNIX Programmer's Manual, Volume I for System III | 04:43 |
| therealphoenix | Sir_Fawnpug: I looked in the file, should i just delete the references to the bad screen res? | 04:43 |
| niki | Sir_Fawnpug, i got a copy of Linux In A Nutshell, it's a pretty good desk reference | 04:44 |
| Sir_Fawnpug | therealphoenix, if they're bad, yeah | 04:44 |
| pete_ | how do I install firefox 1.5? | 04:44 |
| therealphoenix | thank you | 04:44 |
| jbroome | TheDracle: yeah. but if you didn't start one, there shouldn't be a FW. | 04:44 |
| Sir_Fawnpug | pete_, it should come already installed. | 04:44 |
| === ulrik is now known as engla | ||
| ablyss | i got learn unix in 24 hours... and that was 6 years ago and im still learning | 04:44 |
| Dr_House | anyone notice very slow burning speeds (around 3.0x) when burning a .img dvd in K3D? | 04:44 |
| niki | lol ablyss | 04:44 |
| Sir_Fawnpug | niki, yeah, some things are easy to forget. | 04:44 |
| frank23 | !tell pete_ about ff1.5 | 04:44 |
| TheDracle | jbroome: Oh... I didn't... Which is why this is so strangely confusing... | 04:44 |
| pete_ | no, 1.0.7 came installed i mine | 04:44 |
| niki | same here, pete | 04:44 |
| Sir_Fawnpug | It kind of helps that I'm a programmer working in a unix environment most of the time. | 04:44 |
| niki | Sir_Fawnpug, lucky...i'm a fence installer :P | 04:45 |
| ablyss | i wire houses | 04:45 |
| pete_ | I'm so used to downloading simple .EXE files, that when I read about a terminal/console line, my jaw dropped | 04:45 |
| === _human_blip_ [n=mike@mike.nelsonbay.com] has joined #ubuntu | ||
| Sir_Fawnpug | niki, one way to make sure you'll never forget the commands is to install gentoo. | 04:45 |
| Sir_Fawnpug | In fact, gentoo was my first choice for this laptop, but I don't have distcc installed on either my athlon64 or my sparc. | 04:45 |
| niki | Sir_Fawnpug, i dunno...i think i might like ubuntu too much :P | 04:45 |
| Sir_Fawnpug | It would take way too long to get a decent system. | 04:46 |
| Sir_Fawnpug | niki, well debian's not a bad foundation for it. | 04:46 |
| frank23 | pete_: well software that you can install with synaptic is very easy. much easier than running around the web looking for programs | 04:46 |
| === hatake_kakashi [n=meh@60-240-187-186.tpgi.com.au] has joined #ubuntu | ||
| rishi | Sir_Fawnpug: i wanted to install gentoo, but i never could...i don't think i'm smart enough for it yet...:) | 04:46 |
| === Milk_ [n=amshake@12-221-178-11.client.insightBB.com] has joined #ubuntu | ||
| Sir_Fawnpug | Niki, I'm hoping one of these days somebody will come out with a "genbuntoo." | 04:46 |
| niki | Sir_Fawnpug, i've never used pure debian....but i've been through a lot of other installs that i just couldn't get working like this one | 04:46 |
| ablyss | im a OS hobbyist too been on a lot of systems, make you all feel special im using ubuntu :) | 04:46 |
| bimberi | Sir_Fawnpug: get to it :P | 04:47 |
| therealphoenix | How do I edit a write protected file? | 04:47 |
| Milk_ | Hello! Is it possible to control which monitor that software starts on when running a dual head setup? Or is that specific to the software? | 04:47 |
| rishi | therealphoenix: use sudo | 04:47 |
| frank23 | pete_: but ubuntu sticks with a version (like firefox 1.0.7) for 6 months. If you still want to update it;s a bit harder | 04:47 |
| Sir_Fawnpug | Rishi, gentoo isn't too hard, there's tons of documentation out there. | 04:47 |
| niki | Sir_Fawnpug, and for the record, the worst support came from slackware...i was banned within 5 minutes for asking for help installing my wireless network card on my laptop :( | 04:47 |
| IdleOne | therealphoenix, sudo gedit file.name | 04:47 |
| rishi | Sir_Fawnpug: i know..and i followed the tutorial...and it still didn't work! | 04:47 |
| Sir_Fawnpug | niki, I found the debian guys are arses too (is this a family channel?) | 04:47 |
| wastrel | !ff1.5 | 04:47 |
| ubotu | You can use firefox 1.5 by following this wiki page https://wiki.ubuntu.com/FirefoxNewVersion | 04:47 |
| pete_ | ehh I'd rather have something I'm used to... I suppose a technological insecurity of mine? =P | 04:47 |
| Sir_Fawnpug | rishi, what stage installation were you trying to install? | 04:47 |
| === mxpxpod [n=bryan@unaffiliated/mxpxpod] has joined #ubuntu | ||
| === BarneyWithoutApE [i=boxie@adsl-69-149-253-95.dsl.ltrkar.swbell.net] has joined #ubuntu | ||
| rishi | i dunno | 04:48 |
| === GhostXz [n=GhostXz@HSE-Montreal-ppp3469336.sympatico.ca] has joined #ubuntu | ||
| Sir_Fawnpug | bimberi, haha, actaully believe it or not I am writing something pretty complex, working on my own compiler just for my own purposes. | 04:48 |
| BarneyWithoutApE | How do I put more mHz into my Processor? its running a little slow | 04:48 |
| IdleOne | Sir_Fawnpug, yup it is a family channel :) | 04:48 |
| pete_ | so how does synaptic work? | 04:48 |
| pete_ | the concept is completely new to me | 04:48 |
| Milk_ | pete_, how do you mean? | 04:48 |
| Milk_ | its a GUI for apt | 04:48 |
| frank23 | !tell pete_ about synaptic | 04:48 |
| LathropWells | netcat is a "hacking" tool. - lol (glad to learn something of it just the same.) | 04:48 |
| Sir_Fawnpug | IdleOne, ahh, just making sure, I didn't want to get obscene because I tend to swear like a sailor otherwise. | 04:48 |
| BarneyWithoutApE | also, I put more PCI into my graphics, but the sata isnt running as fast | 04:49 |
| narg | so I set up wu-ftpd using webmin, and my user starts in the right place and can create files, but can't look. Any idea what I did wrong? | 04:49 |
| frank23 | pete_: synaptic can install any program in the ubuntu repositories easily (about 15000 packages) | 04:49 |
| Sir_Fawnpug | rishi, nothing scares a new linux user more than a stage 3 | 04:49 |
| Sir_Fawnpug | err, a stage 1 | 04:49 |
| === roylez [n=roy@147.8.245.23] has joined #ubuntu | ||
| Sir_Fawnpug | Beer does strange things to you. | 04:49 |
| === karl_ [n=dean@207.53.228.95] has joined #ubuntu | ||
| Sir_Fawnpug | The installation itself teaches you so much about general system administration. | 04:50 |
| Milk_ | anyone here have experiance forcing an application to open on a specific display? | 04:50 |
| === jane [n=jane@adsl-69-235-53-203.dsl.irvnca.pacbell.net] has joined #ubuntu | ||
| pete_ | I know how to find it, but I've never used something like it before | 04:51 |
| pete_ | so finding ff1.5, or anything for that matter, and installing it is waaay over my head | 04:51 |
| Sir_Fawnpug | Anyway niki, if you ever get the time and a spare machine, give it a try. | 04:51 |
| wastrel | Milk_: -display <displayname> ? | 04:51 |
| niki | Sir_Fawnpug, definately :) | 04:51 |
| === frank23 [n=frank@modemcable135.248-130-66.mc.videotron.ca] has joined #ubuntu | ||
| niki | @chuck | 04:51 |
| Milk_ | wastrel, and display name matches wats in the xorg.conf? | 04:52 |
| Sir_Fawnpug | And seek the pre-gnu publications too, it helps you understand UNIX so much better than alot of today's tutorials. | 04:52 |
| === GigaByte_ [n=kranian@222.114.149.180] has joined #ubuntu | ||
| === pepsi [n=pepsi@pdpc/supporter/active/electronJunkie] has joined #ubuntu | ||
| Sir_Fawnpug | Anybody familiar with acer_acpi? I'm having trouble getting the module to load | 04:53 |
| Sir_Fawnpug | Built with 2.6.12 kernel headers | 04:53 |
| rishi | Sir_Fawnpug: nope, what does it do? | 04:53 |
| Sir_Fawnpug | And sources | 04:53 |
| === kartik [n=kartik@202.63.116.26] has joined #ubuntu | ||
| Sir_Fawnpug | rishi, it enables the buttons on my laptop, one of them which enables my wireless. | 04:53 |
| rishi | oh sweet | 04:54 |
| Sir_Fawnpug | I'm not really concerned about the other buttons, haha. | 04:54 |
| kartik | how do i play mpeg video files?????please help??? | 04:54 |
| rishi | haha | 04:54 |
| Sir_Fawnpug | kartik, mplayer can play MPEGs | 04:54 |
| wastrel | Milk_: display is usually the x server hostname and the display number servername:0 for example. | 04:54 |
| arrick | Hey guys does skype cost anything to run? | 04:54 |
| bimberi | !tell kartik about restricted | 04:54 |
| bimberi | arrick: nope | 04:54 |
| HedgeMage | arrick: only if you want skype-out | 04:54 |
| HedgeMage | arrick: (ie to call regular telephones) | 04:55 |
| arrick | oh ok | 04:55 |
| wastrel | Milk_: if it's localhost you can just do :0 | 04:55 |
| === sabaki [n=crb@205.240.139.203] has joined #ubuntu | ||
| arrick | so I can call otehr pcs though? | 04:55 |
| arrick | like with yahoo messenger? | 04:55 |
| arrick | anyone know what skype-out costs per month? | 04:56 |
| Eleaf | uhh | 04:56 |
| Eleaf | arrick, look on their webpage | 04:56 |
| === Bashed [n=matt@216-12-54-121.access.ntelos.net] has joined #ubuntu | ||
| frank23 | arrick: its per minute I think | 04:56 |
| arrick | ok | 04:56 |
| kartik | sir_fawnpug:can mplayer play video files??????? | 04:57 |
| === venox [n=luiz@200-181-181-154.ctame7016.dsl.brasiltelecom.net.br] has joined #ubuntu | ||
| venox | hey... anyone here ever tried to watch nasatv on ubuntu? | 04:57 |
| venox | the url for watching it is: http://www.nasa.gov/55644main_NASATV_Windows.asx | 04:57 |
| venox | I tried using mplayer, but I can't get it working | 04:57 |
| rishi | kartik: you probably don't have the right codecs | 04:57 |
| venox | any ideas? | 04:57 |
| === franklin [n=franklin@201.242.89.231] has joined #ubuntu | ||
| rishi | venox, maybe thats your problem too? | 04:58 |
| TheFaction20 | is it possible to install things if using the ubuntu live cd? | 04:58 |
| venox | hmm, I don't think so | 04:58 |
| === nethgn [n=ke@pool-71-254-162-182.lsanca.fios.verizon.net] has joined #Ubuntu | ||
| franklin | hola | 04:58 |
| pulgoki | is there a better gui firewall other than firestarter? | 04:58 |
| pulgoki | it gives me problems with my home network | 04:58 |
| pulgoki | :( | 04:58 |
| kartik | rishi:what are the codecs | 04:58 |
| nethgn | How do I use scp in a ssh session to copy files from one computer to the other? I only seem to be able to copy files on the server to other locations on the server | 04:58 |
| dj-fu | use scp instead of ssh | 04:59 |
| dj-fu | usage: scp [-1246BCpqrv] .... | 04:59 |
| === matrix [n=ajay@59.92.143.91] has joined #ubuntu | ||
| Sir_Fawnpug | rishi, the funny thing is that ubuntu seems to think my wireless button's light is a HDD led | 04:59 |
| Sir_Fawnpug | When ubuntu swaps or I use the harddrive otherwise, it starts lighting up and I think, woah, my wireless is working. | 04:59 |
| Sir_Fawnpug | So anybody here a fluxbox user? | 05:00 |
| Sir_Fawnpug | (No problems with it or anything, just curious, I like the fluxbox) | 05:00 |
| === dt-oz-gc [n=dt@sou-ts1-2600-164.tpgi.com.au] has left #ubuntu ["Ciou] | ||
| Sir_Fawnpug | Whoops, there went my hardwired connection. | 05:00 |
| GhostXz | HI, I WANT TO RUN A SERVER WITH UBUNUT, CAN YOU PLS TECH ME HOW | 05:00 |
| === Joetheodd [n=joe@AC9562DC.ipt.aol.com] has joined #ubuntu | ||
| === [gijoe] [n=[gijoe] @h214n2fls304o1039.telia.com] has joined #ubuntu | ||
| venox | hmm, maybe I need w32codecs | 05:00 |
| venox | huhh | 05:00 |
| venox | :) | 05:00 |
| matrix | Hi , my windows crashed , so i reinstalled it , now how to reintall the grub ? | 05:00 |
| === [SEAWOLF] [n=seawolf@host166-57.pool8261.interbusiness.it] has joined #ubuntu | ||
| LadyNikon | matrix: you need to grab a rescue cd | 05:01 |
| _jason | ubotu: tell matrix about grub | 05:01 |
| GhostXz | CAN YOU HELP ME PLS | 05:01 |
| LadyNikon | that works too | 05:01 |
| _jason | GhostXz: please don't shout | 05:01 |
| nickrud | matrix, https://wiki.ubuntu.com/RecoveringUbuntuAfterInstallingWindows | 05:01 |
| LadyNikon | GhostXz: stop yelling and ask your question | 05:01 |
| kRaKoN | somebody who recomends me a good radio station for the Rhythmbox? | 05:01 |
| === mark_ [n=mark@residence-204-240.henday.ualberta.ca] has joined #ubuntu | ||
| mark_ | hello | 05:02 |
| GhostXz | WHAT DO YOU MEAN SHOUT? IM NOT USEING ANY ! | 05:02 |
| LadyNikon | ... | 05:02 |
| niki | GhostXz, your caps lock...disengage it | 05:02 |
| _jason | !caps | 05:02 |
| ubotu | FYI, typing in ALL CAPS is considered to be 'yelling', and therefore rude behaviour. | 05:02 |
| matrix | thanks | 05:02 |
| venox | GhostXz: caps lock? | 05:02 |
| LadyNikon | man i could not be an op in this channel | 05:02 |
| venox | ^o) | 05:02 |
| GhostXz | oh ok | 05:02 |
| kRaKoN | uppercases GhostXz | 05:02 |
| Sir_Fawnpug | It's not yelling, it's high-current typing. | 05:02 |
| LadyNikon | he would be banned for being stupid | 05:02 |
| Sir_Fawnpug | Haha | 05:02 |
| GhostXz | can you tech me how 2 do the servrs | 05:02 |
| === Joetheodd [n=joe@AC9562DC.ipt.aol.com] has joined #ubuntu | ||
| kRaKoN | somebody who recomends me a good radio station for the Rhythmbox? | 05:02 |
| === tonyyarussosleep is now known as tonyyarusso | ||
| LadyNikon | kRaKoN: bash.org | 05:03 |
| === helder [n=helder@87-196-67-166.net.novis.pt] has joined #ubuntu | ||
| Sir_Fawnpug | GhostXz, what kind of server do you want to run? | 05:03 |
| kRaKoN | thanls LadyNikon | 05:03 |
| LadyNikon | kRaKoN: you can find it at shoutcast.com | 05:03 |
| === flashnet [i=flashnet@62.79.123.79.adsl.hvi.tiscali.dk] has joined #ubuntu | ||
| GhostXz | i gots a 366mhz laptop computer with 128mb of ram inside, i want 2 be a web hosting compatys so i can makes me money | 05:03 |
| LadyNikon | can we ban him now? | 05:03 |
| wastrel | ohh baby | 05:03 |
| Sir_Fawnpug | Better hope slashdot doesn't find out. | 05:04 |
| Sir_Fawnpug | Haha. | 05:04 |
| GhostXz | i have a dlink roter ready for it to work | 05:04 |
| Sir_Fawnpug | GhostXz, look into apache | 05:04 |
| Sir_Fawnpug | And you'll probably want to install mysql to go along with it. | 05:04 |
| venox | hey.. anyone try this: http://www.nasa.gov/55644main_NASATV_Windows.asx | 05:04 |
| helder | i can anybody tell me how to install an RPM in ubuntu? | 05:04 |
| === bisquit [n=bisquit@1Cust7907.an3.dca16.da.uu.net] has joined #ubuntu | ||
| venox | I want to know if someone got that streaming working in ubuntu.. | 05:04 |
| biovore | helder: alien | 05:04 |
| wastrel | helder: use alien to convert it to a .deb | 05:04 |
| LadyNikon | gawd why. | 05:04 |
| GhostXz | i have dzl or somethings... i want to host lots of ppls so i can makes lots of money so i buy new things | 05:05 |
| bisquit | Hi, I am trying to install my ATI drivers on Ubuntu,and how can I test if it is working right or not? | 05:05 |
| === dAndy [i=[U2FsdGV@rita.cat.pdx.edu] has joined #ubuntu | ||
| wastrel | bisquit: glxinfo| grep direct | 05:05 |
| Sir_Fawnpug | LadyNikon, believe it or not some people actually like RPMs. | 05:05 |
| === Sir_Fawnpug shudders | ||
| Misnix | GhostXz, you'll have to do lots of studying then | 05:05 |
| LadyNikon | Sir_Fawnpug: heh.. | 05:05 |
| bisquit | wastrel:Ack, it says DRI is off | 05:05 |
| === lyp [n=lyp@218.14.198.199] has joined #ubuntu | ||
| LadyNikon | Sir_Fawnpug: pls see above comment.. gods why.; | 05:06 |
| wastrel | bisquit: are you using the wiki ati howto? | 05:06 |
| bisquit | wastrel: yeah | 05:06 |
| nickrud | helder, just what's in the rpm, maybe you don't need it | 05:06 |
| GhostXz | no see i need money now, so i can buy someting.. can you pls help me set it u p , maybe you can be a customer | 05:06 |
| bisquit | cd / | 05:06 |
| LadyNikon | hahaha | 05:06 |
| Sir_Fawnpug | So how much flamebait do ya'll get in here? | 05:06 |
| Misnix | GhostXz, money doesn't grow on trees, trolls do | 05:07 |
| nickrud | not a whole lot | 05:07 |
| === pablo928 [n=paul@yuma-cuda1-g2-70-36-69-223.losaca.adelphia.net] has joined #ubuntu | ||
| GhostXz | i did bandwidth tests and it says i do 11kbps upload, i hear this is very very good for hosting many peoples, i hear its better then dial dial up | 05:07 |
| === caliuhui [n=caliuhui@201-220-106-182.bk9-dsl.surnet.cl] has joined #ubuntu | ||
| nickrud | nowotny, trolls are another question :) | 05:07 |
| === ccc__ [n=ccc@c-940f70d5.015-28-6c6b7010.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| === isilzha [n=isilzha@155.69.163.196] has joined #ubuntu | ||
| caliuhui | alguien que hable espaol | 05:07 |
| niki | /ignore | 05:07 |
| wastrel | !es | 05:07 |
| nickrud | !es | 05:07 |
| ubotu | Hispanohablantes: Por favor usen #ubuntu-es, #kubuntu-es o #edubuntu-es, alli obtendran mas ayuda. | 05:07 |
| === Falstius [n=jeff@c-68-40-57-200.hsd1.mi.comcast.net] has joined #ubuntu | ||
| rishi | Can anyone tell me how to get gdesklets to work? | 05:08 |
| Sir_Fawnpug | Is anybody familiar with acer_acpi? | 05:08 |
| helder | nickrud: i was trying to compile the newest version of xmame but no luck, so i want to try the binary (RPM)... | 05:08 |
| niki | rishi, have you already installed it? | 05:08 |
| rishi | everytime i click it, it says starting...and then never works | 05:08 |
| === BarneyWithoutApE is now known as gatoradges | ||
| GhostXz | so will anyones help me and plz can be my customers | 05:08 |
| rishi | niki: yeah, it won't start though | 05:08 |
| === caliuhui [n=caliuhui@201-220-106-182.bk9-dsl.surnet.cl] has left #ubuntu ["Abandonando"] | ||
| Joetheodd | Woo, hoary is shiney compared to warty. ^_^ | 05:08 |
| niki | rishi, oh...i know how it's _supposed_ to work :P | 05:08 |
| nickrud | helder, install alien that will convert an rpm to a deb | 05:08 |
| === kyral_ [n=Chris@ubuntu/member/kyral] has joined #ubuntu | ||
| Sir_Fawnpug | helder, xmame might be in the apt tree actually. | 05:08 |
| rishi | niki: hahaha...thanks anyway | 05:09 |
| nickrud | helder, but, no certainty that it will work | 05:09 |
| Sir_Fawnpug | I almost called that portage, haha. | 05:09 |
| isilzha | hi. whenever the system needs root priviledges it fails at the pw prompt, not accepting my password. this pw is correct as i successfully verified in console | 05:09 |
| rishi | has anyone had a problem with Gdesklets where it wouldn't start? | 05:09 |
| GhostXz | helps me pls | 05:09 |
| Sir_Fawnpug | rishi, what window manager are you trying to run them on? | 05:09 |
| gabbah | how do i restart the samba service? | 05:09 |
| wastrel | Joetheodd: hate to break it to you but breezy is the current version :] | 05:09 |
| rishi | Sir_Fawnpug: GNome 2.14 | 05:09 |
| helder | how does alien work anyaway | 05:09 |
| nickrud | 0.86 helder that's too old? | 05:09 |
| Sir_Fawnpug | /etc/init.d/smbd restart | 05:09 |
| niki | what's the command to show my processor speed? | 05:09 |
| _jason | isilzha: what does 'sudo echo hi' do? | 05:09 |
| GhostXz | PLS can help me plz | 05:10 |
| _jason | niki: cat /proc/cpuinfo | 05:10 |
| gabbah | thanks Sir_Fawnpug | 05:10 |
| rishi | Sir_Fawnpug: was that for me? | 05:10 |
| rishi | oh | 05:10 |
| Sir_Fawnpug | rishi, nope | 05:10 |
| rishi | yeah, saw that :) | 05:10 |
| Sir_Fawnpug | Err, maybe that's not it, I guess the script is named something different. | 05:10 |
| niki | ty _jason | 05:10 |
| LadyNikon | GhostXz: apt-get install prozac | 05:10 |
| gabbah | hmm Sir_Fawnpug.. bash: /etc/init.d/smbd: No such file or directory | 05:10 |
| === amgad_ [n=amgad@82.201.236.47] has joined #ubuntu | ||
| === _kalm [n=Jallu_@220-245-217-10-act-pppoe.tpgi.com.au] has joined #ubuntu | ||
| GhostXz | whats this prozec things? | 05:10 |
| helder | i cant get my roms to work with 0.86... | 05:11 |
| Sir_Fawnpug | gabbah, that is a good question. | 05:11 |
| GhostXz | it good for hosting? | 05:11 |
| isilzha | _jason: it won't accept my pw either | 05:11 |
| niki | GhostXz, are you here just to annoy people? | 05:11 |
| === Nickgarvey [n=nick@cpe-24-195-249-41.nycap.res.rr.com] has joined #ubuntu | ||
| _jason | isilzha: is this the first user you created during install? and is this an expert install? | 05:11 |
| LadyNikon | heh | 05:11 |
| Nickgarvey | if windows edits my Ext2 partition, will it fragment it? | 05:11 |
| isilzha | _jason: expert | 05:11 |
| LadyNikon | niki: heh | 05:11 |
| Sir_Fawnpug | niki, I am more than certain he's just being flamebait. | 05:11 |
| _jason | ubotu: tell isilzha about expert | 05:11 |
| === liddan [n=liddan@ua-83-227-135-153.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| GhostXz | you people are no good | 05:12 |
| GhostXz | you no help | 05:12 |
| Nickgarvey | !patience | 05:12 |
| ubotu | The people in this channel are volunteers. Please be aware there are a lot of questions, but only maybe few who might know the answer for you. Please be patient. Your attitude may determine their willingness to help you. | 05:12 |
| nickrud | helder, you would say alien --to-deb rpmfile | 05:12 |
| niki | Sir_Fawnpug, ah, ok...i'll just put him on ignore then | 05:12 |
| === wasabi_ [n=wasabi@c-71-199-216-244.hsd1.co.comcast.net] has joined #ubuntu | ||
| wasabi_ | Where do the real-time utilities live? | 05:12 |
| isilzha | _jason: ohhhh. ok thanks | 05:12 |
| wasabi_ | I want to give a process real time priority. | 05:12 |
| === str8edge [i=hidden-u@static65-87-247-48.regina.accesscomm.ca] has joined #ubuntu | ||
| Sir_Fawnpug | wasabi, try nicing it less than 0 | 05:13 |
| gabbah | if i create a guest share in samba, do i still need to create a "guest user" account that that share will use? | 05:13 |
| helder | thanks i'll try | 05:13 |
| nickrud | linux is not a true real time os | 05:13 |
| Sir_Fawnpug | I don't think you can quite call that real time but it's very high prioirty. | 05:13 |
| wasabi_ | Sir_Fawnpug: Yeah, I know about that. Looking for real time stuff though. | 05:13 |
| LadyNikon | Nickgarvey: he is a troll.. | 05:13 |
| rishi | Can anyone please help me with gDesklets? | 05:14 |
| biovore | want realtime get a rtos | 05:14 |
| nickrud | so ignore them, they get tired, or do something stupid. | 05:14 |
| Sir_Fawnpug | I think the closest you can give that with the scheduler is -20 | 05:14 |
| GhostXz | you no help you no good | 05:14 |
| GhostXz | i no like you peoples | 05:14 |
| Nickgarvey | /ignore GhostXz | 05:14 |
| wasabi_ | There's a tool called schedtool, which can actually give it rt priority. | 05:14 |
| GhostXz | no pls help first | 05:14 |
| wasabi_ | Not finding it packaged though | 05:14 |
| GhostXz | you people remind me of gay | 05:14 |
| Sir_Fawnpug | Is it packaged with binutils? | 05:15 |
| === liddan [n=liddan@ua-83-227-135-153.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| _jason | ubotu: tell GhostXz about gay | 05:15 |
| Nickgarvey | haha pure pwnage | 05:15 |
| Nickgarvey | and why didn't ignore work | 05:15 |
| === intelikey [n=root@0-1pool90-46.nas23.houston4.tx.us.da.qwest.net] has joined #ubuntu | ||
| === liddan [n=liddan@ua-83-227-135-153.cust.bredbandsbolaget.se] has left #ubuntu ["Leaving"] | ||
| rishi | yeah i dunno | 05:15 |
| Nickgarvey | /ignore GhostXz all quiet | 05:15 |
| LadyNikon | ubotu !troll | 05:15 |
| ubotu | I don't know, try searching at http://ubuntu.cc.com.au/, LadyNikon | 05:15 |
| Nickgarvey | right? | 05:15 |
| Nickgarvey | !troll | 05:15 |
| ubotu | Wish I knew. Try searching at http://ubuntu.cc.com.au/, Nickgarvey | 05:15 |
| === liddan [n=liddan@ua-83-227-135-153.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| GhostXz | gay,, you all gay | 05:15 |
| rishi | Nickgarvey it didn't work for me either | 05:15 |
| Sir_Fawnpug | Brb, going to smoke. | 05:16 |
| LadyNikon | thank the gods | 05:16 |
| === LeeJunFan [n=junfan@adsl-69-210-207-5.dsl.klmzmi.ameritech.net] has joined #ubuntu | ||
| nickrud | like I said, they get tired. | 05:16 |
| LadyNikon | that guy was entertaining while i was having my dinner | 05:16 |
| wasabi_ | Sir_Fawnpug: package schedutils. | 05:16 |
| wasabi_ | took me awhile to find it | 05:16 |
| === [SEAWOLF] [n=seawolf@host166-57.pool8261.interbusiness.it] has joined #ubuntu | ||
| xerophyte | does anybody know where can i find the wibmin 1.26 deb files | 05:17 |
| === Agamotto [n=agamotto@adsl-68-78-164-178.dsl.rcfril.ameritech.net] has joined #ubuntu | ||
| === Agamotto bows | ||
| === diego [n=diego@200.77.215.66] has left #ubuntu ["Abandonando"] | ||
| Sir_Fawnpug | wasabi_, ahh, good deal | 05:19 |
| intelikey | xerophyte is it not in the dapper repo ? | 05:20 |
| Sir_Fawnpug | Anybody familiar with acer_acpi? I'm having a problem getting the module to work | 05:20 |
| === winXperts [n=winXpert@ip70-171-10-206.ga.at.cox.net] has joined #ubuntu | ||
| nazty | can anyone help me out with update-alternatives --install? | 05:20 |
| LadyNikon | who was it that was in here.. talking about watching proggys compile? | 05:21 |
| === param [n=param@219.64.67.71] has joined #ubuntu | ||
| Agamotto | Sounds too much like watching golf on the telly | 05:21 |
| Sir_Fawnpug | LadyNikon, I used to do that all the time, gentoo tends to put alot of noise on your monitor. | 05:22 |
| === scotty_b [n=chatzill@70-41-128-25.cust.wildblue.net] has joined #ubuntu | ||
| LadyNikon | Sir_Fawnpug: i used to goto sleep like that | 05:22 |
| LadyNikon | my husband thought i was a freak. | 05:22 |
| Sir_Fawnpug | LadyNikon, haha, I would just screen portage and go to school usually. | 05:22 |
| Sir_Fawnpug | Come home and find something went wrong. | 05:22 |
| === liddan [n=liddan@ua-83-227-135-153.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| LadyNikon | Sir_Fawnpug: it was amuzing to watch the crap they toss in there | 05:23 |
| LadyNikon | and all the ;) | 05:23 |
| LadyNikon | its like watching one of those crazy screen savers | 05:23 |
| Sir_Fawnpug | LadyNikon, cat the HME driver some time, there's some hilarious stuff in there. | 05:23 |
| === IdleOne [n=idleone@toronto-HSE-ppp4085528.sympatico.ca] has joined #ubuntu | ||
| LadyNikon | Sir_Fawnpug: i got away from gentoo when i couldnt spent tons of time working on it | 05:24 |
| LadyNikon | heh | 05:24 |
| === dt0x [i=dtox@69.156.172.253] has joined #Ubuntu | ||
| === hartym_ [n=romain_d@AAnnecy-103-1-11-135.w193-251.abo.wanadoo.fr] has joined #ubuntu | ||
| LadyNikon | job+work+school+workingout+wow = no time | 05:24 |
| === j_ack [n=nico@p508D9211.dip0.t-ipconnect.de] has joined #ubuntu | ||
| === tesseract [n=ajw33@volatile.ENGINEERING.CWRU.Edu] has joined #ubuntu | ||
| dt0x | DCC SEND AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA | 05:24 |
| Sir_Fawnpug | LadyNikon, actually it was my first choice for the laptop I'm on, but I don't have distCC installed on any of my workstations. | 05:24 |
| _jason | !ops | 05:25 |
| ubotu | Help! lilo, fabbione, lamont, Keybuk, jdub, mdz, Amaranth, tritium, ajmitch, crimsun, ogra, CarlK, Seveas, Burgundavia, apokryphos, thoreauputic, nalioth, Madpilot, ompaul, rob or Hobbsee | 05:25 |
| Sir_Fawnpug | It would've been a nightmare to even do a stage 3 | 05:25 |
| bimberi | hmm, where is ubugtu? | 05:25 |
| === GeorgeAScott [n=scott@71-212.69-92-cpe.cableone.net] has joined #ubuntu | ||
| === mode/#ubuntu [+o Hobbsee] by ChanServ | ||
| _jason | bimberi: I think he messed up on his exploit | 05:25 |
| === dt0x [i=dtox@67.71.71.9] has joined #Ubuntu | ||
| === existance [n=existanc@cpe-68-201-251-162.houston.res.rr.com] has joined #ubuntu | ||
| === winXperts [n=winXpert@ip70-171-10-206.ga.at.cox.net] has joined #ubuntu | ||
| === Trae [n=october@ip24-252-207-46.mc.at.cox.net] has joined #ubuntu | ||
| === t1n_l0tus [n=lotus@cpe-72-226-4-218.nycap.res.rr.com] has joined #ubuntu | ||
| === redir [n=Reed@208-58-195-117.c3-0.grg-ubr2.lnh-grg.md.cable.rcn.com] has joined #ubuntu | ||
| bimberi | Hobbsee: too slow :P | 05:25 |
| LadyNikon | is ubot going nuts? | 05:25 |
| === VRWarper [n=VRWarper@cpe-24-90-212-152.nyc.res.rr.com] has joined #ubuntu | ||
| === Sionide [n=sphinx@collaredlory2.hornet.uea.ac.uk] has joined #ubuntu | ||
| GeorgeAScott | hello | 05:25 |
| Sir_Fawnpug | LadyNikon, we have a 160 node cluster at the school I want to try using with it, though. | 05:25 |
| === mode/#ubuntu [+o fabbione] by ChanServ | ||
| === amgad_ [n=amgad@82.201.236.47] has left #ubuntu ["Leaving"] | ||
| === mode/#ubuntu [+o nalioth] by ChanServ | ||
| === mode/#ubuntu [+b *!*@67.71.71.9] by nalioth | ||
| === dt0x [i=dtox@67.71.71.9] has left #ubuntu [requested] | ||
| === mode/#ubuntu [-o nalioth] by nalioth | ||
| Sir_Fawnpug | err, whoops, 80 nodes, 160 procs. | 05:26 |
| Hobbsee | hehe | 05:26 |
| === mode/#ubuntu [+b dtox*!*@*] by fabbione | ||
| GeorgeAScott | does anybody know the name of the screen that comes up after the login? | 05:26 |
| === mode/#ubuntu [+b dt0x*!*@*] by fabbione | ||
| tesseract | I have a DAC960 scsi card, and I did a default ubuntu install. On boot I get "ALERT! /dev/rd/c0d0p1 does not exist." how to fix? | 05:26 |
| Hobbsee | bimberi: indeed. i dont have an awesome script. | 05:26 |
| === mode/#ubuntu [-b dtox*!*@*] by fabbione | ||
| Sir_Fawnpug | I don't think my boss would be too happy with that though, considering it's supposed to be for number crunching. | 05:26 |
| LadyNikon | Sir_Fawnpug: </drool> | 05:26 |
| nalioth | fabbione: i just got him | 05:26 |
| wastrel | GeorgeAScott: gnome splash screen? | 05:26 |
| fabbione | * nalioth sets ban on *!*@67.71.71.9 | 05:26 |
| bimberi | Hobbsee: :) | 05:26 |
| === Astinus got it. | ||
| fabbione | nalioth: he did change ip 2 times :) | 05:26 |
| nalioth | fabbione: ah, how lovely | 05:27 |
| Sir_Fawnpug | LadyNikon, you should see the air conditioner we got for it, it was like $25k and is likely to triple the power bill for CS | 05:27 |
| LadyNikon | ohh | 05:27 |
| LadyNikon | that was stupid | 05:27 |
| intelikey | hmmm is there not a package "alternatives" in ubuntu ? | 05:27 |
| Hobbsee | nalioth: why not kline instead? | 05:27 |
| GeorgeAScott | the splash screen comes up on it yeah... but i've changed my splash screen and can't find out how to change the background | 05:27 |
| fabbione | nalioth: that's why i didn't bad at speed light :) | 05:27 |
| === mode/#ubuntu [-o fabbione] by fabbione | ||
| GeorgeAScott | and the two just clash | 05:27 |
| === mode/#ubuntu [-o Hobbsee] by ChanServ | ||
| nalioth | Hobbsee: if he's changing IPs a kline won't stop him, either | 05:27 |
| intelikey | how do you remove alternatives ? | 05:27 |
| Hobbsee | nalioth: ah darn! | 05:27 |
| Joetheodd | Hobbsee: Chanserv hates you! gg =p | 05:27 |
| nalioth | where is ubugtu? | 05:27 |
| Hobbsee | Joetheodd: i removed it :P | 05:27 |
| Hobbsee | nalioth: it's there... | 05:28 |
| Joetheodd | Hobbsee: Me want op please. =p | 05:28 |
| LadyNikon | wow.. all those people have the vuln | 05:28 |
| Sir_Fawnpug | I get to cut my teeth on that thing once we get the rack moved, they weren't able to put it in the room where we originally had it. | 05:28 |
| _jason | nalioth: he didn't end it in 0 0, that's my theory as to why Ubugtu didn't act | 05:28 |
| Hobbsee | Joetheodd: dream on :P | 05:28 |
| === MistaED [n=alex@203-214-140-27.perm.iinet.net.au] has joined #ubuntu | ||
| LadyNikon | heh i remember dumpstering a rack | 05:28 |
| nalioth | Ubugtu: is not opped, Hobbsee | 05:28 |
| === Glacious [n=sdsd@res18003.rh.rit.edu] has joined #ubuntu | ||
| LadyNikon | my now ex was like.. | 05:28 |
| LadyNikon | what are you doing.. | 05:28 |
| Hobbsee | nalioth: that script did work, on ubugtu | 05:28 |
| nalioth | Hobbsee: w/o being opped, Ubugtu is useless | 05:28 |
| LadyNikon | as i am trying to pull it out of the garbage | 05:28 |
| _jason | nalioth: that appears to be a better theory | 05:28 |
| Hobbsee | nalioth: op it then? | 05:28 |
| LadyNikon | my answer " welll if you would help me get this in the elevator.. i would be putting this in my apt" | 05:29 |
| === mode/#ubuntu [+o Ubugtu] by ChanServ | ||
| Sir_Fawnpug | LadyNikon, I would become your ex too. | 05:29 |
| Sir_Fawnpug | Haha | 05:29 |
| Hobbsee | there you go... | 05:29 |
| LadyNikon | yeh well he had issues that i was a geek | 05:29 |
| LadyNikon | how is that for a twist! | 05:29 |
| === jadaz87 [n=jadaz87@pool-70-111-105-18.nwrk.east.verizon.net] has joined #ubuntu | ||
| Hobbsee | obviously a whole lot of people are still stung by the exploit... | 05:29 |
| LadyNikon | Sir_Fawnpug: 19 inch rack.. that had all the power plugs working | 05:30 |
| pulgoki | is there anyone that may be able to help with a firewall issue? | 05:30 |
| === IdleOne [n=idleone@toronto-HSE-ppp4085528.sympatico.ca] has joined #ubuntu | ||
| === Jeshua [n=Jeshua@dpc6747171093.direcpc.com] has joined #ubuntu | ||
| LadyNikon | Hobbsee: yar. | 05:30 |
| Sir_Fawnpug | LadyNikon, haha, I thought he was dumping you because of the rack. | 05:30 |
| Glacious | hello, i have a SATA controller card with XP + UBUNTU (Grub) installed. Dual boot worked fine until I re-installed XP, then re-installed grub to get boot menu back. now it says "Can't find NTLDR" when I goto XP | 05:30 |
| arrick | How do you add info to ubotu> | 05:30 |
| arrick | ? | 05:30 |
| LadyNikon | Sir_Fawnpug: nah he liked my rack.. it was my brain he didnt like ;) | 05:30 |
| Glacious | I know I had it all working before, but i can't remember how :( | 05:30 |
| _jason | ubotu: tell arrick about yourself | 05:30 |
| === phrizer [n=lance@60-234-134-230.bitstream.orcon.net.nz] has joined #Ubuntu | ||
| Sir_Fawnpug | LadyNikon, let me ask you this; did you dump it so you could conviently go dumpster diving after work? | 05:30 |
| Jeshua | Hmm, seems like everyone is already busy. | 05:30 |
| Falstius | does ubuntu support wpa/wpa2? | 05:30 |
| _jason | arrick: add only useful stuff, adding silly things usually gets a ban for people | 05:30 |
| === B_166-ER-X [n=oli@c207.134.16-188.clta.globetrotter.net] has joined #ubuntu | ||
| pussfeller | if i set a password for root, regular users should not be able to ls /root? | 05:30 |
| === GeorgeAScott [n=scott@71-212.69-92-cpe.cableone.net] has left #ubuntu [] | ||
| arrick | I found the answer to many questions about missing partitions a minute ago, that could help | 05:31 |
| LadyNikon | oh no.. i dumpstered it in my apt building | 05:31 |
| arrick | _jason, good evening | 05:31 |
| _jason | pussfeller: depends on permissions of /root | 05:31 |
| nalioth | pussfeller: you don't need to set a password for root | 05:31 |
| === GeorgeAScott [n=scott@71-212.69-92-cpe.cableone.net] has joined #ubuntu | ||
| nalioth | pussfeller: a root password has nothing to do with /root | 05:31 |
| LadyNikon | i dont do the whole.. " oh .. its trash.." and then dumpster it later.. I like working | 05:31 |
| Sir_Fawnpug | LadyNikon, haha, maybe it was the brain, although if you dumped a perfectly good rack, it may not be for the reason you think, haha. | 05:31 |
| pussfeller | i know, but root should not be readable my reg users | 05:31 |
| pussfeller | by | 05:31 |
| === isilzha [n=isilzha@155.69.163.196] has joined #ubuntu | ||
| pussfeller | i dont remember changing the perms | 05:31 |
| nalioth | pussfeller: so use sudo to set the permissions | 05:31 |
| LadyNikon | dumpstered = taking it out of the trash | 05:31 |
| isilzha | _jason: doesn't seem to work | 05:32 |
| Sir_Fawnpug | Oh, I thought you meant the other way around. | 05:32 |
| nalioth | pussfeller: but be careful you know what permissions to set | 05:32 |
| LadyNikon | heh nope | 05:32 |
| intelikey | pussfeller users should not be able to ls /root whether or not you set a root passwd. | 05:32 |
| pussfeller | nalioth: i dont use sudo | 05:32 |
| Hobbsee | Sionide Trae, VRWarper , t1n_l0tus redir existance winXperts: You should all connect on port #8001, not #6667, so that you will not be affected if some idiot does run the exploit. | 05:32 |
| Jeshua | If someone gets a free minute, I need instructions.. I don't know if it would mainly be ubuntu related or not. | 05:32 |
| nalioth | pussfeller: ah. | 05:32 |
| Sir_Fawnpug | Then allow me to retract my statement because of your rack. | 05:32 |
| _jason | isilzha: you may need to logout and back in | 05:32 |
| pussfeller | hmm | 05:32 |
| isilzha | _jason: i did that | 05:32 |
| Trae | heh | 05:32 |
| Sionide | whut | 05:32 |
| _jason | isilzha: paste the output of 'groups' command | 05:32 |
| Sionide | what exploit? :S | 05:32 |
| === Sir_Fawnpug cowers in fear over the previous statement. | ||
| Hobbsee | Sionide: the one that booted your client before... | 05:32 |
| nickrud | Jeshua, ask away | 05:32 |
| Glacious | nobody knows why a SATA card /w XP and Ubuntu would give me "can't find NTLDR" when i try to goto XP? it worked until I reinstalled XP + Grub. | 05:32 |
| intelikey | pussfeller i recomend chmod 000000 /root -R | 05:33 |
| arrick | ubotu https://wiki.ubuntu.com/GnomeComputerMenu is where you can find information on how to get missing partitions found. | 05:33 |
| ubotu | arrick: that's too long | 05:33 |
| Glacious | my ATA on board controller just has a drive for storage, no OS's | 05:33 |
| Jeshua | Well, I want to replace Metacity window manager, ubuntu related, with fluxbox, not ubuntu related. | 05:33 |
| isilzha | _jason: isilzha adm dialout cdrom floppy audio dip video plugdev lpadmin scanner admin | 05:33 |
| arrick | ubotu https://wiki.ubuntu.com/GnomeComputerMenu is on how to get missing partitions found. | 05:33 |
| ubotu | that's too long, arrick | 05:33 |
| nickrud | Jeshua, you mean run fluxbox instead of metacity with gnome? | 05:33 |
| _jason | isilzha: su to root and pastebin /etc/sudoers please | 05:33 |
| nalioth | arrick: leave the bot alone, please | 05:33 |
| Jeshua | Nickrud: Correct. | 05:33 |
| arrick | _jason, how long can they be | 05:34 |
| nalioth | jason_: su? | 05:34 |
| === str8edge [i=hidden-u@static65-87-247-48.regina.accesscomm.ca] has left #ubuntu ["Ex-Chat"] | ||
| _jason | nalioth: expert install with non-working sudo | 05:34 |
| nickrud | Jeshua, that used to be easy ;( | 05:34 |
| Sir_Fawnpug | LadyNikon, I don't think I've been dumpster diving in a while, but there's something wrong when I'm excited because I can get a sun5 for $75 | 05:34 |
| Jeshua | I already have Fluxbox installed, I just need to switch them out. | 05:34 |
| === Toma- [n=lin4me@203-59-207-250.dyn.iinet.net.au] has joined #ubuntu | ||
| LadyNikon | Sir_Fawnpug: heh | 05:34 |
| LadyNikon | well.. | 05:34 |
| LadyNikon | my first date with my now hubby was dumpster diving | 05:34 |
| LadyNikon | and then vadding | 05:34 |
| Sir_Fawnpug | And I thought that was a better buy than my athlon64 | 05:34 |
| Sir_Fawnpug | Haha, a match made in heaven | 05:34 |
| Jeshua | Nickrud: So you got any idea on how I might do it? Got a FAQ lying around or some ideas? | 05:35 |
| intelikey | !offtopic | 05:35 |
| ubotu | Non Ubuntu support related discussions may be carried out in the channel #ubuntu-offtopic. Editor/Language wars are welcome there! | 05:35 |
| Sir_Fawnpug | "So you want to go dig through CS's trash?" "... I love you." | 05:35 |
| LadyNikon | heh | 05:35 |
| === mattcraigschultz [n=matt@adsl-70-240-228-227.dsl.hstntx.swbell.net] has joined #ubuntu | ||
| === IdleOne [n=idleone@toronto-HSE-ppp4085528.sympatico.ca] has joined #ubuntu | ||
| LadyNikon | hey man.. we got some good phone numbers and ip address.. | 05:35 |
| LadyNikon | and stuff | 05:35 |
| LadyNikon | NoVa is beautiful at night. | 05:35 |
| nickrud | Jeshua, I'm trying to remember. I probably won't :) | 05:35 |
| LadyNikon | which later got tossed because we moved | 05:36 |
| LadyNikon | people do not shred | 05:36 |
| === LadyNikon shakes her head | ||
| Sir_Fawnpug | I think the last thing I got out of a dumpster diving raid was the Parish's Apple IIe inventory. | 05:36 |
| nickrud | !offtopic | 05:36 |
| ubotu | Non Ubuntu support related discussions may be carried out in the channel #ubuntu-offtopic. Editor/Language wars are welcome there! | 05:36 |
| nalioth | LadyNikon: may i ask you to move to #ubuntu-offtopic with those wonderful tales? | 05:36 |
| TSCHAK | ummmm, where are the ld library paths kept? | 05:36 |
| Jeshua | Nickrud, heh. XP Well, think as long as you like. I'm sure someone-of-us can figure it out. | 05:36 |
| Sir_Fawnpug | Very well. | 05:36 |
| TSCHAK | they're not in /etc/ld.so.conf | 05:36 |
| LadyNikon | nalioth: i will just shut up. | 05:36 |
| nickrud | as well as dumpster diving trophies :) | 05:36 |
| LadyNikon | and read the troller stuff instead | 05:36 |
| mattcraigschultz | ok, i installed kismet and got a new wireless card (orinoco gold pcmcia 802.11b unknown firmware version) and i can't get it into monitor mode, and i cant compile new orinoco drivers, any ideas? | 05:36 |
| === ch1r1 [n=v0id@21-171-28.adsl.terra.cl] has joined #ubuntu | ||
| Sir_Fawnpug | Anybody happen to be familiar with acer_acpi? | 05:37 |
| Glacious | so nobody has used an SATA card to install Ubuntu? | 05:37 |
| === lyp [n=lyp@218.14.198.199] has left #ubuntu [""] | ||
| === JustinLynn [n=JustinLy@wlbg-00-0014.dsl.iowatelecom.net] has joined #ubuntu | ||
| Jeshua | I tried adding Fluxbox into the startup program under order of 10, Metacity under 20, to see if it would run first and work, then disable metacity. | 05:37 |
| Sir_Fawnpug | I am trying to install the module on my Asus 3004WLCi, but for some reason the kernel doesn't think I have the hardware. | 05:37 |
| isilzha | _jason: http://paste.ubuntu-nl.org/11080 | 05:38 |
| Sir_Fawnpug | Err, Acer, not asus. | 05:38 |
| wastrel | hi | 05:38 |
| Glacious | SATA add-on card with XP + Ubuntu dual boot, worked until I reinstalled XP, now XP on Grub just gives me "Can't find NTLDR". On-board IDE just has a storage drive. | 05:38 |
| Glacious | any ideas? | 05:38 |
| LadyNikon | anyone having issues with breezy badger being laggy? | 05:38 |
| Glacious | I can't figure out for the life of me how I got it working last time with dual boot on the SATA card | 05:38 |
| rishi | LadyNikon: yeah | 05:39 |
| === Jeshua hits himself. "Oh yeah! Nickrud, how do you check what Ubuntu you have?" | ||
| === Vic_Astro [n=vic@85.186.238.232] has joined #ubuntu | ||
| intelikey | Jeshua uname -r | 05:39 |
| === ^majik^ [n=majik@68-187-20-53.static.jcsn.tn.charter.com] has joined #Ubuntu | ||
| gabbah | is someone here decent with samba config? | 05:40 |
| _jason | isilzha: 'visduo' as root and make your /etc/sudoers look like http://paste.ubuntu-nl.org/7021, the only diff I see is the Default line other than the comments | 05:40 |
| arrick | !samba | 05:40 |
| ubotu | it has been said that samba is https://wiki.ubuntu.com/SettingUpSamba or https://wiki.ubuntu.com/MountWindowsSharesPermanently | 05:40 |
| wastrel | LadyNikon: firefox on breezy is slow, upgrade to ff1.5 if you haven't yet | 05:40 |
| rishi | LadyNikon: any ideas on how to fix that? | 05:40 |
| Jeshua | intelikey, I guess thats the version. I was asking more for if I'm Breezy or what c.c I had a brain-fail after a while and forgot. | 05:40 |
| === papawiskas [n=papawisk@ip68-229-163-137.om.om.cox.net] has joined #ubuntu | ||
| LadyNikon | wastrel: is it part of the updater.. or is that something i have to do myself | 05:40 |
| Sir_Fawnpug | Anybody familiar with acer_acpi? I'm having trouble loading the module on my Acer Aspire 3004WLCi | 05:40 |
| LadyNikon | i was thinking of turning off framebuffer for one. | 05:41 |
| intelikey | Jeshua 5.10 is breezy | 05:41 |
| rishi | Jeshua: if you have 5.10 its breezy | 05:41 |
| wastrel | !ff1.5 | 05:41 |
| ubotu | You can use firefox 1.5 by following this wiki page https://wiki.ubuntu.com/FirefoxNewVersion | 05:41 |
| wastrel | LadyNikon: ^^ | 05:41 |
| rishi | Jeshua: if you have 6.06 it is dapper | 05:41 |
| intelikey | Jeshua 5.4 hoary | 05:41 |
| LadyNikon | wastrel: does that fix all of the laggy issues? | 05:41 |
| Jeshua | "2.6.12-9-386" O_o | 05:41 |
| DBO | thats your kernel | 05:41 |
| === TTilus_ is now known as TTilus | ||
| gabbah | arrick, that setting up samba doesn't load for me.. | 05:41 |
| Jeshua | Figures. | 05:41 |
| wastrel | LadyNikon: it makes firefox faster ... won't fix any other probs ;] | 05:41 |
| === thoffmeyer is now known as thoffmeyer|AFK | ||
| === rishi [n=rishi@c-67-173-80-222.hsd1.il.comcast.net] has left #ubuntu [] | ||
| intelikey | Jeshua errr -a | 05:42 |
| LadyNikon | doh | 05:42 |
| isilzha | _jason: yes it does actually. i omitted he comments and forgot about the defaults line with that | 05:42 |
| _jason | isilzha: yes it does what? | 05:42 |
| LadyNikon | wastrel: do you know if anyone has reported that turning off frame buffer support in the kernel makes a difference? | 05:42 |
| isilzha | _jason: look this way | 05:42 |
| gabbah | arrick, never mind | 05:42 |
| Jeshua | I got something very similar to the last, with no difference in numbers. | 05:42 |
| _jason | isilzha: and what does 'sudo echo hi' say? | 05:42 |
| intelikey | Jeshua hehhe well you could cat /etc/*release | 05:43 |
| wastrel | LadyNikon: i have no idea - never really tried tweaking for performance | 05:43 |
| isilzha | _jason: same as before... it diesn't accept my pw | 05:43 |
| Jeshua | Well that works! :D | 05:43 |
| _jason | isilzha: you are using the user password? | 05:43 |
| Jeshua | Breezy it is. | 05:43 |
| === C-O-L-T [n=hunika@193.231.163.10] has joined #ubuntu | ||
| === Agamotto waves | ||
| === Agamotto [n=agamotto@adsl-68-78-164-178.dsl.rcfril.ameritech.net] has left #ubuntu ["No] | ||
| === hippie23 [n=hippie@longview-cuda1-g2-70-36-99-223.losaca.adelphia.net] has joined #ubuntu | ||
| LadyNikon | wastrel: k | 05:44 |
| === axisys [i=iqbala@silenceisdefeat.org] has joined #ubuntu | ||
| isilzha | _jason: oh... sorry expected that i needed the root pw. thanks | 05:45 |
| _jason | isilzha: np | 05:45 |
| === seraphim [n=seraphim@dslb-088-072-206-066.pools.arcor-ip.net] has left #ubuntu ["raus"] | ||
| LadyNikon | ok I raelly hate gnome terminal | 05:45 |
| === LadyNikon goes to find eterm | ||
| intelikey | heh yeah but it doesn't work here i have no /etc/*release ..... | 05:45 |
| wastrel | lsb_release -a | 05:45 |
| arrick | ubotu: tell arrick about yourself | 05:46 |
| intelikey | -bash: lsb_release: command not found | 05:46 |
| intelikey | :) | 05:46 |
| === MachineScrew [n=machine@ip68-225-114-11.mc.at.cox.net] has joined #ubuntu | ||
| wastrel | someone's distro is non compliant | 05:46 |
| === mattcraigschultz [n=matt@adsl-70-240-228-227.dsl.hstntx.swbell.net] has left #ubuntu [] | ||
| intelikey | hmmm it's ubuntu 5.4 | 05:46 |
| axisys | how do i covert 5 searate one page .ps file to One 5 page .ps file? | 05:46 |
| === wickers [n=buck@d150-73-176.home.cgocable.net] has joined #ubuntu | ||
| wickers | Holy crap... when does ubuntu 6.04 come out? | 05:47 |
| _jason | !dapper | 05:47 |
| ubotu | Dapper Drake will be the next release of Ubuntu - due June 1 (see: http://tinyurl.com/qyrkq). Join channel #ubuntu+1 for discussion :) | 05:47 |
| nalioth | intelikey: you won't have it. type "cat /etc/issue" | 05:47 |
| Sir_Fawnpug | Oh, wow, I'm still registered. | 05:47 |
| === GeorgeAScott [n=scott@71-212.69-92-cpe.cableone.net] has left #ubuntu [] | ||
| wastrel | wickers: heh it doesn't - postponed a month & change. :] | 05:47 |
| wickers | I installed Fedora Core 5 to see how it runs... and I want my ubuntu back so badly. | 05:47 |
| hippie23 | I cant log into any of my window managers, only iceWM and failsafe termanal, gnome, KDE, and XFCE all dont work | 05:47 |
| intelikey | nalioth issue is blank | 05:47 |
| hippie23 | it just goes back to the login screen | 05:47 |
| hippie23 | what happened? | 05:47 |
| nalioth | intelikey: i'm lost | 05:47 |
| axisys | never mind.. got it | 05:48 |
| axisys | cat 1.ps 2.ps 3.ps 4.ps > output.ps | 05:48 |
| === KurtKraut [n=ktk@200216077007.user.veloxzone.com.br] has joined #ubuntu | ||
| wickers | I've doen so much to this FC5 install to speed things up... but it still is crap. | 05:48 |
| nickrud | odd that issue would be missing | 05:48 |
| intelikey | that's ok. i'm not looking for the information. just pointing out that it wasn't avalable here. | 05:48 |
| wastrel | well some of us update our systems | 05:48 |
| wastrel | ;] | 05:48 |
| === WebLOCH [n=WebLOCH@82-34-95-143.cable.ubr05.gill.blueyonder.co.uk] has joined #ubuntu | ||
| LadyNikon | ew fedora | 05:49 |
| TheFaction20 | am i able to install things if im just running the live cd | 05:49 |
| intelikey | nickrud issue isn't missing just has nothing in it. | 05:49 |
| WebLOCH | hey guys, does anyone know if its possible to get Epiphany 2 for breezy ? | 05:49 |
| KurtKraut | How do I hibernate my computer ? I'm using Dapper and I can succesufly hibernate it thru gnome, but I can't bring the system back again. I have to shut the power off and boot it again. | 05:49 |
| nickrud | intelikey, you must have removed it, or, nm :) | 05:49 |
| === __mikem [n=michael@201-106.124-70.tampabay.res.rr.com] has joined #ubuntu | ||
| Sir_Fawnpug | Everybody loves RPMs. | 05:49 |
| KurtKraut | Any suggestions ? | 05:49 |
| arrick | ubotu: partitions is https://wiki.ubuntu.com/GnomeComputerMenu on how to find missing partitions. | 05:49 |
| ubotu | ...but partitions is already something else... | 05:49 |
| tonyyarusso | TheFaction20: Yes, but it will bog down your RAM. | 05:49 |
| __mikem | I love binary installers | 05:49 |
| arrick | ok | 05:49 |
| === venska_rossy [n=userbn@202.150.68.114] has joined #ubuntu | ||
| intelikey | !info epiphany-browser | 05:50 |
| ubotu | epiphany-browser: (Intuitive GNOME web browser), section gnome, is optional. Version: 1.8.2-0ubuntu1 (breezy), Packaged size: 1989 kB, Installed size: 9656 kB | 05:50 |
| __mikem | hey, my ubuntu laptop machine isn't broke after all, I just needed to blow it out with compressed air | 05:50 |
| TheFaction20 | tonyyarusso:alright | 05:50 |
| Sir_Fawnpug | __mikem, nice. | 05:50 |
| === WebLOCH [n=WebLOCH@82-34-95-143.cable.ubr05.gill.blueyonder.co.uk] has joined #ubuntu | ||
| __mikem | !linx | 05:50 |
| ubotu | __mikem: parse error: Try searching at http://ubuntu.cc.com.au/ | 05:50 |
| __mikem | !lynx | 05:50 |
| ubotu | __mikem: Wish I knew. Try searching at http://ubuntu.cc.com.au/ | 05:50 |
| __mikem | does liinx or lynx or how ever its spelled still exist | 05:51 |
| Sir_Fawnpug | Yes. | 05:51 |
| Sir_Fawnpug | Links | 05:51 |
| Sir_Fawnpug | And lynx both I think. | 05:51 |
| venska_rossy | hiiiiiiiiiiiiiiiiiiiiiiiiiiii | 05:51 |
| __mikem | !links | 05:51 |
| ubotu | Did you get hit by a windmill? Try searching at http://ubuntu.cc.com.au/, __mikem | 05:51 |
| === nalioth is now known as nalioth_zZz | ||
| intelikey | WebLOCH it looks like 1.8 is the breezy vresion of epip | 05:51 |
| __mikem | obviously if I got hit by a windmill I wouldn't be here right now | 05:51 |
| === roylez [n=roy@147.8.246.173] has joined #ubuntu | ||
| TheFaction20 | Can the ubuntu install make like 3 partitions? one splitting the xp from the files and then add another for ubuntu? | 05:52 |
| === poningru [n=poningru@n128-227-55-122.xlate.ufl.edu] has joined #ubuntu | ||
| arrick | ubotu: lostpartitions is https://wiki.ubuntu.com/GnomeComputerMenu on how to find missing partitions. | 05:52 |
| ubotu | okay, arrick | 05:52 |
| === pablo928 [n=paul@yuma-cuda1-g2-70-36-69-223.losaca.adelphia.net] has left #ubuntu [] | ||
| === mklebel [n=mklebel@198.174.37.205] has joined #ubuntu | ||
| KurtKraut | How can I hibernate a Ubuntu box ? | 05:52 |
| wastrel | links, lynx, w3m | 05:52 |
| WebLOCH | intelikey, yeah i know ive been using it for awhile, but the dependancies for 2.x are the same, so i wnated to upgrade | 05:52 |
| === Jeshua [n=Jeshua@dpc6747171093.direcpc.com] has joined #ubuntu | ||
| === kuja [n=kuja@unaffiliated/kuja] has joined #ubuntu | ||
| Sir_Fawnpug | KurKraut, my hibernate was installed out of the box. | 05:52 |
| intelikey | WebLOCH you could build the new one. | 05:52 |
| Sir_Fawnpug | Err, KurtKraut | 05:52 |
| Sir_Fawnpug | Sorry | 05:53 |
| __mikem | I run my laptop off of ac power so I don't need hibernate | 05:53 |
| WebLOCH | intelikey, i cant find the source, im on the epip site, any directions? | 05:53 |
| intelikey | no. | 05:53 |
| TheFaction20 | Can the ubuntu install make like 3 partitions? one splitting the xp from the files and then add another for ubuntu? | 05:53 |
| Sir_Fawnpug | Anybody happen to be familiar with acer_acpi? I'm having trouble getting the module to load on my Acer Aspire 3004WLCi | 05:53 |
| KurtKraut | Sir_Fawnpug, I'm able to hibernate my computer, but I don't know how to bring it back after hibernating. | 05:53 |
| === Siph0n [n=Siph0n@gateway2.ycp.edu] has joined #ubuntu | ||
| LadyNikon | yay bye bye gnomer terminal :D | 05:53 |
| WebLOCH | intelikey, i just saw the link, i am such a moron | 05:53 |
| intelikey | WebLOCH search source forge | 05:53 |
| Sir_Fawnpug | Kurt, power button probably. | 05:53 |
| === hippie23 [n=hippie@longview-cuda1-g2-70-36-99-223.losaca.adelphia.net] has left #ubuntu ["Leaving"] | ||
| Jeshua | Oh well, back-ish. | 05:54 |
| intelikey | k | 05:54 |
| KurtKraut | Sir_Fawnpug, no, I've tried that, no response. | 05:54 |
| Sir_Fawnpug | Or opening the lid. | 05:54 |
| KurtKraut | I'm trying to hibernate a desktop, not a laptop | 05:54 |
| __mikem | Some laptops hibernate when you close the lid while they are running | 05:54 |
| Sir_Fawnpug | Oh, I see. | 05:54 |
| Sir_Fawnpug | I don't know about desktop hibernation, I never needed it myself. | 05:54 |
| __mikem | I don't understand the point of hibernating a desktop | 05:54 |
| === tar_ [n=tar@dynamic-oit-vapornet-c-477.Princeton.EDU] has joined #ubuntu | ||
| __mikem | computers use virtually no power, except for the monitor which you can turn off | 05:55 |
| === johanbr [n=j@d154-20-231-240.bchsia.telus.net] has joined #ubuntu | ||
| __mikem | and the fans which won't run unless the thing starts to over heat which won't be that often if you are not using it | 05:55 |
| tar_ | How can I disable UIM for a session? It's interfering with many of my applications. | 05:55 |
| intelikey | yeah and my bios does all but powerdown this box anyway.... better than screen saver. | 05:55 |
| KurtKraut | __mikem, if your building is on fire and you don't have enough time to save all your current work it is the quickiest way of shutting off a computer without loosing the current data :P | 05:55 |
| LathropWells | around 200watts for a desktop muchless for a laptop | 05:55 |
| __mikem | lol | 05:55 |
| Sir_Fawnpug | I dunno man, a P4 dissipates ALOT of power. | 05:56 |
| === Davey` [i=foobar@77-231.124-70.tampabay.res.rr.com] has joined #ubuntu | ||
| === eviltux [n=eviltux@201.154.212.24] has joined #ubuntu | ||
| === michael [n=michael@adrianDHCP-69.216-254-253.iw.net] has joined #ubuntu | ||
| __mikem | Sir_Fawnpug never heard of that happening | 05:57 |
| === eviltux [n=eviltux@201.154.212.24] has left #ubuntu ["GNU/Linux"] | ||
| intelikey | what is UIM ? | 05:57 |
| michael | Does anybody know if a Creative Nomad Zen Xtra will play OGG Vorbis? | 05:58 |
| Sir_Fawnpug | __mikem, a P4 dissipating alot of power? They're notorious for that aren't they? | 05:58 |
| tar_ | UIM is the input manager that I am using for Japanese input. | 05:58 |
| __mikem | I always used athlon chips | 05:58 |
| === AphoriSm [n=AphoriSm@201.154.212.24] has joined #ubuntu | ||
| __mikem | but I don't know if that makes a difference | 05:58 |
| __mikem | same archetecture | 05:58 |
| tar_ | I just removed it, and I'm going to see if my problems disappear now. | 05:58 |
| Sir_Fawnpug | __mikem, well it has more to do with how the chips are designed I think | 05:58 |
| TheFaction20 | michael:im pretty sure that they dont play ogg's. i have a creative and they wont go on | 05:58 |
| intelikey | oh universal input manager hehhe | 05:58 |
| === scotty_b [n=chatzill@70-41-128-25.cust.wildblue.net] has left #ubuntu [] | ||
| === hatake_k1kashi [n=meh@60-240-187-186.tpgi.com.au] has joined #ubuntu | ||
| __mikem | yes, so I doubt it makes a difference if its an intel or an athlon | 05:59 |
| === kartik [n=kartik@202.63.116.26] has joined #ubuntu | ||
| __mikem | because the athlon chips use the intel designs | 05:59 |
| michael | TheFaction, if I rip to FLAC, can I convert to MP3 and keep the ID3 tags? | 05:59 |
| === KurtKraut [n=ktk@200216077007.user.veloxzone.com.br] has left #ubuntu ["Leaving"] | ||
| LathropWells | someone mentioned "netcat" earlier. take a look at "socat" ;) | 05:59 |
| === TTilus is now known as Zathras | ||
| Jeshua | Oh dear.. | 06:00 |
| kartik | can i use webcam while chatting from yahoo messenger??????? | 06:00 |
| Sir_Fawnpug | __mikem, well not nessescarily. AMD at one point did second source chips, but I think the latter support was reverse engineering. | 06:00 |
| === Zathras is now known as TTilus | ||
| __mikem | Yes, years ago they had their own chips | 06:00 |
| === sinblox [n=matt@S0106000c41aebf83.cc.shawcable.net] has joined #ubuntu | ||
| TheFaction20 | michael:im not sure, havent had to do that much converting. actually never had to. but if u can get tit to mp3 its not hard to customize the id3 tags | 06:01 |
| sinblox | Can anyone direct me to instructions/help me to get Realplayer working in FireFox? When I try to run RM files that are on websites it tries to use totem | 06:01 |
| michael | TheFaction20, what is a good program to rip o MP3? | 06:01 |
| wastrel | bye now | 06:01 |
| Sir_Fawnpug | __mikem, well I'd liken it to more like how sparcs are. The operating specifications are more or less the same, but not nessescarily the same. | 06:01 |
| __mikem | I don't know if real player has plugin support for firefox in linux | 06:01 |
| Sir_Fawnpug | err | 06:01 |
| === Flik [n=mbamford@d205-250-148-56.bchsia.telus.net] has joined #ubuntu | ||
| === DeMoNSeEd [n=DeMoNSeE@toronto-HSE-ppp4001054.sympatico.ca] has joined #ubuntu | ||
| Sir_Fawnpug | I meant the design is not nessescarily the same, just the architecture. | 06:02 |
| TheFaction20 | michael: to be honest i dont know that one. im sure someone here can help you | 06:02 |
| __mikem | I have no experience with sparcs so, I wouldn't know about that | 06:02 |
| === Dr_Willis [n=willis@12-222-81-183.client.insightBB.com] has joined #ubuntu | ||
| === eduardo [n=eduardo@201.153.243.190] has joined #ubuntu | ||
| sinblox | Damn. Hmm | 06:02 |
| Sir_Fawnpug | __mikem, the SPARC architecture is open, at least in comparison to the x86 | 06:02 |
| arrick | michael, ask _jason your question | 06:02 |
| __mikem | Sparc is by Sun right? | 06:03 |
| _jason | sinblox: mplayer with w32codecs can play them | 06:03 |
| Sir_Fawnpug | __mikem, well by FreeScale/Motorola. | 06:03 |
| kartik | !how to use webcam while cyhatting?????? | 06:03 |
| ubotu | kartik: Some people juggle geese. Try searching at http://ubuntu.cc.com.au/ | 06:03 |
| michael | _jason, what is a good program to rip o MP3? | 06:03 |
| WebLOCH | intelikey, do you run epiphany 2.14? | 06:03 |
| arrick | kartik, good luck | 06:03 |
| __mikem | I see | 06:03 |
| intelikey | WebLOCH i use links2 | 06:03 |
| LathropWells | search your favorite player ans LAME it sould be able to encode to mp3. | 06:03 |
| sinblox | _jason: so just install mplayer then? | 06:03 |
| sinblox | (sorry I'm a bit of a newbie) | 06:03 |
| WebLOCH | intelikey, okay | 06:03 |
| _jason | ubotu: tell sinblox about replacetotem | 06:04 |
| arrick | night all | 06:04 |
| _jason | ubotu: tell sinblox about mplayer | 06:04 |
| sinblox | Thanks Jason | 06:04 |
| Sir_Fawnpug | __mikem, I guess a better analogy might be the PowerPC architecture, or the ARM architecture. | 06:04 |
| _jason | michael: I don't know of a good one, i've never had to do it sorry | 06:04 |
| Sir_Fawnpug | Basically the design expectations are the same, but the means to get there are not. | 06:04 |
| tonyyarusso | michael: grip | 06:04 |
| LathropWells | socat - glad i am not a hacker - roflmao | 06:04 |
| depakote | http://s49.photobucket.com/albums/f278/tripps6969/? | 06:04 |
| michael | _jason; what about converting FLAC to MP3 and keeping theID3 tag? | 06:04 |
| WebLOCH | anyone here running epiphany 2.14? | 06:04 |
| kartik | how to use webcam in yahoo?????? | 06:04 |
| __mikem | Speaking of PowerPC, Apple is using the intel chips now | 06:04 |
| sinblox | !mplayer | 06:05 |
| ubotu | mplayer is, like, https://wiki.ubuntu.com/MplayerInstallHowto For compiling, see: http://ubuntuforums.org/showthread.php?t=31061 | 06:05 |
| Sir_Fawnpug | __mikem, yep, although if I were jobs I would've stayed with a RISC processor. | 06:05 |
| intelikey | WebLOCH my hdd is only 610m so space is vital. i have to use the lightest of apps if i have a gui. most of what i do is cli. | 06:05 |
| Sir_Fawnpug | I think the x86 is actaully a very messy platform. | 06:05 |
| === malv [n=arthur@pool-71-103-34-110.lsanca.dsl-w.verizon.net] has joined #ubuntu | ||
| __mikem | Yup, to much concern with backwards compat | 06:05 |
| TTilus | Sir_Fawnpug: messy and fast per buck | 06:05 |
| WebLOCH | intelikey, im impressed, i wouldnt wnat to do it myself, i like the idea of the efficiency but at the same time, i like pretty. | 06:05 |
| __mikem | an instruction set that was overextended | 06:06 |
| Sir_Fawnpug | But the way the hardware proliferates is amazing | 06:06 |
| Sir_Fawnpug | TTilus, I wasn't arguing against the x86 per se. | 06:06 |
| TTilus | all concern with backwards compat is good concern | 06:06 |
| TTilus | Sir_Fawnpug: i know :) | 06:06 |
| __mikem | yes, it will be interesting to see if any newcommers imerge in the market as 64 bit computing catches on | 06:06 |
| Sir_Fawnpug | __mikem, well you'll notice alot of older computers have relatively large instruction sets too. | 06:06 |
| __mikem | Yes, but they are more thought out and a bit neater | 06:07 |
| === oRxo [n=orco@user-142h4ed.cable.mindspring.com] has joined #ubuntu | ||
| === me2win [n=me2win@adsl-69-152-250-70.dsl.snantx.swbell.net] has joined #ubuntu | ||
| Sir_Fawnpug | __mikem, maybe not as much as you think. | 06:07 |
| oRxo | heeey i'm in ubuntu!!!!!!!! | 06:07 |
| TTilus | Sir_Fawnpug: i wasn't arguing per pro x86 | 06:07 |
| Sir_Fawnpug | Some are. | 06:07 |
| TheDracle | Eh, more geared for compilers is more important than neat. | 06:07 |
| LathropWells | Welcome oRxo :) | 06:07 |
| TheFaction20 | do any of you guys like any of the usb thumbdrive distros? | 06:07 |
| Sir_Fawnpug | TTilus, ahh, I just thought at first I gave the impression I'm against the PC or anything, which would be odd, considering I'm using one. | 06:07 |
| __mikem | I have some experience with x86 asm, and I rarely use more than mov, push, call, add, sub, etc | 06:07 |
| intelikey | WebLOCH yeah eye candy is sweet if you can afford it. links2 -g does a pretty good job tho. and it also works in text mode so i don't have to start a gui. for anyone thinking "minimal" i recomend links2. | 06:08 |
| TheDracle | __mikem: But compilers tend to use a lot more. | 06:08 |
| bimberi | !tell michael about ripping | 06:08 |
| TTilus | __mikem: leave the other stuff to compilers | 06:08 |
| kartik | can i reinstall windows in my computer???????? | 06:08 |
| WebLOCH | intelikey, if you lived in the UK i would send yuou a spare HDD | 06:08 |
| intelikey | :) | 06:08 |
| Sir_Fawnpug | Well every now and then an obscure opcode can be good when you're hashing out assembly. | 06:08 |
| TTilus | kartik: any reason why not? (i can figure out several :) | 06:08 |
| __mikem | Actually, I disassembled a lot of code immited by visual c++, and didn't see much leveraging of the other instructions | 06:08 |
| TheDracle | Right, having a huge insruction set is good if the extra instructions can be wielded by a good compiler. | 06:08 |
| Sir_Fawnpug | If you know how to use it. | 06:08 |
| Sir_Fawnpug | __mikem, was the code optimized? | 06:09 |
| TheDracle | __mikem: So have I, you haven't dissaembled enough :p And enough varied compilers. | 06:09 |
| TTilus | kartik: do you mean to install (re)windows as only platform? | 06:09 |
| __mikem | Yes | 06:09 |
| TheDracle | __mikem: But yes, 90% of instructions will be mov, and add, and push. | 06:09 |
| Sir_Fawnpug | To what level? | 06:09 |
| intelikey | kartik you are not allowed to go back to windows. now don't ask again! and go to your room. | 06:09 |
| === casey_ [n=casey@68.191.32.128] has joined #ubuntu | ||
| === La_PaRCa [n=sergio@cable200-116-15-45.epm.net.co] has joined #ubuntu | ||
| LathropWells | lol | 06:09 |
| TTilus | kartik: or perhaps (re)install windows in side of ubuntu? | 06:09 |
| intelikey | :) | 06:09 |
| casey_ | Greetings. | 06:09 |
| === avdi [n=avdi@ha-216-108-203-126.ctsimm.net] has joined #ubuntu | ||
| === AphoriSm [n=AphoriSm@201.154.212.24] has left #ubuntu ["GNU/Linux"] | ||
| __mikem | Its a deep rooted issue heavly influenced by business decisions as apposed to rational thought | 06:10 |
| WebLOCH | TTilus, VM is the Devil | 06:10 |
| Sir_Fawnpug | TheDracle, it doesn't help execution any if you have to wait on microcode. | 06:10 |
| kartik | TTilus : i want to reinstall because i am not able to access my webcam | 06:10 |
| casey_ | Might I ask a kind of esoteric sound-related question? | 06:10 |
| TTilus | kartik: webcam in windows? | 06:10 |
| LadyNikon | alright | 06:11 |
| LadyNikon | question | 06:11 |
| === dtrostis [n=damian@dsl092-160-184.wdc2.dsl.speakeasy.net] has joined #ubuntu | ||
| TTilus | casey_: no? go ahead!!1 | 06:11 |
| LadyNikon | https://wiki.ubuntu.com/FirefoxNewVersion can someone look at this page for me | 06:11 |
| TTilus | kartik: you have win ubuntu dualboot? | 06:11 |
| _jason | LadyNikon: what's the question | 06:11 |
| LathropWells | If you really must have windows reinstalled - ask the question and we can help (heck it is very likely you will be back here after the next virus/spyware/keylogger infection. | 06:11 |
| kartik | ttilus:because in ubuntu i am not able to use wwebcam while chatting from yahoo messenger | 06:11 |
| dtrostis | question guys, an easy one. Where Ubuntu stores the desktop backgrounds | 06:11 |
| casey_ | Alright, so here it is. I have an A7N8X-DX mainboard and I'm using the S/PDIF sound. So I set up an asoundrc file to get that working, but OSS programs give me no sound. | 06:11 |
| __mikem | I never had any luck doing duel boot | 06:11 |
| casey_ | Furthermore, the aoss wrapper causes them to segfault and work in unusual ways. | 06:12 |
| __mikem | the partitioning software we tried using never worked | 06:12 |
| casey_ | (Rather than making them, y'know, produce sound). | 06:12 |
| === bsoft [n=bsoft@87-196-215-165.net.novis.pt] has joined #ubuntu | ||
| LadyNikon | jason_: it just froze on me | 06:12 |
| TTilus | kartik: if you have problems in ubuntu, reinstalling windows will definitely not help you, quite contrary, windows install will propably squash ubuntu away without asking you any questions | 06:12 |
| LadyNikon | ill ask tomorrow when i wake up | 06:13 |
| intelikey | dtrostis /usr/X11* maybe ? | 06:13 |
| LadyNikon | bugers all | 06:13 |
| casey_ | I'm assuming you'll want to look at the .asoundrc file. | 06:13 |
| dtrostis | maybe ladynikon, I will try there | 06:13 |
| LathropWells | windows for games. Ubuntu for everyrthing else | 06:13 |
| TTilus | kartik: iirc yahoo in linux does not support video | 06:13 |
| TTilus | kartik: i could be wrong | 06:13 |
| === reggaemanu [n=manu@ARennes-257-1-114-32.w86-210.abo.wanadoo.fr] has joined #ubuntu | ||
| Sir_Fawnpug | TTilus, actually the two can co-exist peacefully even if you reinstall windows afterwards | 06:14 |
| === spider [n=spider@cpe-66-25-130-204.austin.res.rr.com] has joined #ubuntu | ||
| === spider is now known as suffer | ||
| TTilus | Sir_Fawnpug: tell me more, i would _love_ to know how to do that | 06:14 |
| kartik | ttilus:is that going to put any trouble to the mother board??????? | 06:14 |
| Sir_Fawnpug | I keep windows around due to a microsoft pawn up at school. | 06:14 |
| casey_ | http://www.ubuntuforums.org/archive/index.php/t-75317.html Here, I used this asoundrc file. | 06:14 |
| dtrostis | sorry, intelikey | 06:14 |
| intelikey | np | 06:14 |
| TTilus | Sir_Fawnpug: i'm well aware that at some point some of my buddies will be asking that question :) | 06:14 |
| === MetaMorfoziS [n=sajt@3e44a606.adsl.enternet.hu] has joined #ubuntu | ||
| IdleOne | !tell TTilus about dualboot | 06:15 |
| TTilus | kartik: one question mark does fine, dont waste them | 06:15 |
| === Silencer [n=Silencer@82.208.215.13] has joined #ubuntu | ||
| Sir_Fawnpug | TTilus, at least in my general experience, besides the bootloader issue and of course having to keep a small FAT32 partition | 06:15 |
| TTilus | kartik: depends on what "that" is | 06:15 |
| Sir_Fawnpug | There weren't many issues with dual boot. | 06:15 |
| TTilus | kartik: you mean reinstalling windows? | 06:15 |
| casey_ | So do any of you guys have any idea about the sound thing? | 06:15 |
| dtrostis | I couln't find it there. I have also a problem trying with the art manager :( It doesn't work, I mean it downloads and the dissapears. | 06:15 |
| kartik | ttilus:ya | 06:15 |
| === panzer [n=panzer@130-126-246-201.adsl.terra.cl] has joined #ubuntu | ||
| === born_ [n=born@20151236138.user.veloxzone.com.br] has joined #ubuntu | ||
| TTilus | kartik: if you want to reinstall windows because you have problem with webcam in linux, Do Not Do That! | 06:16 |
| born_ | j #ubuntu-br | 06:16 |
| TTilus | kartik: it wont help ya | 06:16 |
| === jadaz87_ [n=jadaz87@pool-70-111-105-18.nwrk.east.verizon.net] has joined #ubuntu | ||
| === panzer [n=panzer@130-126-246-201.adsl.terra.cl] has left #ubuntu ["Abandonando"] | ||
| === Elhaz [n=elhaz_10@conm200-116-102-165.epm.net.co] has joined #ubuntu | ||
| === TecnoVM64 [n=tecnovm@unaffiliated/tecnovm64] has joined #ubuntu | ||
| Sir_Fawnpug | Naturally if you reinstall windows afterwards its going to want to overwrite the boot sector, but that's no problem, since you can just get a livecd, chroot into your root, and run grub | 06:16 |
| TTilus | kartik: and the problem most propably is not a prob at all | 06:16 |
| dtrostis | question guys, an easy one. Where Ubuntu stores the desktop backgrounds | 06:16 |
| TTilus | kartik: but a feature | 06:16 |
| === Sionide [n=sphinx@collaredlory2.hornet.uea.ac.uk] has joined #ubuntu | ||
| intelikey | dtrostis if you know any of the names use find /usr -name *blah* it can tell you where. | 06:16 |
| tonyyarusso | born_: /join #ubuntu-br | 06:16 |
| kartik | ttilus:but i was able to access webcam in windows | 06:16 |
| === ba [n=ba@69-11-1-139.yktn.hsdb.sasknet.sk.ca] has joined #ubuntu | ||
| __mikem | I always prefere to put linux on an old machine that is no longer in heavy use | 06:17 |
| Sionide | huzzah | 06:17 |
| TTilus | kartik: have you asked yahoo forums or somewhere where there are yahoo linux people? | 06:17 |
| Sionide | stupid exploit | 06:17 |
| === jadaz87_ is now known as jadaz87 | ||
| __mikem | like this presario 900 I am on | 06:17 |
| born_ | tonyyarusso, I got it ! Thanks | 06:17 |
| TTilus | kartik: that does not have anything to do with the issue, windows and ubuntu are independet | 06:17 |
| __mikem | that way we don't need to worry about hurting a windows instalation | 06:17 |
| LathropWells | Old computers never die they just get more flexible and powerful with linux. :) | 06:17 |
| kartik | ttilus:ya they said in linux we cant use webcam feature | 06:18 |
| born_ | tonyyarusso, We can type only /j #channel too. | 06:18 |
| === Arrick [n=Arrick@pool-71-115-130-42.gdrpmi.dsl-w.verizon.net] has joined #ubuntu | ||
| TTilus | kartik: if something works under windows you can not deduce upon that something workin on ubuntu and vice versa | 06:18 |
| TTilus | kartik: so there you are | 06:18 |
| TTilus | kartik: if you want to use webcam in linux, use chatapp which supports webcam in linux | 06:18 |
| intelikey | LathropWells flexible and powerful ? hmmmm i thought that linux just made use of what was there...... | 06:18 |
| TTilus | kartik: i personally use gnomemeeting | 06:18 |
| Dr_Willis | if you can find a supported webcam | 06:18 |
| oRxo | hmm i'm having trouble trying to install mplayer | 06:19 |
| __mikem | talk about splitting hairs | 06:19 |
| LadyNikon | gn all | 06:19 |
| Arrick | !mplayer | 06:19 |
| ubotu | [mplayer] https://wiki.ubuntu.com/MplayerInstallHowto For compiling, see: http://ubuntuforums.org/showthread.php?t=31061 | 06:19 |
| oRxo | in debian, you added merriliat to the apt/sources | 06:19 |
| __mikem | night ladynikon | 06:19 |
| Elhaz | Hello | 06:19 |
| biovore | oRxo: ubuntu has a mplayer in there repos | 06:19 |
| === eth0-noob [n=brian@adsl-69-152-160-49.dsl.okcyok.swbell.net] has joined #ubuntu | ||
| LathropWells | there is joy in reusing a 200mhz laptop to serve webpages. | 06:19 |
| kartik | ttilus:from gnomemeeting can i access my yahoo account? | 06:19 |
| Elhaz | can somebody help me with my modem? | 06:19 |
| eth0-noob | hello | 06:19 |
| TTilus | Sir_Fawnpug: umm, gotta remember to have livecd ready | 06:19 |
| === [aJ] [n=[aJ] @adsl-68-248-193-249.dsl.klmzmi.ameritech.net] has joined #ubuntu | ||
| TTilus | kartik: hmm, yahoo, propably not, but i dont know for sure | 06:20 |
| eth0-noob | is there anyway i could make an ssh server on my windows computer and come over from my linux computer? | 06:20 |
| __mikem | LathropWells hope you have more bandwidth than you do processor speed | 06:20 |
| TTilus | kartik: i dont use yahoo | 06:20 |
| intelikey | !modem | 06:20 |
| ubotu | methinks modem is https://wiki.ubuntu.com/DialupModemHowto | 06:20 |
| Elhaz | yeah.. | 06:20 |
| Elhaz | but.. | 06:20 |
| eth0-noob | ? | 06:20 |
| Sir_Fawnpug | LAter nikon | 06:20 |
| Elhaz | i haver the Driver.. | 06:20 |
| === walkingice [n=walkingi@220-132-63-119.HINET-IP.hinet.net] has joined #ubuntu | ||
| Elhaz | and i don`t know what happen | 06:20 |
| kartik | ttilus:please can i know what do u use for chatting with other people? | 06:21 |
| === sNake [n=mrdez@c-67-163-82-21.hsd1.il.comcast.net] has joined #ubuntu | ||
| eth0-noob | is there a possible way i can make an ssh server on my winsows xp computer and ssh over from my computer? | 06:21 |
| Sir_Fawnpug | TTilus, the headache is minor in my experience. | 06:21 |
| tonyyarusso | eth0-noob: Look into putty. | 06:21 |
| Sir_Fawnpug | When you don't know about chroot it does suck though. | 06:21 |
| intelikey | eth0-noob yes. google putty | 06:22 |
| === mulberry [n=mulberry@68-112-70-193.dhcp.jcsn.tn.charter.com] has joined #ubuntu | ||
| eth0-noob | ok | 06:22 |
| __mikem | or tight vnc | 06:22 |
| eth0-noob | well | 06:22 |
| eth0-noob | yea | 06:22 |
| === manji [n=manji@c-71-193-163-175.hsd1.or.comcast.net] has joined #ubuntu | ||
| eth0-noob | uhm but all i really am trying to do is copy some music files from windows to my computer | 06:22 |
| manji | hey, so how do fonts work in X if i wanted to specify one on the command line | 06:22 |
| eth0-noob | im using samba... but there is an error.. needs octet or something? | 06:22 |
| tonyyarusso | eth0-noob: Hmm, that says client; not sure if it does server or if you set it up with something else for that. That'll get you going in the right direction anyway. | 06:22 |
| === ba_ [n=ba@69-11-1-139.yktn.hsdb.sasknet.sk.ca] has joined #ubuntu | ||
| oRxo | well i've got my sources, open to restricted, universe, multiverse | 06:22 |
| === sinblox [n=matt@S0106000c41aebf83.cc.shawcable.net] has left #ubuntu ["Leaving"] | ||
| TTilus | kartik: gnomemeeting, but i would not call that "chatting" in the sense you propably mean | 06:23 |
| __mikem | if your computer is on a network, all you need to do is provide the ip address of the computer you want to access | 06:23 |
| TTilus | kartik: that would be more like videoconference | 06:23 |
| [aJ] | I just setup MySQL on a Ubuntu server and I can't connect to it from another machine I receive the error "ERROR 2003 (HY000): Can't connect to MySQL server on 'jinx' (111)" Does Ubuntu have a firewall setup by default that does not allow for me to connect? Anyone know how to fix this? | 06:23 |
| === bimberi_ [n=bimberi@pdpc/supporter/active/bimberi] has joined #ubuntu | ||
| tonyyarusso | eth0-noob: It might be easier for you to hope someone here can help you with samba then. | 06:23 |
| Elhaz | ok.. thanks for help me | 06:23 |
| eth0-noob | __mikem, i have already done that. i have actually browsed through stuff on windows, but i cant copy them? heh. | 06:24 |
| manji | hey how do you specify X fonts at the command line? | 06:24 |
| manji | whats the format? | 06:24 |
| __mikem | interesting, you don't have read access to the files | 06:24 |
| eth0-noob | i guess not | 06:24 |
| eth0-noob | i actually | 06:24 |
| TTilus | [aJ] : i assume mysql on ubuntu doesnt have net enabled by default, see mysql conf (ps. clumsy nick you have) | 06:24 |
| eth0-noob | had to kind of hack it so i could browse windows | 06:24 |
| eth0-noob | using ettercap. | 06:24 |
| eth0-noob | using a couple plug-ins. | 06:24 |
| __mikem | that sounds like it might be a problem on the other end though, that is to say not on your linux box | 06:25 |
| mahangu | what's the bash to grep a file for "foo" and then remove all lines that have that? | 06:25 |
| === hatake_kakashi [n=meh@60-241-7-174.tpgi.com.au] has joined #ubuntu | ||
| === Agent_bob [n=root@0-1pool90-6.nas23.houston4.tx.us.da.qwest.net] has joined #ubuntu | ||
| [aJ] | TTilus: How would I enabled net access? | 06:25 |
| eth0-noob | hm | 06:25 |
| eth0-noob | i hate windows... | 06:25 |
| === me2win [n=Roberto@adsl-69-152-250-70.dsl.snantx.swbell.net] has joined #ubuntu | ||
| __mikem | ditto | 06:25 |
| eth0-noob | aj | 06:25 |
| kartik | ttilus:please can u tell me the procedure for inviting other to vedioconference in gnomemeeting? | 06:25 |
| [aJ] | eth0-noob: | 06:25 |
| Sir_Fawnpug | I'm going to get some grand unified bootloader. Be back shortly. | 06:25 |
| === WiFi_Warri0r [n=roy@adsl-70-136-54-247.dsl.hstntx.swbell.net] has joined #ubuntu | ||
| WiFi_Warri0r | hello all | 06:25 |
| Agent_bob | hmmm that was nice.... like a dcc.send exploit or something.... | 06:25 |
| __mikem | hi | 06:25 |
| eth0-noob | hello | 06:25 |
| WiFi_Warri0r | im new to linux | 06:26 |
| WiFi_Warri0r | just installed ubuntu | 06:26 |
| WiFi_Warri0r | very nice OS | 06:26 |
| WiFi_Warri0r | :D | 06:26 |
| __mikem | we get that allot | 06:26 |
| === Dr_Willis hands WiFi_Warri0r a gold star. :P | ||
| === TubaSoldier [n=llij@72.24.12.41] has joined #ubuntu | ||
| WiFi_Warri0r | mikem: id say so lol | 06:26 |
| eth0-noob | aj if you have ethernet cord hooked up to computer its probably sudo ifconfig eth0 up | 06:26 |
| eth0-noob | and then do | 06:26 |
| eth0-noob | sudo dhclient | 06:26 |
| tonyyarusso | WiFi_Warri0r: Congratulations. | 06:26 |
| eth0-noob | and route and make sure you have connection | 06:26 |
| WiFi_Warri0r | im having trouble getting bittorrent to work tho | 06:26 |
| WiFi_Warri0r | :( | 06:26 |
| eth0-noob | hey | 06:27 |
| TTilus | [aJ] : uhh... you not-disable it :) it consists of editing mysql conf (/etc/mysql/) and restarting daemon (sudo /etc/init.d/mysql restart) | 06:27 |
| Agent_bob | ifup | 06:27 |
| TubaSoldier | How big is the software repository for ubuntu? is it anything like debians? | 06:27 |
| === bimberi_ is now known as bimberi | ||
| tonyyarusso | TubaSoldier: I have about 17,000 in my repos right now. | 06:27 |
| eth0-noob | i should dl stuff in bittorrent maybe some movies? yay i got dvd burner yesterday. oh can anyone tell me how to make vcd's? | 06:27 |
| Agent_bob | !dstats | 06:27 |
| === JohnP789 [n=JohnP789@68-188-42-215.dhcp.stls.mo.charter.com] has joined #ubuntu | ||
| ubotu | Ubuntu Distro Stats on breezy... 18588 packages, 1641 maintainers, 36998 MB installed size, 11424 MB compressed size. | 06:27 |
| [aJ] | eth0-noob: dude my network works fine | 06:27 |
| [aJ] | eth0-noob: it's mysql that I can't connect to | 06:27 |
| TubaSoldier | tonyyarusso: thanks. thats good to know | 06:27 |
| [aJ] | TTilus: thanks | 06:27 |
| tonyyarusso | Agent_bob: I forgot about that :) | 06:27 |
| Agent_bob | :) | 06:27 |
| eth0-noob | i dont know aj. | 06:27 |
| WiFi_Warri0r | i cant get torrents, i cant figure out how to install a client and i cant get bitorrent working | 06:28 |
| WiFi_Warri0r | :\ | 06:28 |
| === Makimer [i=mustapha@S010600134645dcdf.ed.shawcable.net] has joined #ubuntu | ||
| __mikem | oh well, I am getting tired, ttyl | 06:28 |
| === mark_ [n=mark@ip24-250-169-78.bc.dl.cox.net] has joined #ubuntu | ||
| TTilus | [aJ] : my debian stable has bind-address = 127.0.0.1 | 06:28 |
| === ep [n=mdr@ip68-97-122-135.ok.ok.cox.net] has joined #ubuntu | ||
| eth0-noob | does anyone know what would be the best program to get or the best command i could use to make a video cd? i got a dvd burner and want to make some vds | 06:28 |
| [aJ] | TTilus: so does mine | 06:28 |
| eth0-noob | vcds* | 06:28 |
| JohnP789 | Can I put the Dapper Live ISO on a FAT32 partition on my hard disk and have the initrd read the squashfs loop file from there? | 06:28 |
| TTilus | [aJ] : it means mysql is only listening localhost | 06:28 |
| [aJ] | TTilus: just add a , and the ip? | 06:29 |
| [aJ] | or a space & the ip? | 06:29 |
| TTilus | [aJ] : look conf manual | 06:29 |
| [aJ] | searching now | 06:29 |
| eth0-noob | hm | 06:30 |
| Agent_bob | JohnP789 not likely without modifying the initrd.img, because the support for ide and vfat are not in initrd.img on the installer. | 06:30 |
| JohnP789 | Agent_bob, Ah. OK. | 06:31 |
| === hyphenated [n=cgilmour@222-153-82-42.jetstream.xtra.co.nz] has joined #ubuntu | ||
| === ckasprzak [n=ckasprza@69-162-199-115.bflony.adelphia.net] has joined #ubuntu | ||
| === TubaSoldier [n=llij@72.24.12.41] has left #ubuntu ["These] | ||
| === Elvin [n=Elvin@216-188-239-117.dyn.grandenetworks.net] has joined #ubuntu | ||
| === aFlag [n=uno@201008134005.user.veloxzone.com.br] has joined #ubuntu | ||
| WiFi_Warri0r | im having some troubkle sharing files on my ubuntu server | 06:31 |
| nalioth_zZz | !botabuse | 06:31 |
| ubotu | You can play with me in /msg or #debian-bots without being banned. | 06:31 |
| WiFi_Warri0r | i see them on my windows box3n but when i try and open them it asks for login | 06:32 |
| WiFi_Warri0r | i type in my name and password and it doesnt seem to work | 06:32 |
| nalioth_zZz | !ircrules | 06:32 |
| ubotu | you are invited to read https://wiki.ubuntu.com/IrcRules | 06:32 |
| WiFi_Warri0r | just pops back up with logon again | 06:32 |
| WiFi_Warri0r | ny help? | 06:32 |
| WiFi_Warri0r | any* | 06:32 |
| kRaKoN | with "users" you can see the users connected on the bash, but how can you disconect an user ? | 06:32 |
| eth0-noob | WiFi_warri0r i have the same problem | 06:33 |
| eth0-noob | but | 06:33 |
| === jmworx [n=jmworx@theorix.CeNTIE.NET.au] has joined #ubuntu | ||
| eth0-noob | i got around mine.. had to hack | 06:33 |
| WiFi_Warri0r | hack, what did u do? | 06:33 |
| eth0-noob | using ettercap and there is a plugin to where it doesnt ask you for pass or username. shouldnt anyways but windows sucks | 06:33 |
| === EABS [n=Elvin@216-188-239-117.dyn.grandenetworks.net] has joined #ubuntu | ||
| eth0-noob | you know what ettercap is? | 06:33 |
| WiFi_Warri0r | ethercap? | 06:33 |
| WiFi_Warri0r | for win or nix? | 06:33 |
| eth0-noob | linux | 06:33 |
| tonyyarusso | WiFi_Warri0r, eth0-noob: Hey, are we sambaing? Try setting up accounts on the Linux box with the same username and password as on Windows, and make sure you've added those users and passwords to samba (smbpasswd -a). | 06:33 |
| WiFi_Warri0r | which box did u sniff? | 06:33 |
| === cmvo [n=cmvo@62.225.11.174] has joined #ubuntu | ||
| eth0-noob | the windows one lol | 06:34 |
| EABS | hi | 06:34 |
| WiFi_Warri0r | tony: ty! andf yes i was sambaing | 06:34 |
| === cmvo [n=cmvo@62.225.11.174] has left #ubuntu [] | ||
| WiFi_Warri0r | ;) | 06:34 |
| eth0-noob | unified sniffing arp poisioning..added hosts to targets.. router first target- box second | 06:34 |
| === jadaz87 [n=jadaz87@pool-70-111-105-18.nwrk.east.verizon.net] has left #ubuntu ["Leaving"] | ||
| === carthik [n=carthik@user-0cej755.cable.mindspring.com] has joined #ubuntu | ||
| eth0-noob | win box second target | 06:34 |
| eth0-noob | go to pluging and select.. (hold on) | 06:34 |
| eth0-noob | at the bottom of plugins list | 06:35 |
| [aJ] | TTilus: thanks 10x | 06:35 |
| === [aJ] [n=[aJ] @adsl-68-248-193-249.dsl.klmzmi.ameritech.net] has left #ubuntu [] | ||
| eth0-noob | there is smb_clear and smb_(something else lol forgot) select both and it should work./ | 06:35 |
| WiFi_Warri0r | roy@ubuntu:~$ smbpasswd -L -a roy -n | 06:35 |
| WiFi_Warri0r | Failed to open /var/lib/samba/secrets.tdb | 06:35 |
| WiFi_Warri0r | Failed to open /var/lib/samba/secrets.tdb | 06:35 |
| WiFi_Warri0r | Failed to open /var/lib/samba/secrets.tdb | 06:35 |
| WiFi_Warri0r | pdb_generate_sam_sid: Failed to store generated machine SID. | 06:35 |
| WiFi_Warri0r | smb_panic(): calling panic action [/usr/share/samba/panic-action 6780] | 06:35 |
| WiFi_Warri0r | /usr/share/samba/panic-action: line 48: mail: command not found | 06:35 |
| WiFi_Warri0r | smb_panic(): action returned status 127 | 06:35 |
| === Agent_bob is now known as yintelike | ||
| WiFi_Warri0r | PANIC: Could not generate a machine SID | 06:35 |
| WiFi_Warri0r | BACKTRACE: 6 stack frames: | 06:35 |
| WiFi_Warri0r | #0 smbpasswd(smb_panic2+0x79) [0x80ddb43] | 06:36 |
| WiFi_Warri0r | #1 smbpasswd(smb_panic+0x19) [0x80ddd40] | 06:36 |
| TTilus | [aJ] : you found it? | 06:36 |
| WiFi_Warri0r | #2 smbpasswd(get_global_sam_sid+0x287) [0x8076707] | 06:36 |
| WiFi_Warri0r | #3 smbpasswd(main+0x4fe) [0x806c8df] | 06:36 |
| WiFi_Warri0r | #4 /lib/tls/i686/cmov/libc.so.6(__libc_start_main+0xd2) [0xb7d58ec2] | 06:36 |
| TTilus | [aJ] : i did not | 06:36 |
| WiFi_Warri0r | #5 smbpasswd [0x806bf91] | 06:36 |
| WiFi_Warri0r | Aborted | 06:36 |
| WiFi_Warri0r | ?? | 06:36 |
| TTilus | [aJ] : tell me too! | 06:36 |
| eth0-noob | ? | 06:36 |
| WiFi_Warri0r | sorry if their is flooding rule | 06:36 |
| eth0-noob | hm | 06:36 |
| WiFi_Warri0r | :O | 06:36 |
| WiFi_Warri0r | forgot | 06:36 |
| eth0-noob | well | 06:36 |
| EABS | I hate doing this, but I'm having trouble even installing Ubuntu. It stalls at ACPI: Subsystem revision 20050729 | 06:36 |
| eth0-noob | i used a different client | 06:36 |
| eth0-noob | im in xfce | 06:36 |
| eth0-noob | its regular gui samba browser | 06:36 |
| kRaKoN | with "users" you can see the users connected on the bash, but how can you disconect an user ? | 06:36 |
| TTilus | WiFi_Warri0r: shame on you, try to remember next time | 06:36 |
| eth0-noob | WiFi_Warri0r your using gnome right? | 06:37 |
| WiFi_Warri0r | krakon: u want 2 disconnect remote user? | 06:37 |
| eth0-noob | hm | 06:37 |
| === simple1 [n=root@0-1pool90-6.nas23.houston4.tx.us.da.qwest.net] has joined #ubuntu | ||
| kRaKoN | Wifi_warri0r: that's it warrior how do i do it? | 06:37 |
| WiFi_Warri0r | eth0: im using whatever gets installed by default on breezy | 06:37 |
| WiFi_Warri0r | :\ | 06:37 |
| eth0-noob | ok :P | 06:37 |
| eth0-noob | hm | 06:37 |
| eth0-noob | hold on | 06:37 |
| eth0-noob | im going to get on gnome | 06:38 |
| eth0-noob | my comp is so slow.. | 06:38 |
| WiFi_Warri0r | ok | 06:38 |
| eth0-noob | ill see if it still works on gnoem | 06:38 |
| WiFi_Warri0r | thnx for ur help man i really appreciate it, hard to find people that will help out a newb | 06:38 |
| eth0-noob | ;p | 06:38 |
| eth0-noob | itsw cool | 06:38 |
| kRaKoN | that's what i want to do, to discconect a remote user from the console | 06:39 |
| eth0-noob | hold on i have to get on and off. | 06:39 |
| === eth0-noob [n=brian@adsl-69-152-160-49.dsl.okcyok.swbell.net] has joined #ubuntu | ||
| eth0-noob | hey | 06:39 |
| eth0-noob | back | 06:39 |
| WiFi_Warri0r | krakon: if i reme right ps -? some random switch with ps to kill the bash process | 06:39 |
| WiFi_Warri0r | but im not sure | 06:39 |
| WiFi_Warri0r | google! how to disconnect remote bash shell | 06:39 |
| WiFi_Warri0r | :) | 06:39 |
| simple1 | is there a correct way to remove alternatives ? | 06:39 |
| eth0-noob | hold on logging into gnome (takes about 5 - 10 min....) | 06:40 |
| WiFi_Warri0r | 5-10 minutes?! | 06:40 |
| kRaKoN | thanks a lot Wifi-warri0r: thanks a lot | 06:40 |
| WiFi_Warri0r | w0w | 06:40 |
| WiFi_Warri0r | o_0 | 06:40 |
| kRaKoN | google know everything | 06:40 |
| EABS | Anyone using the 64-bit edition? | 06:40 |
| === Davey [i=foobar@unaffiliated/davey] has joined #ubuntu | ||
| WiFi_Warri0r | krakon: no problem pal | 06:40 |
| narg | With wu-ftpd, a restricted user I have can do everything I want him to except list files (ls). No errors, nothing. Any ideas of what I did? | 06:40 |
| WiFi_Warri0r | EABS: they have 64 edition for ubuntu? | 06:40 |
| eth0-noob | google does know everything. | 06:41 |
| eth0-noob | lo | 06:41 |
| eth0-noob | lol | 06:41 |
| WiFi_Warri0r | google doesnt | 06:41 |
| WiFi_Warri0r | the internet does | 06:41 |
| WiFi_Warri0r | google just organizes it for ya | 06:41 |
| WiFi_Warri0r | lol | 06:41 |
| WiFi_Warri0r | ;) | 06:41 |
| narg | google is all knowing. It just denies knowledge to mortals when it sees fit. :) | 06:41 |
| simple1 | very poorly at that. | 06:41 |
| WiFi_Warri0r | well it doesnt organize it, it looks it up for ya | 06:42 |
| WiFi_Warri0r | better? | 06:42 |
| bitox | when is the new ubuntu release coming out?and will it have the latest Xorg 7 and gnome? | 06:42 |
| WiFi_Warri0r | when will ubuntu come prepackaged with gcc??? | 06:42 |
| WiFi_Warri0r | is what i wanna know | 06:42 |
| WiFi_Warri0r | lol | 06:42 |
| === ckasprzak [n=ckasprza@69-162-199-115.bflony.adelphia.net] has left #ubuntu [] | ||
| WiFi_Warri0r | i still cant figure out how to get gcc | 06:42 |
| WiFi_Warri0r | :/ | 06:42 |
| === ckasprzak [n=ckasprza@69-162-199-115.bflony.adelphia.net] has joined #ubuntu | ||
| === ckasprzak [n=ckasprza@69-162-199-115.bflony.adelphia.net] has left #ubuntu [] | ||
| _jason | WiFi_Warri0r: 'sudo aptitude install build-essential' | 06:43 |
| narg | WiFi_Warri0r: apt-get install build-essential | 06:43 |
| Dr_Willis | build-essential is the package | 06:43 |
| Dr_Willis | :P | 06:43 |
| eth0-noob | ok | 06:43 |
| eth0-noob | hey wifi | 06:43 |
| eth0-noob | ok | 06:43 |
| WiFi_Warri0r | thnx alot | 06:43 |
| Dr_Willis | and proberly other dev files you may need | 06:43 |
| eth0-noob | run ettercap | 06:43 |
| WiFi_Warri0r | brb | 06:43 |
| eth0-noob | unified sniffing, eth0 | 06:43 |
| === Crankeye [n=Admin@ip-69-10-100-214.cableaz.net] has joined #ubuntu | ||
| narg | what I want to know is why it isn't build-essentials. It should be plural :) | 06:43 |
| === born_ [n=born@20151236138.user.veloxzone.com.br] has left #ubuntu ["Ex-Chat"] | ||
| Dr_Willis | !info ettercap | 06:44 |
| ubotu | ettercap: (Multipurpose sniffer/interceptor/logger for switched LAN), section universe/net, is optional. Version: 1:0.7.3-1 (breezy), Packaged size: 164 kB, Installed size: 400 kB | 06:44 |
| Dr_Willis | its in the repos. | 06:44 |
| eth0-noob | scan for hosts (ctrl-s) and then go to hosts list | 06:44 |
| === honk|afk is now known as honkzilla | ||
| simple1 | yeah, but my exp with goog is, search returns 1.8 million, look at the first 20 or so. search again with diff words, returns same 1.8 million same order. search again, forget why you wanted to know...... get mad a google.... | 06:44 |
| eth0-noob | add your router ip to target one and your windows comp ip to second target | 06:44 |
| eth0-noob | go to mitm | 06:44 |
| eth0-noob | arp poisioning sniff remote connections | 06:44 |
| === julio [n=julio@user-0c6t7t0.cable.mindspring.com] has joined #ubuntu | ||
| eth0-noob | then go to plugins | 06:45 |
| Crankeye | hey hey guys | 06:45 |
| eth0-noob | smb_clear and smb_down | 06:45 |
| eth0-noob | then hit start sniffing | 06:45 |
| eth0-noob | then | 06:45 |
| Crankeye | i need to check my x output because my x keeps failing to start on boot | 06:45 |
| === Hobbsee_ [n=Hobbsee@ubuntu/member/hobbsee] has joined #ubuntu | ||
| eth0-noob | run | 06:45 |
| Crankeye | for some reason it crashes only on boot | 06:45 |
| kRaKoN | anyway i cannot imagine life without google ;) | 06:45 |
| eth0-noob | sudo nautilus network: | 06:45 |
| Crankeye | if i run sudo /etc/init.d/gdm restart | 06:46 |
| julio | hi | 06:46 |
| eth0-noob | and walla | 06:46 |
| Crankeye | its works just fine | 06:46 |
| eth0-noob | you have access to shared files on windows | 06:46 |
| === phrizer [n=lance@60-234-134-230.bitstream.orcon.net.nz] has joined #Ubuntu | ||
| === freeflying-ibook [n=freeflyi@61.190.65.15] has joined #ubuntu | ||
| eth0-noob | but you cant copy them (or i cant anyways) | 06:46 |
| eth0-noob | hopefull this works for you. | 06:46 |
| Crankeye | ethercap is fun heh | 06:46 |
| Crankeye | but yeah anyone have any clue why why x crashes only at startup | 06:47 |
| simple1 | Crankeye less /var/log/messages and less /var/log/x<tab_key> have a look at the logs. | 06:47 |
| Crankeye | ahh thanks | 06:47 |
| Crankeye | funny thing is i can restart gdm from the command line and be just fine | 06:47 |
| Crankeye | >_>;; | 06:48 |
| === x86-64 [n=me@cpe-24-27-59-232.austin.res.rr.com] has joined #ubuntu | ||
| x86-64 | hi I'm running osx on my powerbook at the moment, but I installed Ubuntu 5.10 and I'm having a problem... when I log into Gnome, all I get is that brown background for the human theme... sits there at least 5, if not 10 minutes, with no signs of activity (visual or auditory)... any ideas on why this is? | 06:48 |
| === nalioth_zZz is now known as nalioth | ||
| === Hobbsee_ is now known as Hobbsee | ||
| === lvi [n=levi@S0106000f66f29b72.vc.shawcable.net] has joined #ubuntu | ||
| === matthinckley [n=matthinc@24-117-13-215.cpe.cableone.net] has joined #ubuntu | ||
| === matthinckley [n=matthinc@24-117-13-215.cpe.cableone.net] has left #ubuntu ["Leaving"] | ||
| Crankeye | im checking my /var/log/messages and i dont see anything about crashing | 06:50 |
| Crankeye | :/ | 06:50 |
| Crankeye | upon closer inspection: Mar 29 21:40:36 localhost gdm[6791] : Failed to start X server several times in a short time period; disabling display : | 06:50 |
| WiFi_Warri0r | thnx alot for whoever told me how to get gcc!!!!!!!! | 06:50 |
| === michael [n=michael@ool-45740794.dyn.optonline.net] has joined #ubuntu | ||
| simple1 | !b-e | 06:51 |
| ubotu | [b-e] no make ? you need build-essential or if you get errors saying gcc cannot create executables, or that you can't find header files like stdio.h, you need to do a sudo apt-get install build-essential. | 06:51 |
| Sionide | WiFi_Warri0r, build-essential ? yeah.. fun stuff | 06:51 |
| Crankeye | maybe i should consult google | 06:51 |
| DBO | does anyone else have a clock applet that leaks memory like it is going out of style (in GNOME) | 06:51 |
| simple1 | Crankeye check the x logs too like i first said | 06:52 |
| === MrPockets [n=alex@CPE-69-23-87-53.new.res.rr.com] has joined #ubuntu | ||
| WiFi_Warri0r | what does that command mean tho? | 06:52 |
| WiFi_Warri0r | i mean i did it, but i dont understan what i did | 06:53 |
| WiFi_Warri0r | :\ | 06:53 |
| Crankeye | hmmm i might of missed it one sec | 06:53 |
| WiFi_Warri0r | it doesnt help me if i dont understsand what im doin | 06:53 |
| Crankeye | ah ok well i seem to have found part of the error in my /var/log/syslog | 06:53 |
| Crankeye | Mar 29 21:40:03 localhost gdm[7005] : gdm_slave_xioerror_handler: Fatal X error - Restarting :0 | 06:53 |
| === vvlaw_ [n=vvlaw@59.56.246.69] has joined #ubuntu | ||
| simple1 | WiFi_Warri0r b-e is a meta package (empty package) that depends on every thing that you need to compile 'most' things. | 06:54 |
| === bobyfixer [n=boby@85.139.113.222] has joined #ubuntu | ||
| vvlaw_ | anybody knows that how to set the config when i could not into the X window ? | 06:54 |
| WiFi_Warri0r | roy@ubuntu:~$ apt-get install build-essential | 06:54 |
| WiFi_Warri0r | E: Could not open lock file /var/lib/apt/lists/lock - open (13 Permission denied) | 06:54 |
| WiFi_Warri0r | E: Unable to lock the list directory | 06:54 |
| WiFi_Warri0r | ?? | 06:54 |
| bimberi | WiFi_Warri0r: build-essential has a number of dependencies including libraries and compilers. When you install it those things are installed with it. | 06:54 |
| bimberi | WiFi_Warri0r: sudo apt-get.... | 06:55 |
| WiFi_Warri0r | i already did that one | 06:55 |
| WiFi_Warri0r | it completed | 06:55 |
| WiFi_Warri0r | ;/ | 06:55 |
| simple1 | WiFi_Warri0r sudo. also make sure that synaptic or aptitude are not running. | 06:55 |
| WiFi_Warri0r | so gcc is installed now? | 06:55 |
| === mendred [n=mendred@59.92.57.186] has joined #ubuntu | ||
| vvlaw_ | no body knows ? | 06:55 |
| simple1 | if you installed b-e then you have gcc. WiFi_Warri0r gcc --version | 06:55 |
| bimberi | WiFi_Warri0r: if build-essential has installed successfully then yes | 06:56 |
| Crankeye | simplel i cant find the x<tab> file but i did find Xorg.0.log is this correct? | 06:56 |
| WiFi_Warri0r | kk checking | 06:56 |
| === bobyfixer is now known as VOicePrint | ||
| Dr_Willis | WiFi_Warri0r, try gcc --version | 06:56 |
| Dr_Willis | :P | 06:56 |
| WiFi_Warri0r | !! TY !! | 06:56 |
| ubotu | Huh? Try searching at http://ubuntu.cc.com.au/, WiFi_Warri0r | 06:56 |
| === VOicePrint is now known as VOIcePrint | ||
| WiFi_Warri0r | gcc 4.0.2 ? it worke!! | 06:56 |
| WiFi_Warri0r | thnx for the help with that | 06:56 |
| WiFi_Warri0r | im starting to like linux, i needa go buy a book anbd learn the commands tho | 06:56 |
| === Eleaf [n=ethan@71-208-126-224.hlrn.qwest.net] has joined #ubuntu | ||
| WiFi_Warri0r | :/ | 06:56 |
| Eleaf | help help! | 06:56 |
| === freeflying_ [n=freeflyi@61.190.65.15] has joined #ubuntu | ||
| carthik | ask ask! | 06:57 |
| simple1 | vvlaw_ i don't really understand your question. if you are asking how to configure xorg form the console. sudo dpkg-reconfigure xserver-xorg | 06:57 |
| carthik | :) | 06:57 |
| === Hobbsee is now known as Hobbsee_away | ||
| Eleaf | I've just been ddos'd | 06:57 |
| === jessy_ [n=jessy@4va54-1-81-56-98-29.fbx.proxad.net] has joined #ubuntu | ||
| Eleaf | o.O | 06:57 |
| WiFi_Warri0r | o_0 | 06:57 |
| Crankeye | hmm | 06:57 |
| Eleaf | O_o | 06:57 |
| === nightbeing86 [n=nightbei@212.117.85.164] has joined #ubuntu | ||
| Crankeye | why would someone target you.. | 06:57 |
| me2win | Eleaf, it was me... | 06:58 |
| Eleaf | what do I do to prosecute this person? | 06:58 |
| Eleaf | lol | 06:58 |
| WiFi_Warri0r | lol | 06:58 |
| === vipaca [n=x@165.95.46.55] has joined #ubuntu | ||
| carthik | Eleaf, "have you tried restarting the machine in question?" lol | 06:58 |
| Eleaf | This guy messages me, and he starts harrasing me "kinda" | 06:58 |
| Eleaf | then says if you don't tell me something I'll ddos you | 06:58 |
| === niki [n=juztin@68-184-136-55.dhcp.stbr.ga.charter.com] has joined #ubuntu | ||
| Crankeye | are you sure he ddosed you or jsut dosed | 06:58 |
| Crankeye | dd = distribute denial | 06:58 |
| jbroome | Eleaf: if you're on the net right now, it's a pretty weak dos | 06:58 |
| Eleaf | then my internet went down, I saw all the bandwidth was taken up. | 06:58 |
| Crankeye | d = just plain denial | 06:58 |
| Eleaf | jbroome, I think it stopped.. | 06:58 |
| Eleaf | hold on. | 06:59 |
| Eleaf | well I couldn't ping ;) | 06:59 |
| simple1 | DoS=denial of service | 06:59 |
| Crankeye | you would be lagged out right now | 06:59 |
| Eleaf | I know | 06:59 |
| Eleaf | I did when it started | 06:59 |
| vipaca | I need a howto on getting tomcat going on my Ubuntu box. | 06:59 |
| vipaca | Can someone give me a link? | 06:59 |
| Eleaf | Irc started to lag, then I couldn't ping or do anything. | 06:59 |
| Eleaf | All withen seconds! lol | 06:59 |
| Eleaf | simple1, what is ddos then? | 07:00 |
| simple1 | vipaca man tomcat | 07:00 |
| nalioth | Eleaf: this is the incorrect forum for that | 07:00 |
| Eleaf | I don't know where else to go | 07:00 |
| Eleaf | I thought you guys were so nice you could help me. | 07:00 |
| Eleaf | (And I'm running Ubuntu!) | 07:00 |
| vipaca | no man on tomcat | 07:00 |
| nalioth | Eleaf: join #ubuntu-offtopic to start | 07:01 |
| Crankeye | DDoS = Distrubted Denial Of Service | 07:01 |
| vipaca | apt-get install tomcat does nothing either | 07:01 |
| DBO | DDoS = Distributed Denial of Service | 07:01 |
| === Griver [n=Griver@81-231-250-204-no52.tbcn.telia.com] has joined #ubuntu | ||
| DBO | doh | 07:01 |
| Eleaf | nalioth, sorry | 07:01 |
| simple1 | Eleaf maybe someone in #ubuntu-offtopic | 07:01 |
| Crankeye | basically more than one computers are hitting you with packets | 07:01 |
| === nemitz [n=fc@d47-69-136-102.try.wideopenwest.com] has joined #ubuntu | ||
| Eleaf | Crankeye, ye ye. | 07:01 |
| === nemitz [n=fc@d47-69-136-102.try.wideopenwest.com] has left #ubuntu [] | ||
| === weo [n=weo@p5499C387.dip0.t-ipconnect.de] has joined #ubuntu | ||
| Crankeye | alright simplel im checkin my x and ill i get are a few warndins | 07:01 |
| === dre| [i=hydro@zarf.moxiehosting.com] has left #ubuntu [] | ||
| Crankeye | Warning: font renderer for ".pcf" already registered at priority 0 | 07:02 |
| Crankeye | Warning: font renderer for ".pcf.Z" already registered at priority 0 | 07:02 |
| Crankeye | could these maybe be the problem...? | 07:02 |
| carthik | vipaca, http://www.google.com/search?q=tomcat+on+ubuntu | 07:02 |
| === sH4 [n=foo@220.91.193.198] has joined #ubuntu | ||
| carthik | vipaca, dunno which of the results is closest to what you are looking for, but there are answers out there | 07:02 |
| vipaca | Yeah I used google to search this topic | 07:02 |
| vipaca | these links are no good | 07:03 |
| vipaca | no installatio information | 07:03 |
| kuja | My "Print Screen" button doesn't take a screenshot anymore :P | 07:03 |
| vipaca | that why I'm here | 07:03 |
| Dr_Willis | kuja, egads! the Horror! | 07:03 |
| Dr_Willis | :P | 07:03 |
| vipaca | I followed those links | 07:04 |
| kuja | I'm trying to get a screenie of compiz in action, but it'd be faster if the button would work -_- | 07:04 |
| carthik | kuja, you might have to setup a keybinding to do that, then | 07:04 |
| === tenshiKur0 [n=tenshiKu@24.84.47.187] has joined #ubuntu | ||
| vipaca | how do I search the repository | 07:04 |
| === caglar__ [n=caglar@dslb-084-056-084-009.pools.arcor-ip.net] has joined #ubuntu | ||
| simple1 | vipaca tomcat doesn't seem to be supported by ubuntu at all. | 07:04 |
| kuja | vipaca: apt-cache search <term> | 07:04 |
| vipaca | that does seem to be the case | 07:04 |
| simple1 | vipaca apt-cache search <blah> | 07:04 |
| carthik | kuja -> system->pref->keyboard shortcuts | 07:04 |
| kuja | carthik: Thank you | 07:04 |
| === Hobbsee_away is now known as Hobbsee | ||
| === harisund [n=harisund@ip24-255-87-152.br.br.cox.net] has joined #ubuntu | ||
| === BlueDevil [n=mircea@81.196.151.21] has joined #ubuntu | ||
| kuja | carthik: Apparently it's already set to that key. | 07:06 |
| x86-64 | anyone here know if there's any reported bugs/issues with ubuntu 5.10 and loading gnome 2.12? | 07:06 |
| simple1 | kuja i'm lagging just a little, it's uncanny; we typed almost the same thing... :) | 07:06 |
| kuja | =) | 07:06 |
| kuja | simple1: print screen key not working on compiz? | 07:07 |
| vipaca | I got it apt-get libapache2-mod-jk2 | 07:07 |
| simple1 | kuja might in a gui ? | 07:07 |
| simple1 | it seems to be sys-rq in cli | 07:07 |
| carthik | x86-64, have you tried looking at the error logs for x, gdm etc? | 07:08 |
| simple1 | s/cli/console/ | 07:08 |
| carthik | x86-64, they must be in /var/log/ | 07:08 |
| === Blippe [n=henryson@1-1-11-41a.f.sth.bostream.se] has joined #ubuntu | ||
| x86-64 | carthik: nope, not as of yet, but I will now :) | 07:08 |
| x86-64 | thanks | 07:08 |
| carthik | x86-64, try starting x using startx from a console terminal and see what you get by way of info regarding why it does not start properly | 07:08 |
| x86-64 | ok, kewl | 07:09 |
| === harisund [n=harisund@ip24-255-87-152.br.br.cox.net] has left #ubuntu ["Leaving"] | ||
| === nalioth is now known as nalioth_zZz | ||
| === harisund [n=harisund@ip24-255-87-152.br.br.cox.net] has joined #ubuntu | ||
| carthik | x86-64, of course, it is entirely possible that it is just the panels that are not starting up fine, if the problem is that gnome does not start | 07:09 |
| simple1 | -:- SignOff x86-64: #ubuntu ("Leaving" | 07:09 |
| carthik | does not seem to start, that is | 07:10 |
| === seth is now known as seth|away | ||
| === harisund is now known as HariS | ||
| === HariS is now known as harisund | ||
| harisund | How do you mount a CD ROM so that programs on the CD rom can be executed? | 07:11 |
| === harisund [n=harisund@ip24-255-87-152.br.br.cox.net] has joined #ubuntu | ||
| Crankeye | well i think i found the problem | 07:12 |
| simple1 | harisund mount /dev/<cdrom_inode> /<mountpoint> -o exec ? | 07:12 |
| Crankeye | if anyone has the smae problem tell them to add Option "NvAGP" "0" to there xorg.conf | 07:12 |
| === solo [n=solo@S0106001310249b85.vc.shawcable.net] has joined #ubuntu | ||
| === solo [n=solo@S0106001310249b85.vc.shawcable.net] has joined #ubuntu | ||
| simple1 | !nvidia | 07:12 |
| ubotu | hmm... nvidia is at https://wiki.ubuntu.com/BinaryDriverHowto/Nvidia or http://ubuntuforums.org/showthread.php?t=57368 | 07:13 |
| simple1 | you could check ^ there and if needed update it. | 07:13 |
| solo | any one know how to install driver for wireless adapter zd1211? | 07:13 |
| simple1 | !wifi | 07:13 |
| ubotu | from memory, wifi is https://wiki.ubuntu.com/WiFiHowto | 07:13 |
| simple1 | check that solo ^ | 07:14 |
| solo | right | 07:14 |
| === juan [n=juan@host48.201-252-191.telecom.net.ar] has joined #ubuntu | ||
| === blrich [n=blrich@c220-239-8-98.belrs4.nsw.optusnet.com.au] has joined #ubuntu | ||
| === freeflying-ibook [n=freeflyi@61.190.65.15] has joined #ubuntu | ||
| === Spudchat [n=Spud@adsl-68-74-146-215.dsl.emhril.ameritech.net] has joined #ubuntu | ||
| Se7h | irc is all very quite | 07:15 |
| === sandyeggoboy [n=chatzill@pdpc/supporter/basic/sandyeggoboy] has joined #ubuntu | ||
| blrich | can someone tell me what the abi-<kernelversion> files are in /boot/? | 07:15 |
| === jerware [n=jerware@156.12.172.88] has joined #ubuntu | ||
| crimsun | blrich: they're indicators of the versions of exported symbols | 07:16 |
| === dereks__ [n=derekS@cpe-66-108-44-139.nyc.res.rr.com] has joined #ubuntu | ||
| simple1 | it's of passing interest, concerning the former conversation; a DoS attack can at most push me off line, because of the speed of my dialup connection compared to the system speed.... | 07:17 |
| === kakalto [n=kakalto@wired-210-54-56-47.ps.net.nz] has joined #ubuntu | ||
| crimsun | blrich: when any change, the abi is increased | 07:17 |
| simple1 | i guess a fast inet connection has it's draw-backs after all. | 07:17 |
| === simple1 is now known as intelikey | ||
| blrich | crimsun, so the addresses of symbols in the kernel abi are exported into a list in the abi- files? | 07:19 |
| === FallenHitokiri [n=blitz@p54ACE135.dip.t-dialin.net] has joined #ubuntu | ||
| === liddan [n=liddan@ua-83-227-135-153.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| crimsun | blrich: essentially. | 07:19 |
| === Klowner_ [n=klown@porky118.revealed.net] has joined #ubuntu | ||
| blrich | crimsun, what's the point, are they going to make a dynamic interface to the kernel or is the production of those files just part of the kernel build process? | 07:19 |
| === Spudchat [n=Spud@adsl-68-74-146-215.dsl.emhril.ameritech.net] has left #ubuntu [] | ||
| LathropWells | users | 07:20 |
| === phr023n [n=phr023n@219.95.99.246] has joined #ubuntu | ||
| crimsun | blrich: the latter. They're used to determine if an abi bump is necessary for packaging. | 07:20 |
| LathropWells | :x | 07:20 |
| === Tadej`Certanc [n=universe@infinity.unixrulz.net] has joined #ubuntu | ||
| intelikey | /users | 07:20 |
| === dextro_dude [n=raja@60.51.38.113] has joined #ubuntu | ||
| intelikey | all 612 of us.... | 07:21 |
| LathropWells | trying to show what processes are opened by each user. | 07:21 |
| === Crankeye [n=Admin@ip-69-10-100-214.cableaz.net] has joined #ubuntu | ||
| intelikey | fuser | 07:21 |
| === newbie [n=tagabasa@58.69.221.195] has joined #ubuntu | ||
| === harisund [n=harisund@ip24-255-87-152.br.br.cox.net] has joined #ubuntu | ||
| Crankeye | well bad news adding that line to my xconf did absolutley nothing | 07:21 |
| newbie | hi guys | 07:21 |
| LathropWells | Ah - nice. - Thanks. :) | 07:21 |
| Crankeye | hey | 07:21 |
| newbie | can anyone here help me upgrading my gimp? | 07:22 |
| blrich | crimsun, ah, clever | 07:22 |
| blrich | crimsun, so is that something the ubuntu team have done, or is it part of the normal kernel build scripts? | 07:22 |
| harisund | hello people, I was just wondering what fps as reported by glxgears could be considered 'decent' enough? | 07:22 |
| crimsun | blrich: Ubuntu's kernel team | 07:22 |
| intelikey | LathropWells also of note man ps | 07:22 |
| blrich | crimsun, this ABI is what everyone is talking about when they say 'linux has no stable driver ABI', i'm assuming | 07:22 |
| crimsun | blrich: no, completely independent of that discussion | 07:23 |
| === GNU_Style [n=GNU@203.177.205.199] has joined #ubuntu | ||
| blrich | crimsun, so the kernel and driver ABI's are separate? | 07:23 |
| crimsun | blrich: the acronym ABI as used here is a red herring | 07:23 |
| kRaKoN | I want to mount my palm on /dev/pilot .. is the command: sudo mount -t ??? /dev/ttyUSB1 /dev/pilot | 07:23 |
| kRaKoN | .. ? is that right? what should i write instead of " ??? " | 07:23 |
| crimsun | blrich: here it simply marks any change in exported symbols | 07:23 |
| Crankeye | k well if anyone knows anything heres my problem still: x crashes (gdm) crashes on startup i can restart it and go about my buiness | 07:24 |
| harisund | hello people, I was just wondering what fps as reported by glxgears could be considered 'decent' enough? | 07:24 |
| Crankeye | my xorg log shows Warning: font renderer for ".pcf.gz" already registered at priority 0 | 07:24 |
| === theBishop [n=mike@cpe-24-193-239-113.ucwphilly.res.rr.com] has joined #ubuntu | ||
| intelikey | mount something ON /dev/* bad idea. you mount the devices in /dev/ on /mnt/* | 07:24 |
| theBishop | has anyone been able to get BCM43xx wireless drivers working? | 07:24 |
| blrich | crimsun, okay, but those changes reflect changes in the actual ABI, which is the kernel... binary? the thing which object-code from binary drivers must compile against? | 07:25 |
| === concept10 [n=concept1@c-67-166-167-125.hsd1.tx.comcast.net] has joined #ubuntu | ||
| harisund | theBishop, if you are talking about Dapper, I believe they work out of the box, but in Breezy you might have to use ndiswrapper.. | 07:25 |
| Crankeye | how do you check your fps with glxgeras | 07:25 |
| Crankeye | >_> | 07:25 |
| theBishop | Harisund: nope, not out of the box | 07:25 |
| blrich | crimsun, sorry for so many questions but i'm trying to research this topic at the moment and finding information about it is almost impossible | 07:25 |
| === Hoxzer [n=niko@a80-186-169-248.elisa-laajakaista.fi] has joined #ubuntu | ||
| harisund | Crankeye glxgears -printfps | 07:25 |
| kRaKoN | intelikey but to sincronize with jpilot is must be there doesn't it? let me see | 07:25 |
| Crankeye | thanks | 07:25 |
| crimsun | blrich: no, they mark possible shifts in order/address, which is not the same as the API as used upstream by vendors/developers | 07:25 |
| harisund | Crankeye, this opens up a window, on which you see moving gears.. and in the terminal that you used it prints out fps every 5 seconds. | 07:25 |
| crimsun | s/API/ABI/ | 07:25 |
| theBishop | harisund, i've tried using the firmware cutter, and i got the fw files in /lib/firmware | 07:26 |
| === TecnoVM64 [n=tecnovm@unaffiliated/tecnovm64] has joined #ubuntu | ||
| Crankeye | thanks | 07:26 |
| Crankeye | im getting about 185 | 07:26 |
| Crankeye | nwo its jumped to 251 | 07:26 |
| === Khisanth [n=Khisanth@pool-71-247-81-57.nycmny.east.verizon.net] has joined #ubuntu | ||
| harisund | Crankeye, I believe that is low.. | 07:26 |
| Crankeye | ahahhaahha | 07:26 |
| === Syntux [n=Jad@213.186.178.5] has joined #ubuntu | ||
| Crankeye | i have a vanta 16 mb card | 07:26 |
| intelikey | kRaKoN well maybe, i think if that is the case the code monkeys messed that one up tho. | 07:26 |
| harisund | Crankeye, here's the funny part, use the terminal window to cover the gears .. so that you can't see the gears directly | 07:26 |
| harisund | The terminal window should be on top of the gear's window, do you see what I am saying? | 07:27 |
| Crankeye | ahuh | 07:27 |
| kRaKoN | intelikey but what should i write instead of the " ??? " is a ntfs a fat32 what should i write there? | 07:27 |
| harisund | Crankeye, did you see it increase any bit? | 07:27 |
| Crankeye | yeah haha | 07:27 |
| intelikey | if it's ntfs use -t ntfs if it's fat32 use -t vfat | 07:28 |
| harisund | quiet funny, don't know what that happens.. | 07:28 |
| Crankeye | maybe because its not paintign to the screen | 07:28 |
| Crankeye | faster to update nothing | 07:28 |
| Crankeye | :D | 07:28 |
| kRaKoN | intelikey it is a palm pilot... | 07:28 |
| harisund | Yep, that's what I think too.. when painting on the screen, I get around 70mbps and around 1500 fps when it's not on the screen, | 07:28 |
| intelikey | kRaKoN try without a -t and see if mount can auto-detect the type | 07:29 |
| harisund | I think you are right through (Crankeye) | 07:29 |
| blrich | crimsun, okay, so: the kernel version changes, it gets compiled, this alters the ABI, differences between previous addresses and current addresses of various symbols in the kernel are recorded in the appropriate abi- file, this is used to check if binary drivers need recompiling? | 07:29 |
| harisund | I mean, 700 fps | 07:29 |
| kRaKoN | intelikey okah thanks brother | 07:29 |
| === pierre- [n=pierre@ip73.168.adsl.wplus.ru] has joined #ubuntu | ||
| Crankeye | it would make sense.. i mean its only updating what going and it doesnt have to update the picture | 07:29 |
| carpediem | Anyone having problems with Dapper swallowing the CTRL key? I've searched, but I'm not finding anything. It was fine in Breezy. | 07:29 |
| blrich | crimsun, when you say 'exported symbols', i'm assuming you mean symbols in the resulting exported binary, the kernel? or something else? | 07:29 |
| Crankeye | but i dont excatly know what im talking about, just inferring | 07:30 |
| harisund | Right, so probably it calculates the fps in the background, which means the update rate is faster.. | 07:30 |
| crimsun | blrich: you mean "the exported symbols change, their values get dumped into an abi-$(uname -r) file, ..." | 07:30 |
| === kuja [n=kuja@unaffiliated/kuja] has joined #ubuntu | ||
| Crankeye | yeah that would make sense | 07:30 |
| harisund | cool.. nice meeting ya.. got to go.. | 07:30 |
| intelikey | carpediem the "left" ctrl or both ? | 07:30 |
| === Xnos [n=marco@201.137.170.123] has joined #ubuntu | ||
| crimsun | blrich: yes, changes to the symbol table, which mean a bump in the abi marker of Ubuntu's kernel | 07:30 |
| Crankeye | yeah you too | 07:30 |
| === Deserir [i=greeny@226gis182.gulftel.com] has joined #ubuntu | ||
| Crankeye | seeyah | 07:30 |
| carpediem | intelikey: it appears to be both | 07:30 |
| blrich | crimsun, okay thankyou for all this information, i think i'm beginning to understand more | 07:31 |
| carpediem | intelikey: CTRL-C/CTRL-V work fine, but everything else is just swallowed. | 07:31 |
| carpediem | intelikey: including CTRL-ALT-F1 etc....which really kills me. | 07:31 |
| intelikey | carpediem it's common for linux systems to not react like you would expect, to the right alt and ctrl keys but normally the left ones work as expected. | 07:31 |
| Crankeye | hmm brb | 07:31 |
| carpediem | intelikey: I've been using Linux for three years....I'm more familiar with its key setup than anything else...this is abnormal, to say the least. | 07:32 |
| === niki [n=juztin@68-184-136-55.dhcp.stbr.ga.charter.com] has joined #ubuntu | ||
| intelikey | carpediem yes. if you can't drop to console, IT JUST AINT LINUX ! | 07:32 |
| carpediem | intelikey: I can't even CTRL-ALT-Backspace in emergencies. | 07:33 |
| blrich | crimsun, so then: when we talk ABI, how many of them are there? there is an API for developers to writer drivers for the kernel - this doesn't change much i'm assuming. but the ABI represents the addresses of various function insertion points in the... kernel binary? is the driver abi related to the "kernel abi" whatever that might be? what ABI must drivers compile against, are we talking the kernel binary, a library, an object f | 07:33 |
| blrich | ile...? sorry if i seem unbelievably stupid, i'm just trying to get this straight in my mind | 07:33 |
| carpediem | Hobbsee probably tried CTRL-ALT-Backspace. ;) | 07:33 |
| intelikey | carpediem file a priority 1 bug on that and run for your life...... | 07:33 |
| === triceratops [n=tricerat@dyndsl-085-016-009-103.ewe-ip-backbone.de] has joined #ubuntu | ||
| carpediem | intelikey: yeah, I think I need to....I was hoping it was known, but doesn't sound like it. | 07:34 |
| dextro_dude | ubuntu rocks ppl. | 07:34 |
| kakalto | ^-^ | 07:34 |
| niki | dextro_dude, sure does :D | 07:34 |
| === xnull- is now known as xnull | ||
| carpediem | ubuntu rocks as long as your rock isn't in mp3 format. <eg> | 07:35 |
| === Griver [n=Griver@81-231-250-204-no52.tbcn.telia.com] has joined #ubuntu | ||
| dextro_dude | any idea which is the most lightest window manager other than fluxbox ? | 07:35 |
| kakalto | carpediem, why do you say that? | 07:35 |
| niki | i have no problem with mp3's :P | 07:36 |
| crimsun | blrich: the kernel API is _supposed_ to be stable, but it isn't. External drivers are compiled against the API. The ABI denotes an exported interface for binary-only modules. This is akin to the ABI that's used to determine whether Ubuntu's abi # [which is purely for packaging reasons] needs a bump. | 07:36 |
| carpediem | kakalto: It's a joke about mp3s not working out of the box. | 07:36 |
| triceratops | Any idea where i wll find a binary of gnome dhcpd (packet gdhcpd) for breezy? | 07:36 |
| kakalto | raight, out of the box :) | 07:36 |
| newbie | how can i upgrade gimp on ubuntu? | 07:36 |
| carpediem | dextro_dude: any of the boxes are light. XFCE is pretty light. | 07:36 |
| kakalto | carpediem, hehe, I assume nothing works by default :P | 07:36 |
| niki | dextro_dude, i like blackbox | 07:36 |
| kakalto | carpediem, windows doesn't even detect my sound card. | 07:36 |
| triceratops | newbie: may I ask which gimp and which ubuntu version | 07:37 |
| intelikey | hmm i got to playing around in 'nome and found another reason i didn't like gnome-terminal as well as konsole. it seems that g-t has followed suit with screen on switching tabs it's [alt] +[#] i never learned to like that. | 07:37 |
| kakalto | dextro_dude, there's quite a few box's, isn't there | 07:37 |
| kakalto | blackbox, fluxbox | 07:37 |
| dextro_dude | hmm. yet to try it. i'll try it 2nite. even flux is lagging on my PII system | 07:37 |
| blrich | crimsun, ah, cool, okay starting to see the picture | 07:37 |
| === rgck [n=rgck@66.220.31.222] has joined #ubuntu | ||
| carpediem | intelikey: CTRL-Alt-Left and CTRL-Alt-Right still work. | 07:37 |
| kakalto | dextro_dude, wow, what's the gfx card like? | 07:37 |
| niki | dextro_dude, is it a laptop? | 07:38 |
| intelikey | kakalto icewm nice and light. | 07:38 |
| dextro_dude | blackbox and fluxbox are identical rite ? | 07:38 |
| === Paralla1 [i=hidden-u@206.107.251.214] has joined #ubuntu | ||
| niki | dextro_dude, not identical, no | 07:38 |
| Paralla1 | Can I get a quick bit of help from someone? | 07:38 |
| newbie | triceratops, i mean gimp image editor on ubuntu 5.10 | 07:38 |
| carpediem | intelikey: sorry, I meant CTRL-ALT-PageUp /PageDown. For gnome terminal tabs. | 07:38 |
| intelikey | fvwm / twm ultra light | 07:39 |
| === jonatan [n=jonatan@208.Red-80-37-254.staticIP.rima-tde.net] has joined #ubuntu | ||
| kakalto | dextro_dude, my p2 handles gnome, albeit with a little struggle, and a decent (of its time) pci gfx card | 07:39 |
| newbie | triceratops, is there a way that i can update it? | 07:39 |
| kakalto | intelikey, doesn't twm come with x? | 07:39 |
| Paralla1 | Is there a terminal/root/sudo command to view usernames on the system? | 07:39 |
| blrich | crimsun, so then concerning only binary drivers: these compile against an "exported interface for binary modules". is this interface a library, an object file, the kernel binary itself, or part of the kernel binary? since all binary modules seem to need to compile against a kernel source tree, i'm assuming it's some sort of object file that disappears when you remove the source tree? | 07:39 |
| === Paralla1 is now known as Nat1 | ||
| dextro_dude | my gfx is ATI Rage II 4mb on AGP. | 07:39 |
| intelikey | <carpediem> intelikey: CTRL-Alt-Left and CTRL-Alt-Right <-- hehhe that's konsole :) | 07:39 |
| triceratops | newbie: Ok, ubuntu breezy. And which gimp version would you like to upgrade? (From which installed one which new one) | 07:40 |
| === Nat1 is now known as Paralla1 | ||
| intelikey | err actually just alt >< | 07:40 |
| carpediem | intelikey: Edit > Keyboard Shortcuts | 07:40 |
| niki | Paralla1, users wil list users that are logged on | 07:40 |
| === Francisco [n=fromeroc@201.154.2.254] has joined #ubuntu | ||
| intelikey | or not install 'nome :) | 07:40 |
| === Phlosten [n=Me@58.166.77.3] has joined #ubuntu | ||
| niki | i think... | 07:40 |
| === darnell [n=darnell@dsl254-014-076.sea1.dsl.speakeasy.net] has joined #ubuntu | ||
| === GNU_Style2 [n=GNU@203.177.164.80] has joined #ubuntu | ||
| Paralla1 | Thanks Niki. The problem is that I'm at the GUI login and I need a common user name, being that the root is disabled. | 07:41 |
| triceratops | newbie: If you want to have a regular breezy update it may be done via synaptic. | 07:41 |
| intelikey | niki who or w | 07:41 |
| dextro_dude | lemme google out all the wm out there .. maybe i'll find a good one. ;) | 07:41 |
| darnell | !w32codecs | 07:41 |
| newbie | triceratops, i want to upgrade it to 2.2.10, coz the one that i have is gimp 2.2 | 07:41 |
| ubotu | w32codecs is probably a compilation of binary win32 A/V codecs for many popular proprietary formats not currently supported by free implementations under linux. See http://tinyurl.com/e4a5s to install | 07:41 |
| === Crankeye [n=Admin@ip-69-10-100-214.cableaz.net] has joined #ubuntu | ||
| Francisco | I want to know whic one is the better browser for to use.." | 07:41 |
| niki | intelikey, thanks, thats the one i was trying to remember :P | 07:41 |
| Crankeye | anyone offhand know how to reset the wine configuration, i cant get my winecfg to run even lol | 07:41 |
| dextro_dude | Francisco : use firefox | 07:41 |
| carpediem | intelikey: that's your choice...I prefer gnome, but I understand why some people like KDE. Everyone is different. But, you can configure gnome-terminal's keyboard shortcuts to match your preference if you so desire. | 07:41 |
| kakalto | why is ubotu so unsure of things? | 07:41 |
| === a8523 [n=a8523@81.175.5.65] has joined #ubuntu | ||
| kakalto | "...probably..." | 07:42 |
| niki | ubotu rocks | 07:42 |
| ubotu | niki: I haven't a clue, try searching at http://ubuntu.cc.com.au/ | 07:42 |
| niki | lol | 07:42 |
| Francisco | dextro_dude, I want to suppor java like explorer for yahoo." | 07:42 |
| kakalto | niki xD | 07:42 |
| Paralla1 | Anybody know how I can retrieve a non-root username from the command line? | 07:42 |
| Crankeye | i am without knowledge to where the wine configuation file is >_>; | 07:43 |
| Dr_Willis | retrieve ? | 07:43 |
| === eduardo :) | ||
| dextro_dude | Paralla1 : just save the trouble and reset it for ur user. | 07:43 |
| Dr_Willis | look in the /homes/ dir and see aht users are there? | 07:43 |
| === mahmud [n=mahmud@202.81.60.98] has joined #ubuntu | ||
| triceratops | newbie: The latest gimp in breezy is 2.2.8. May be there is a backport of 2.2.10 somwhere out there in the wild. But you have to be aware that using backports may cause trouble in the long run. | 07:43 |
| Paralla1 | Thanks, Dr_Wills. | 07:43 |
| kakalto | Crankeye, depends which version... recent wines don't have a specific file, I believe, it just has 'winecfg' as a configuration tool | 07:43 |
| mahmud | helo | 07:43 |
| Dr_Willis | or did you mean a non-root users password? | 07:43 |
| mahmud | i'm trying to instal dosemu | 07:43 |
| kakalto | mahmud, helo! | 07:43 |
| intelikey | carpediem yes "most" things in 'nome can be configured. i find it easier to change things in kde. but i am using fvwm95 for my gui now. so..... | 07:43 |
| mahmud | i've got problem | 07:43 |
| Paralla1 | Well, I may need the password as well, Dr_Wills. | 07:43 |
| crimsun | blrich: no, modules compile against kernel _headers_, not the full source. | 07:44 |
| === Lasse_ [n=lasse@dsl-aur-fe80dd00-87.dhcp.inet.fi] has joined #ubuntu | ||
| Crankeye | heh well i seem to have changed a setting to where i cant get my winecfg to work | 07:44 |
| Crankeye | :/ | 07:44 |
| kakalto | :/ | 07:44 |
| Dr_Willis | Paralla1, you are out of luck with that part - i imagine | 07:44 |
| mahmud | can any one on this help me | 07:44 |
| Crankeye | it to crashes | 07:44 |
| === zenbum [n=zenbum@c-71-198-208-194.hsd1.ca.comcast.net] has joined #ubuntu | ||
| carpediem | intelikey: then obviously you aren't afraid to customize...because a raw fvwm is unusable. | 07:44 |
| newbie | triceratops, ok tnx for the info, is their a wiki on how can i upgrade my gimp? | 07:44 |
| === professor_chaos [n=danc@67-41-205-76.hlrn.qwest.net] has joined #ubuntu | ||
| === prof [n=danc@67-41-205-76.hlrn.qwest.net] has joined #ubuntu | ||
| kakalto | mahmud, well, it depends if you tell what your problem is | 07:44 |
| Paralla1 | Well, the root password is saved in clear text in several locations, I'm not sure about a common (non-root) user. | 07:44 |
| intelikey | mahangu sudo apt-get install dosemu | 07:44 |
| === a8523 [n=a8523@81.175.5.65] has left #ubuntu ["Leaving"] | ||
| Crankeye | oh and i am using the latest wine, i got it with synaptic | 07:44 |
| Crankeye | !info wine | 07:45 |
| ubotu | wine: (Microsoft Windows Compatibility Layer (Binary Emulator and Library)), section universe/otherosfs, is optional. Version: 0.0.20050725-0ubuntu1.1 (breezy), Packaged size: 14130 kB, Installed size: 55488 kB | 07:45 |
| whyami | Crankeye: what is the repo you are getting wine from? | 07:45 |
| Crankeye | X Error of failed request: BadMatch (invalid parameter attributes) | 07:45 |
| Crankeye | Major opcode of failed request: 1 (X_CreateWindow) | 07:45 |
| Crankeye | Serial number of failed request: 13 | 07:45 |
| Crankeye | Current serial number in output stream: 14 | 07:45 |
| Crankeye | thats what happens when i run winecfg | 07:45 |
| === aaron [n=aaron@12-217-51-43.client.mchsi.com] has joined #ubuntu | ||
| mahangu | intelikey, eh? | 07:45 |
| === AJA- [n=AJA@a85-156-183-233.elisa-laajakaista.fi] has joined #ubuntu | ||
| triceratops | newbie: I would suggest upgrading to dapper. The gimp in dapper is version 2.10. I would asume that this wil be better than having a gimp backport for breezy. So for this it might be good to dig for information upgrading breezy to dapper | 07:46 |
| whyami | Crankeye: if you type wine --version, what response do you get? | 07:46 |
| Paralla1 | My problem is that it has been a few days since I installed Ubuntu, and have just now got a good config for X Free 86 to work. I don't even know the name of the non-root account I created, and recall having problems with the Ubuntu installer accepting my password. | 07:46 |
| aaron | hey, do any of you guys know where you can download some product keys for some games on the internet? | 07:46 |
| intelikey | mahangu to install dosemu type this in a terminal; sudo apt-get install dosemu | 07:46 |
| triceratops | newbie: An other way would be using the live-cd of dapper until dapper gets released (june afaik) | 07:46 |
| niki | aaron, www.astalavista.com | 07:46 |
| mahangu | intelikey, i didn't ask to install dosemu. i use dosbox anyway? | 07:46 |
| Crankeye | Wine 20050725 | 07:47 |
| Crankeye | whyami, Wine 20050725 | 07:47 |
| === Phlosten [n=Me@58.166.77.3] has left #ubuntu ["Leaving"] | ||
| blrich | crimsun, but binary modules? what is this driver ABI they compile against, where is it physically, is it a file, part of the kernel...? | 07:47 |
| mahmud | i run this command | 07:47 |
| mahmud | alien -i dosemu_1.2.1-3_i386.deb | 07:47 |
| mahmud | Must run as root to convert to deb format (or you may use fakeroot). | 07:47 |
| mahangu | aaron, please, this is ubuntu support, not #warez | 07:47 |
| newbie | triceratops, ok tenks | 07:47 |
| mahangu | niki, let's not encourage piracy in here, this is a FOSS channel | 07:47 |
| Crankeye | Paralla1, i belive you gotta set the password | 07:47 |
| Crankeye | sudo passwd | 07:47 |
| niki | oops | 07:47 |
| === andre [n=andre@201.56.114.248] has joined #ubuntu | ||
| Paralla1 | I need a user name to do so, no? | 07:47 |
| === spine_ [n=spine@c-66-176-98-9.hsd1.fl.comcast.net] has joined #ubuntu | ||
| whyami | Crankeye: I'd really recommend you update to the binary of wine which wine is providing for breezy. To do this, add to /etc/apt/sources.list this line: deb http://wine.sourceforge.net/apt/ breezy/ | 07:47 |
| Crankeye | that sets the password for the root acount | 07:48 |
| kakalto | mahmud, if you have synaptic set up properly, I believe that you should be able to simply go into synaptic and search for 'dosemu', then install it | 07:48 |
| andre | i've installed ubuntu here, and created a dual boot to choose beetwen winxp and ubuntu | 07:48 |
| Crankeye | whyami, thanks i didnt know i was missing that reposirtie | 07:48 |
| === p62 [n=p62@212.26.240.117] has joined #ubuntu | ||
| kakalto | andre, congratulations :) | 07:48 |
| andre | but when i try to start winxp, it says NTLDR is missing | 07:48 |
| andre | how i fix that? | 07:48 |
| whyami | Crankeye: add that line, do an apt-get update, then update wine. Then try again. | 07:48 |
| Paralla1 | The root account is fine, I can use that from a command line interface, but I want to login to the "GUI" (I'm not even sure if I have KDE, or whatever the default was)... | 07:48 |
| === p62 [n=p62@212.26.240.117] has left #ubuntu ["] | ||
| mahmud | ok thank ..i will try | 07:48 |
| andre | kakalto, thanks =) | 07:48 |
| crimsun | blrich: modules compile against an API, not an ABI. | 07:48 |
| kakalto | andre, sorry :) | 07:49 |
| Crankeye | hmm | 07:49 |
| === airbucks [n=airbucks@203.177.219.251] has joined #ubuntu | ||
| andre | kakalto, well, ubuntu is working fine, at least | 07:49 |
| === moxshax [n=moxshax@60.51.38.113] has joined #ubuntu | ||
| triceratops | newbie: May I ask if you are an advanced linux user? If so I would suggest uprading to dapper. | 07:49 |
| Crankeye | Paralla1, try sudo /etc/init.d/gdm start | 07:49 |
| === chavo [n=chavo@68.235.250.234] has joined #ubuntu | ||
| crimsun | blrich: API (headers), ABI (exported symbol table) | 07:49 |
| mahmud | mr kakalto i could not find dosemu package | 07:49 |
| kakalto | mahmud, sorry mate, I g2g, keep trying in this channel | 07:50 |
| newbie | triceratops, nope im a newbie, i dont think i would upgrade it | 07:50 |
| blrich | crimsun, but then, this means the kernel module API changes between say, 2.6.10 and 2.6.15? why is it that the nvidia drivers have to be recompiled every time you change your kernel? nvidia doesn't provide source code, just object files, so this can't be compiling against only a API? | 07:50 |
| === Versed [n=Versed@c-69-253-173-154.hsd1.nj.comcast.net] has joined #ubuntu | ||
| intelikey | mahmud i mistyped your nick earlier as mahangu sorry. | 07:50 |
| Paralla1 | Crankeye, that got me to the login screen fine, but I can do that just by letting GRUB load the default Ubuntu entry. I need, at least, a user NAME. | 07:50 |
| === aaron [n=aaron@12-217-51-43.client.mchsi.com] has joined #ubuntu | ||
| andre | someone can help me with lilo and winxp? | 07:51 |
| triceratops | newbie: Ok, so using the live CD may be a way to have the latest gimp. It will only need some more weeks till dapper gets released. | 07:51 |
| niki | Paralla1, couldn't you boot into recovery mode and make a new user at terminal? | 07:51 |
| === jenda-zZz is now known as jenda | ||
| andre | when i try to boot winxp, it says NTLDR is missing | 07:51 |
| whyami | Paralla1: it would be the same user name you use from the command line. | 07:51 |
| aaron | does anyone know where I can get some product codes for games on the internet? | 07:51 |
| newbie | triceratops, ok i just w8 for that, tenks a lot | 07:51 |
| === bpont [n=bpont@216.220.64.226] has joined #ubuntu | ||
| triceratops | newbie: You are welcome :) | 07:51 |
| Paralla1 | When at the command like, I only use root@mobile. I don't know what the other user name is... | 07:52 |
| dextro_dude | hi every1, say hi to "moxshax" for providing me free server access | 07:52 |
| Paralla1 | niki, I don't know how!??!?! | 07:52 |
| crimsun | blrich: you mean the kernel API changes, and yes, it has between 2.6.10 and 2.6.15. Vastly. You have to recompile the Nvidia drivers for each kernel precisely because there can be a change in the exported symbols (ABI). You have to compile the kernel-specific part so that the API matches the existing ABI. You're not changing the ABI at all, and neither is Nvidia. | 07:52 |
| niki | Paralla1, when you boot, at grub, choose recovery mode | 07:52 |
| niki | Paralla1, then use the adduser command (i think it's adduser) | 07:52 |
| niki | Paralla1, yeah, adduser | 07:53 |
| === [1] wenko [n=wenko@142.232.8.200] has joined #ubuntu | ||
| Crankeye | deb http://wine.sourceforge.net/apt/ breezy/ | 07:53 |
| bpont | i just marked mozilla-firefox for reinstallation in synaptic, which completed succesfully...however, when i opened firefox and went to help/about it list version 1.0.2...what's wrong? | 07:53 |
| Crankeye | whyami, deb http://wine.sourceforge.net/apt/ breezy/ something is wrong with that line | 07:53 |
| Paralla1 | Niki, thanks. I hope that that will work. | 07:53 |
| niki | bpont, i think that's what version installs from synaptic | 07:53 |
| niki | Paralla1, good luck :) | 07:53 |
| bpont | niki: how do i get up to version 1.5.1? | 07:54 |
| whyami | Crankeye: why do you say that? What isn't working? I did a cut and paste from my own sources.list. | 07:54 |
| triceratops | Paralla1: niki: Dont forget to add the new user to group admin 'adduser newuser admin' So you will be able to use sudo again. | 07:54 |
| niki | Paralla1, yes, what triceratops said | 07:54 |
| Crankeye | >_>;; | 07:54 |
| niki | Paralla1, important stuff :) | 07:54 |
| Paralla1 | Alright, will do. Thanks :) | 07:54 |
| niki | bpont, i got it using automatix...which i now know to be a no-no, so don't do it! | 07:54 |
| === sH4 [n=foo@220.91.193.198] has joined #ubuntu | ||
| bpont | niki: no bggie...so you're saying just live with 1.0.2? | 07:55 |
| whyami | Crankeye: try this link for Wine: http://www.winehq.org/site/download-deb | 07:55 |
| Crankeye | whyami, well now it decied to work | 07:55 |
| Crankeye | i dont even know | 07:55 |
| === drcode [n=user1@87.69.59.186.cable.012.net.il] has joined #ubuntu | ||
| niki | bpont, nah, there's a way | 07:55 |
| Crankeye | >_>;; | 07:55 |
| niki | !firefox | 07:55 |
| === j22j [n=user@195.Red-80-25-184.staticIP.rima-tde.net] has joined #ubuntu | ||
| niki | !tell bpont about firefox | 07:55 |
| Crankeye | ahh thanks much whyami | 07:56 |
| blrich | crimsun, but that makes no sense, compiling a kernel with a changed API would change the ABI wouldn't it? the ABI represents the addresses of symbols in the compiled API, doesn't it? | 07:56 |
| === L|nu}{ [n=linux@193.10.197.41] has joined #ubuntu | ||
| bpont | niki: ok...so what do i do? | 07:56 |
| blrich | crimsun, man this is compicated | 07:56 |
| niki | bpont, read the PM you just got from ubotu | 07:56 |
| Crankeye | the first is working for me now and its updating | 07:56 |
| bpont | niki: OK | 07:56 |
| niki | bpont, that's how you do it :P | 07:56 |
| Crankeye | thank you much | 07:56 |
| whyami | Crankeye: is winecfg working? | 07:56 |
| dextro_dude | niki: u mean automatix is no good ? | 07:57 |
| Crankeye | ill let you know as soon as my wine updates ;) | 07:57 |
| === erikl [n=fredrik@host-83-166-19-203.hernonet.se] has joined #ubuntu | ||
| === LathropWells [n=bill@cpe-72-134-66-177.socal.res.rr.com] has joined #ubuntu | ||
| niki | dextro_dude, from what everyone tells me, it's not the way to go | 07:57 |
| erikl | how do i get .mkv support for ubuntu? | 07:57 |
| tsw | !automatix | 07:57 |
| ubotu | [automatix] unsafe, it overwrites configuration files, and does things like "echo -e 'y\nY\n'" that are considered risky. Please do not use it. There are alternative applications, but it's often best to read the documentation. | 07:57 |
| === [1] wenko is now known as wenko | ||
| Dr_Willis | Friends dont let friends use Automatix. | 07:57 |
| niki | dextro_dude, see...even ubotu doesn' tlike it | 07:57 |
| Dr_Willis | Just say NO! | 07:57 |
| niki | i've unfortunately already used it :P | 07:57 |
| niki | but _now_ i know :P | 07:57 |
| Dr_Willis | Lol | 07:57 |
| === intelikey wishes there was automatix for 5.4 ;/ | ||
| === subir [n=subir@202.79.37.177] has joined #ubuntu | ||
| === darkmaze [n=patrick@c-71-199-22-152.hsd1.co.comcast.net] has joined #ubuntu | ||
| crimsun | blrich: yes, a change in API affects the ABI. However, you're not recompiling simply against the chance of a changed API. You're doing so because different _ABI_s cause silent errors that are insanely difficult to debug. | 07:58 |
| === Dr_Willis slaps intelikey with a... hmm... err... somthing big and heavy. | ||
| Sir_Fawnpug | Back | 07:58 |
| Paralla1 | Niki/Triceratops: I get a error after "Creating home directory" saying "chown 1000:1000 /home/nate: Operation not permitted" and then it cleans up the user areas created after the command was submitted. Is there a syntax to the command I'm missing (I used "adduser nate admin"). | 07:58 |
| Paralla1 | *? | 07:58 |
| === _Rappy_ [n=hunt-pre@80-89-35-2.network.itconnect.no] has joined #ubuntu | ||
| niki | Paralla1, i usually just type adduser | 07:58 |
| Sir_Fawnpug | Anybody happen to use acer_acpi? I'm having problems getting the module to load on my Acer Aspire 3004WLCi | 07:58 |
| niki | Paralla1, then it steps me through the rest...not sure about your error | 07:58 |
| dextro_dude | thanks for the advance warning on the Automatix. | 07:58 |
| Paralla1 | Oh, lol. Thanks. | 07:59 |
| intelikey | Dr_Willis you're no fun. i think i'll take my dolls and go play some place else.... | 07:59 |
| Paralla1 | Similiar error, unfortunately. | 07:59 |
| niki | Paralla1, hmm | 07:59 |
| triceratops | Paralla1: I would first do an 'adduser newuser' then afterwards do an 'adduser newuser admin' | 07:59 |
| whyami | I have to manually restart cpufreqd every time I wake my laptop from sleep or hibernation? How would I automate this? | 07:59 |
| Paralla1 | Niki/Triceratops: The error remains the same each variation. | 07:59 |
| erikl | how do i get h264 codec? | 08:00 |
| blrich | crimsun, alright then, so the ABI is altered only when the API is altered. so the only thing which will change the driver ABI is the driver API within the kernel having code changed. in that case, what and where exactly is the driver ABI? I know it's an exported interface, but in what form? | 08:00 |
| intelikey | why two commands triceratops ? adduser -G group user | 08:00 |
| === jeff_ [n=jeff@adsl-68-127-208-240.dsl.pltn13.pacbell.net] has joined #ubuntu | ||
| niki | i hate limewire | 08:00 |
| crimsun | blrich: you've already read about it. It's the exported symbols. | 08:00 |
| niki | i'm so uninstalling it | 08:01 |
| triceratops | intelikey: This will make 'group' the primary group of 'user' AFAIK | 08:01 |
| intelikey | or is that useradd i thinking... | 08:01 |
| niki | adduser | 08:01 |
| intelikey | must be useradd | 08:01 |
| niki | oh wait | 08:01 |
| niki | nvm | 08:01 |
| mahangu | where is the trash can on the filesystem? | 08:01 |
| mahangu | i mean location | 08:01 |
| mahangu | like /xxx/trash for e.g | 08:01 |
| intelikey | in useradd [-g initial_group] [-G group[,...] ] | 08:02 |
| bpont | niki: no offense, but what am i supposed to do with "niki wants you to know: well, firefox is a Free Software web browser that supports extensions and is gaining popularity by the hour. Developed by the Mozilla Foundation. For firefox 1.5, look at !firefox1.5 To use your mouse theme in firefox, see http://www.ubuntuforums.org/showthread.php?t=78961" | 08:02 |
| mahangu | is there a site which explains the linux filesystem? | 08:02 |
| triceratops | Paralla1: What says a 'mount' command? may be your partitions are mounted read only. | 08:02 |
| niki | bpont, you could start by reading it and following it's directions | 08:02 |
| TheDracle | Lol. | 08:02 |
| === basanta [n=basanta@202.79.37.177] has joined #ubuntu | ||
| whyami | mahangu: the trash is at ~/.Trash | 08:02 |
| Crankeye | secksy i found the problem | 08:02 |
| TheDracle | Is it really gaining popularity by the hour? | 08:02 |
| niki | !tell bpont about firefox1.5 | 08:03 |
| TheDracle | By the minute maybe? | 08:03 |
| bpont | niki: it's about using a mouse theme in firefox...what's that got to do with apt-get install of latest firefox version? | 08:03 |
| Crankeye | whyami, i updated which was good buy wasnt my problem thanks though i would rather have the updated | 08:03 |
| niki | bpont, read the new one you just got from ubotu | 08:03 |
| Paralla1 | triceratops: All of the /dev/<x> seem to be rw. | 08:03 |
| === Storkme [n=alex@storkey.plus.com] has joined #ubuntu | ||
| Crankeye | i edited the user.reg file in my home/.wine/ folder and changed desktopdoublebuffered to Y | 08:03 |
| whyami | Crankeye: I'm glad you are in business again. The update is far far *far* superior to the version you had. | 08:03 |
| Crankeye | and its all fixed <3 | 08:03 |
| blrich | crimsun, but where do the exported symbols go? into a file? into a binary, a library, an object code file? where is it contained? | 08:03 |
| Crankeye | thank you much <# | 08:03 |
| Crankeye | <3 | 08:03 |
| === Crankeye 's <3 goes to whyami | ||
| niki | love is in the aaaaaair | 08:04 |
| intelikey | man the syntax in adduser is Ugly ! | 08:04 |
| === sfar [n=sfar@c-30f2e253.18-2-64736c10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| Crankeye | haha | 08:04 |
| === thomas [n=thomas@c-68-33-228-218.hsd1.md.comcast.net] has left #ubuntu ["Leaving"] | ||
| bpont | niki: OK, well now that's a different animal...however, i use hoary...will the info still apply to the release i use? | 08:04 |
| whyami | what does <3 mean? | 08:04 |
| Paralla1 | Triceratops:My linux partition is ext3. A friend said that it is a bad choice for disk file formats... I doubt that would be significant here though, correct? | 08:04 |
| Crankeye | its a heart | 08:04 |
| Dr_Willis | Less then 3 :P | 08:04 |
| Crankeye | sideways lol | 08:04 |
| whyami | oh, duh! | 08:04 |
| intelikey | less than three ? | 08:04 |
| Crankeye | hahah lol | 08:04 |
| Dr_Willis | pv=nrt | 08:04 |
| TheDracle | Paralla1: I'm not exactly sure it's such a bad choice. It depends on what you're doing. | 08:05 |
| Dr_Willis | e=mc^2 | 08:05 |
| whyami | Anyway, glad I was helpful, even though you solved your own problem. | 08:05 |
| intelikey | CO_2 | 08:05 |
| Crankeye | haha you got me the upgraded version | 08:05 |
| Crankeye | thank you much <3 | 08:05 |
| crimsun | blrich: the symbols are in the kernel. The table is exported as System.map. The listed of exported symbols per module is in abi. | 08:05 |
| triceratops | Paralla1: You are in recovery mode? What says a 'runlevel' command? | 08:06 |
| === mr_lampe [n=tho@dslb-084-056-154-032.pools.arcor-ip.net] has joined #ubuntu | ||
| Paralla1 | Triceratops:.... "unknown" | 08:06 |
| intelikey | i'm in runlevel 1 | 08:06 |
| bpont | niki: ? | 08:06 |
| Crankeye | omg this version of wine p00ns | 08:06 |
| === philips [n=brandon@osuosl/staff/philips] has joined #ubuntu | ||
| Crankeye | it actually works omg | 08:07 |
| Amaranth | intelikey: that's reboot | 08:07 |
| intelikey | no it's multi-user level here Amaranth | 08:07 |
| Amaranth | intelikey: sudo init 1 will reboot iirc | 08:07 |
| crimsun | (6 is reboot, normally; 1 is single) | 08:07 |
| intelikey | i only have 0 1 & 6 | 08:07 |
| triceratops | Paralla1: If ext3 is a bad choice I would say using ntfs for Win-XP would be a bad choice too. Using ext3 _is_ a good choice. Beleve me... | 08:07 |
| intelikey | Amaranth no it wont. | 08:08 |
| === budluva [n=budluva@d209-89-216-221.abhsia.telus.net] has joined #ubuntu | ||
| === obontu [n=obontu@80.179.185.46.static.012.net.il] has joined #ubuntu | ||
| crimsun | (intelikey has modified his runlevels; we've been over this) | 08:08 |
| intelikey | 1 is single by default | 08:08 |
| === ckbk [n=ckbk@073.192-93-216-nokia-dsl.dynamic.surewest.net] has joined #ubuntu | ||
| triceratops | Paralla1: 'unknown' is what I would like to see :) | 08:08 |
| Paralla1 | Oh. Good :) | 08:08 |
| ckbk | hello? | 08:08 |
| === intelikey has modified everything...... | ||
| Amaranth | crimsun: ah | 08:08 |
| === Klowner_ is now known as Klowner | ||
| ckbk | can anyone help me with dapper drake 6.06 open office | 08:09 |
| blrich | crimsun, okay then one or two last questions, sorry, thankyou for all this info so far -- when you get the latest nvidia binary driver or whatever, what form does it come in? object code, or pure source? | 08:09 |
| frank23 | how do I disable ssh access to a specific user? | 08:09 |
| Dr_Willis | frank23, Hmm.. | 08:09 |
| Dr_Willis | you want them to still login however? | 08:09 |
| Dr_Willis | but not ssh in? or not ssh out? | 08:09 |
| ckbk | please help i updated the unofficial way from 5.10 to 6.06 and now open office doesnt work | 08:09 |
| === zulu22 [n=Frank@hmbg-d9bf9fa2.pool.mediaWays.net] has joined #ubuntu | ||
| ablyss | frank23, edit /etc/hosts.deny add "sshd : <ip_of allow users> : allow" | 08:10 |
| sfar | ubotu, tell ckbk about dapper | 08:10 |
| frank23 | Dr_Willis: its a dummy user for a program | 08:10 |
| intelikey | but init 1 is not reboot that is init 6 on a default system Amaranth. init 0 is halt init 1 is single user (sulogin) on all default *nix's | 08:10 |
| crimsun | blrich: both. It contains a small glue portion that you have to compile against your kernel kernels. The binary-only object code is obfuscated code that's internal to Nvidia (think IP). | 08:10 |
| === jim_c [n=jchurchi@133.97.174.204.adsl.island.net] has joined #ubuntu | ||
| ablyss | frank23, the ip can be in a range too, e.g., 192.168.*.* | 08:10 |
| triceratops | Paralla1: Are you able to edit the '/etc/passwd' file? Use vi, nano, mcedit or which editor you prefer. | 08:10 |
| intelikey | i have had as few as two runlevels and as many as twelve. | 08:11 |
| Paralla1 | I wish I new how to use those... I'll see if I can get any of those to work. | 08:11 |
| Dr_Willis | frank23, you can totally block any logging in by that dummyuser. by setting their shell to '/bin/false' i think | 08:11 |
| === buffarama [n=buffaram@adsl-69-155-217-173.dsl.rcsntx.swbell.net] has joined #ubuntu | ||
| niki | bpont, sorry | 08:11 |
| frank23 | Dr_Willis: yeah that would be the idea | 08:11 |
| ablyss | frank23, /etc/hosts.allow and hosts.deny are virtually the same file.. only thing is hosts.allow gets checked first, then hosts.deny.. but you can put whatever you want in either file i.e., allow or deny | 08:12 |
| niki | bpont, my bf is very sick, i'm gonna have to sign out...i'm sure one of the fine folks in here will help you out :) | 08:12 |
| triceratops | Paralla1: Using vi will do the job. Just type 'vi /etc/passwd' | 08:12 |
| niki | g'night all :) | 08:12 |
| frank23 | Dr_Willis I do that in /etc/passwd ok | 08:12 |
| blrich | crimsun, okey-doke, so they include source that will compile against the latest kernel driver API, which will then provide an ABI/library/something to it's own object-code, which can then be linked against that? | 08:12 |
| frank23 | ablyss: I'll just deby logins completely | 08:12 |
| crimsun | blrich: don't think of Nvidia's binary-only blob as ABI. Just don't. It has nothing to do with it. | 08:12 |
| intelikey | block their passwd. | 08:12 |
| ablyss | frank, i run a cron job to check for string on my server to add my IP so i can remote ssh to my server anywhere in the world.. pretty secure | 08:13 |
| intelikey | passwd -l user | 08:13 |
| === volcom_b0i [n=volcom_b@host-69-145-68-234.bln-mt.client.bresnan.net] has joined #ubuntu | ||
| === ulinskie [n=yolynne@202.57.88.34] has joined #ubuntu | ||
| === Blippe [n=henryson@1-1-11-41a.f.sth.bostream.se] has joined #ubuntu | ||
| === freeflying-ibook [n=freeflyi@61.190.65.15] has joined #ubuntu | ||
| === ckbk [n=ckbk@073.192-93-216-nokia-dsl.dynamic.surewest.net] has left #ubuntu ["Leaving"] | ||
| frank23 | ablyss: how does your server know your IP? | 08:14 |
| volcom_b0i | does anyone know if airsnort will work with a wireless card using ndiswrapper to get its drivers working? | 08:14 |
| === jim_c [n=jchurchi@133.97.174.204.adsl.island.net] has left #ubuntu ["Leaving"] | ||
| === carthik [n=carthik@user-0cej755.cable.mindspring.com] has joined #ubuntu | ||
| ablyss | frank, unique string only i give the server e.g. myserver.com?unique_string | 08:14 |
| === mite [n=mite@pdpc/supporter/active/mite] has joined #ubuntu | ||
| === xsquared [n=mike@dsl-58-6-121-220.qld.westnet.com.au] has joined #ubuntu | ||
| blrich | crimsun, okay, well, then in any case it's compiling against the changed API in the kernel -- so then if that's the case, why do people say 'the linux kernel needs a stable driver ABI so everyone can make binary drivers for it'? | 08:14 |
| === yangchaojiao [n=yangchao@222.79.4.243] has joined #ubuntu | ||
| xsquared | hi, how is it possible to install lighttpd under breezy? | 08:14 |
| === redxninja [n=redxninj@c-67-189-39-74.hsd1.or.comcast.net] has joined #ubuntu | ||
| === Madpilot [n=brian@S0106000d88b9f3db.gv.shawcable.net] has joined #ubuntu | ||
| blrich | crimsun, what part of the kernel would have to be stabalised for a major release for people to be able to build binary drivers for any sub-version? (eg. 2.6.x) | 08:15 |
| Dr_Willis | !info lighthttpd | 08:15 |
| Dr_Willis | !info lighthttp | 08:15 |
| Dr_Willis | Hmm :P | 08:15 |
| triceratops | Paralla1: If you open '/etc/passwd' via apt go to the line which has a ':x:1000:1000:' | 08:15 |
| intelikey | lighttpd ? | 08:15 |
| === reefshark [n=reefshar@fw.sogeti.nl] has joined #ubuntu | ||
| blrich | crimsun, windows can do it, so what it's kernel got that linux hasn't? is this to say window's kernel driver api hasn't changed since 2001 when xp was released? | 08:15 |
| Paralla1 | Triceratops: Alright. It's open in vi. | 08:15 |
| yangchaojiao | sudo alien RealPlayer-10[1] .0.6.776-20050915.i586.rpm | 08:15 |
| yangchaojiao | Error executing "LANG=C rpm -qp --queryformat %{SUMMARY} RealPlayer-10[1] .0.6.776-20050915.i586.rpm": at /usr/share/perl5/Alien/Package.pm line 449. | 08:15 |
| yangchaojiao | why? | 08:16 |
| triceratops | Paralla1: Left of ':x:' there is the username of this user. It should be the first user youve created, and by this the user who is allowed to use sudo. | 08:16 |
| ablyss | sshd : * : deny will deny all attempts to your ssh server frank23 | 08:16 |
| bpont | niki: uh huh...thx | 08:16 |
| xsquared | Dr_Willis, its in dapper, but i want to install it in breezy | 08:17 |
| crimsun | blrich: I have to get to bed, so I'll leave you with http://kerneltrap.org/node/6279 | 08:17 |
| === eXcessive [n=andrey@85.234.165.126] has joined #ubuntu | ||
| xsquared | Dr_Willis, i tried to install it from the package in dapper, but it requires two packages that arn't available on my system or something | 08:17 |
| Paralla1 | triceratops: There is no ':x:1000:1000' that I can find. In the lower right corner of vi's output, there is a 2,1. Are there two pages to the output? | 08:17 |
| xsquared | Dr_Willis, Do you have any idea about how to install it? | 08:18 |
| intelikey | ablyss wouldn't it be better to kill sshd ? | 08:18 |
| triceratops | Paralla1: Sso what we will do now is deleting the password of this user. But first lets see how we may leave vi without saving the changes. It may be good if you made a editing mistake. I would say it will be easier than fizzeling around with vi commands in your state of experience... | 08:18 |
| ablyss | intelikey, not if you plan to use it ;-) | 08:18 |
| xerophyte | how secure is the webmin. . my clients need a web-based stuff so wondering how secure is the webmin is | 08:18 |
| volcom_b0i | intelikey: I am using wi-fi right now, I am asking if airsnort works while using it. THanks though. | 08:18 |
| intelikey | ablyss if * is blocked you can't use ? | 08:19 |
| Dr_Willis | xsquared, go download the source. and start compiling? | 08:19 |
| blrich | crimsun, thanks for all the info =) | 08:19 |
| === tubasoldier [n=tubasold@72.24.12.41] has joined #ubuntu | ||
| triceratops | Paralla1: Uuups, so the file is empty? You should see a lot of lines containing usernames... | 08:19 |
| === bris [n=bris@fla93-1-81-57-169-29.fbx.proxad.net] has joined #ubuntu | ||
| === Homer [n=noplay@wikipedia/Masterhomer] has joined #ubuntu | ||
| intelikey | ablyss so sudo /etc/init.d/ssh stop would be what i would use. | 08:19 |
| === scooter32 [n=scooter3@c-69-142-138-166.hsd1.nj.comcast.net] has joined #ubuntu | ||
| ablyss | intelikey, allow "me" deny "everyone else" will work | 08:19 |
| triceratops | Paralla1: What does a 'ls -l /etc/passwd' say? | 08:19 |
| === JustinLynn is now known as JustinLynn|sleep | ||
| intelikey | ablyss yes. but deny * gets you too don't it ? | 08:20 |
| Paralla1 | triceratops: Where do I input that command? I'm still in vi. I don't know how to exit.. | 08:20 |
| ablyss | intelikey, no | 08:20 |
| triceratops | Paralla1: Leave vi by typing ':q!' | 08:20 |
| intelikey | ablyss oh. | 08:20 |
| yangchaojiao | I need help | 08:20 |
| yangchaojiao | sudo alien RealPlayer-10[1] .0.6.776-20050915.i586.rpm | 08:20 |
| yangchaojiao | Error executing "LANG=C rpm -qp --queryformat %{SUMMARY} RealPlayer-10[1] .0.6.776-20050915.i586.rpm": at /usr/share/perl5/Alien/Package.pm line 449. | 08:20 |
| triceratops | Paralla1: This always will leave vi without saving the changes. | 08:21 |
| Paralla1 | Okay. That worked without a problem. | 08:21 |
| frank23 | !realplayer | 08:21 |
| ubotu | I guess realplayer is http://wiki.ubuntu.com/RestrictedFormats | 08:21 |
| triceratops | Paralla1: Ok, so now do a 'ls -l /etc/passwd' | 08:21 |
| ablyss | intelikey as long as you put "me" first that is before the line "deny everyone else" your okay | 08:22 |
| Paralla1 | '-rw-r--r-- 1 root root 1194 Mar 29 20:01 /etc/passwd' | 08:22 |
| Paralla1 | That is the only line of output. | 08:22 |
| intelikey | ablyss ok, then it's a first read priority. i see. | 08:22 |
| ablyss | the file(s) are read line by line, hosts.allow then hosts.deny.. which comes first is prioritzed | 08:23 |
| triceratops | Paralla1: Ok, fine now do a ' vi /etc/passwd ' (you may use cut and paste from this window to avoid mistyping ;-) | 08:23 |
| === Dr_Willis [n=willis@12-222-81-183.client.insightBB.com] has joined #ubuntu | ||
| === mite [n=mite@pdpc/supporter/active/mite] has joined #ubuntu | ||
| Paralla1 | (I'm interfacing with Ubunut on a serperate machine0 | 08:23 |
| frank23 | Paralla1: you can use nano instead of vi too. more intuitive | 08:23 |
| triceratops | Paralla1: Do you see a lot of users listed now? | 08:23 |
| Paralla1 | triceratops: Yes. | 08:24 |
| === slack_prad [n=slack_pr@59.92.52.163] has joined #ubuntu | ||
| triceratops | frank23: Ok, but I'm not to familiar with nano, so it may be a better idea to use vi in the moment | 08:24 |
| intelikey | never do a rm /etc/passwd* and reboot..... | 08:24 |
| triceratops | Paralla1: So you can search for certain strings in vi by typing '/searchedstring'. Try a '/1000' | 08:25 |
| triceratops | Paralla1: This should bring you to the right line | 08:25 |
| Paralla1 | e486: Pattern not found: 1000 | 08:26 |
| Paralla1 | triceratops: I hope I noted this earlier, but the mount returned "(rw,error=ro, etc)" as part of its output... | 08:27 |
| triceratops | Paralla1: Weird, really. No line which has a 1000? This would say that you haven't created a user during the installation. | 08:27 |
| Sir_Fawnpug | Parallal, oyu know what VI stands for, right? | 08:27 |
| pierre- | how can i assign some hotkey (in Gnome) to the console command? | 08:27 |
| triceratops | Silencer: vi = Very Intuitive :-)) | 08:28 |
| Paralla1 | Visual? (Says the Wiki). | 08:28 |
| intelikey | or 6 | 08:28 |
| === ponds_ [n=ponds@cpe-24-165-165-39.midsouth.res.rr.com] has joined #ubuntu | ||
| triceratops | Paralla1: Hhhm, is your /etc a seperate partition? | 08:28 |
| Sir_Fawnpug | Paralla1, Virtually Impossible. | 08:28 |
| === LathropWells [n=bill@cpe-72-134-66-177.socal.res.rr.com] has joined #ubuntu | ||
| triceratops | Sir_Fawnpug: vi = Very Intuitive :-)) | 08:29 |
| === hatake_k1kashi [n=meh@60-241-7-174.tpgi.com.au] has joined #ubuntu | ||
| === cerebrix [n=christia@cpe-66-27-155-245.socal.res.rr.com] has joined #ubuntu | ||
| Paralla1 | triceratops: I don't believe so. If I re-inserted my install disc, could I get back to the user setup from the installation menu? Would reinstalling be more advisable at this point? | 08:29 |
| === Tennessee [n=tjl@134.178.4.111] has joined #ubuntu | ||
| slack_prad | vi = very intriguing :) | 08:29 |
| LathropWells | vi = very infuriating. - heh | 08:29 |
| Sir_Fawnpug | vim = virtually impossible, improved. | 08:29 |
| LathropWells | lol | 08:29 |
| === ca38aspear [n=mike@66-168-7-43.dhcp.stpt.wi.charter.com] has joined #ubuntu | ||
| intelikey | hey that's hard to set up. mount blah on /etc can be done but it aint so easy as it looks. | 08:30 |
| === drcode [n=user1@87.69.59.186.cable.012.net.il] has joined #ubuntu | ||
| Sir_Fawnpug | Anybody here have an acer laptop? | 08:30 |
| === highvoltage [n=Jono@196.36.161.235] has joined #ubuntu | ||
| Sir_Fawnpug | I'm trying to get the function buttons going so I can get my wireless up, and acer_acpi doesn't feel like cooporating. | 08:30 |
| sfar | Sir_Fawnpug, thats "vii" :< | 08:30 |
| triceratops | Paralla1: If it is a fresh installation it might be better to do a new installation than fizzeling arround for hours and hours. Not to forget doing installation more frequently will skill you too :-)) | 08:30 |
| === intelikey thinks he'll make a 4m partition to mount on /etc | ||
| Paralla1 | Alright. Thanks for all of your help, triceratops. I hope this THIRD installations goes better. Night all. | 08:31 |
| LathropWells | Is it possible to reconcile the kernel compiled with gcc 3.4 and the nvidia binary drivery compiled with gcc 4.0/ - does enabling the option mentioned during install actually make the driver work? | 08:31 |
| === nto-ubu [n=nto@h52n2fls31o290.telia.com] has joined #ubuntu | ||
| LathropWells | (i had a tough go of it.0 | 08:31 |
| intelikey | Paralla1 just before you reload, may i ask what the problem is ? | 08:31 |
| triceratops | intelikey: Don't use seperate partitions for /etc if you are not a very experienced linux user. You may run into a lot of problems in the end... | 08:32 |
| Paralla1 | The Ubuntu installation didn't right my submitted username and password to /etc/passwd during the install. | 08:32 |
| Paralla1 | Now I cannot adduser from the terminal/command line in recovery mode. | 08:32 |
| Paralla1 | Hence, I cannot login into Ubuntu. | 08:32 |
| Sir_Fawnpug | intelikey, I've always tried to figure out how exactly you might do that | 08:32 |
| Paralla1 | Unless I use root from the command line. | 08:33 |
| intelikey | Paralla1 you are not mounted ro are you ? | 08:33 |
| Sir_Fawnpug | I thought it was a good idea until I realized the mounter has to know where /etc/fstab is to mount /etc | 08:33 |
| Paralla1 | my ext3 is, yes. There was an error on mounting, I guess. | 08:33 |
| triceratops | Paralla1: I would asume this is because you use a seperate partition for /etc. Try doing an installation not in expert mode if you are new to linux. | 08:33 |
| === Tomcat_ [n=Tomcat@p54A18B7C.dip0.t-ipconnect.de] has joined #ubuntu | ||
| === trillian [n=trillian@38.115.167.19] has joined #ubuntu | ||
| === ca38aspear [n=mike@66-168-7-43.dhcp.stpt.wi.charter.com] has left #ubuntu [] | ||
| Paralla1 | I had no choice from expert, simple, etc. The ext3 partitions mounts with (rw,errors=remount-ro) | 08:34 |
| === trillian [n=trillian@38.115.167.19] has left #ubuntu ["Leaving"] | ||
| intelikey | Paralla1 do a mount -o remount,rw / then useradd -G admin <username> | 08:34 |
| triceratops | Paralla1: Is there a Linux User Group near to your residence? I always vote for getting in contact to a LUG, you will find a lot of assistance there. | 08:35 |
| === JFK [n=seawolf@host166-57.pool8261.interbusiness.it] has joined #ubuntu | ||
| === erlends_ [n=erlends@80.91.32.21] has joined #ubuntu | ||
| Paralla1 | I've got two friends who are very experianced Linux users, but it's 1:30 AM here. | 08:35 |
| Paralla1 | intelikey, that didn not change the result. | 08:36 |
| triceratops | Paralla1: Hhm, this may be because of a harddisk error. Do you have a harddisk testing floppy to perform a diskcheck? | 08:36 |
| Paralla1 | triceratops: Nope. | 08:36 |
| intelikey | still ro ? | 08:36 |
| Paralla1 | Yes. | 08:36 |
| intelikey | eeek. | 08:36 |
| === Legion_nux [n=Legion_n@201.194.118.70.cfl.res.rr.com] has joined #ubuntu | ||
| Paralla1 | I'm going to try some other things during install. Thanks all. I really need to get going. | 08:36 |
| triceratops | Paralla1: Such errors like yours are often caused due to harddisk failures. May I ask what kind and type of hd it is? | 08:36 |
| intelikey | fsck.ext3 /dev/<your_partition> maybe and see why you cant mount cleanly. | 08:37 |
| intelikey | mount can tell you the device | 08:37 |
| intelikey | or fdisk -l | 08:37 |
| === d-o-b [n=nxt@58.69.220.245] has joined #ubuntu | ||
| triceratops | intelikey: If it is a fresh installation it is very unlikly having such messages whithout a harddisk problem. I don't think it is a filesystem related error in his case. | 08:38 |
| intelikey | triceratops not being able to useradd is fs related. he's mounted / ro | 08:38 |
| === Fang [n=Fang@AToulon-151-1-104-201.w86-200.abo.wanadoo.fr] has joined #ubuntu | ||
| cmatheson | i've always used the 'imap_force_ssl' parameter in my .muttrc so that i could use secure imap... in dapper it says 'imap_force_ssl: unknown variable', i can't find an equivalent option in the man page, any ideas? | 08:39 |
| intelikey | what the cause is. it would be better to find out now and reload later than reload on a bad disk. | 08:39 |
| === neoxan [n=neoxan@i577BDFCC.versanet.de] has joined #ubuntu | ||
| === takedown [n=takedown@hst10.nkosino.ru] has joined #ubuntu | ||
| intelikey | well better imo | 08:41 |
| triceratops | intelikey: Shure, fullack. But having fs errors in a fresh installation is most likely a harddisk problem. So I wouldn't expect too much running a fsck for the long run. Isn't it? | 08:41 |
| intelikey | triceratops well i have had the hoary installer leave my new ext2/3 fs hosed but could fix it and then no errors.... so idk </shrugs> | 08:42 |
| triceratops | intelikey: Really? Strange, never had this before during an installation and it was no harddisk problem. In the long run all this disks died. | 08:44 |
| intelikey | triceratops i just find it easier "MOST" of the time to fix something, than to reload it five times and then fix it. | 08:44 |
| === home-ehjn [n=home-ehj@218.24.76.26] has joined #ubuntu | ||
| intelikey | triceratops i'm using it right now.... | 08:44 |
| DBO | what is the max RAM ubuntu supports with the 386 kernel? | 08:44 |
| intelikey | 2g is it ? | 08:45 |
| DBO | that would be perfect | 08:45 |
| intelikey | or is that the 686 ? | 08:45 |
| intelikey | hehhe i have 96m why am i answering...... | 08:45 |
| DBO | well I have 2 gigs in, but Im not sure how to check to make sure its all used properly | 08:45 |
| triceratops | intelikey: Sure, we do so. But a lot of novice linux users tend to do too much fizzeling during their first installation. Using expert mode, fizzeling arround with partitioning and such stuff due to my experience... | 08:45 |
| === cow_2001 [n=username@bzq-88-155-226-247.red.bezeqint.net] has joined #ubuntu | ||
| === rgck [n=rgck@66.220.31.222] has left #ubuntu [] | ||
| BlueHeron | DBO: mail me a gig i'll check for you | 08:46 |
| DBO | BlueHeron, would you!??! You're such a pal! | 08:46 |
| === liable_ is now known as liable | ||
| BlueHeron | yep free of charge | 08:46 |
| DBO | let me wrap that up in some spare carpet | 08:46 |
| intelikey | DBO cat /proc/meminfo | 08:46 |
| DBO | just to make sure it has a soft ride | 08:46 |
| BlueHeron | sounds good | 08:46 |
| DBO | intelikey, thanks | 08:47 |
| BlueHeron | send it to PO box 1337 @ dumbsville nY | 08:47 |
| === aeolist [n=aeolist@ppp157.dialup.ntua.gr] has joined #ubuntu | ||
| intelikey | triceratops :) i thought it was people that use linux a lot that fizzel arround (: | 08:48 |
| intelikey | what do i know. | 08:48 |
| triceratops | BlueHeron: What would you do if he rally will send you a printout of a 2gig file to your PO box? Could be tons of paper... | 08:48 |
| BlueHeron | triceratops: lmfao .. | 08:49 |
| BlueHeron | triceratops: i want him to send me his RAM | 08:49 |
| Storkme | how can i get the kernel 2.6.16-1-k7-smp so i can get the nvidia drivers working? | 08:49 |
| === DBO cats a 2 gig binary file > /dev/printer (wish I had one...) | ||
| xnull | can I compile openssh on my ubuntu box? | 08:49 |
| intelikey | Storkme install dapper ? | 08:49 |
| triceratops | intelikey: Shure, but not in the beginning I would suppose. So at least I would'd suppose doing so... ;-) | 08:49 |
| Storkme | intelikey, what's dapper? | 08:50 |
| intelikey | xnull yes but why ? it's probably installed already. | 08:50 |
| intelikey | !dapper | 08:50 |
| ubotu | Dapper Drake will be the next release of Ubuntu - due June 1 (see: http://tinyurl.com/qyrkq). Join channel #ubuntu+1 for discussion :) | 08:50 |
| triceratops | intelikey: s/would'd supposewould'd suggest/ | 08:50 |
| Madpilot | !ssh | 08:50 |
| ubotu | I heard ssh is https://wiki.ubuntu.com/SSHHowto or https://wiki.ubuntu.com/AdvancedOpenSSH | 08:50 |
| xnull | intelikey: nope.. | 08:50 |
| === freakabcd [n=freakabc@gn01.quakes.uq.edu.au] has joined #ubuntu | ||
| freakabcd | hi all | 08:50 |
| xnull | i got Ubuntu 4.10 | 08:50 |
| === Hobbsee [n=Hobbsee@ubuntu/member/hobbsee] has joined #ubuntu | ||
| triceratops | intelikey: s/would'd suppose/would'd suggest/ *grr* damned cutnpaste | 08:50 |
| intelikey | xnull well it's certenly in the repos | 08:51 |
| freakabcd | i have just installed ubuntu dapper flight5 | 08:51 |
| intelikey | !info openssh warty | 08:51 |
| freakabcd | and i have the cd for kubuntu dapper flight5 as well. | 08:51 |
| intelikey | !info ssh warty | 08:51 |
| ubotu | ssh: (Secure shell client and server (transitional package)), section net, is standard. Version: 1:3.8.1p1-11ubuntu3.3 (warty), Packaged size: 29 kB, Installed size: 72 kB | 08:51 |
| freakabcd | how do i setup that cd as a repository and install kde on my system ? | 08:51 |
| === holler [n=holler@cpe-66-69-101-208.satx.res.rr.com] has joined #ubuntu | ||
| triceratops | freakabcd: You want to do a remote install via pxb or ftp? | 08:52 |
| intelikey | freakabcd put the disk in and run sudo apt-cdrom ? | 08:52 |
| freakabcd | triceratops, huh? | 08:52 |
| freakabcd | i have the cd in my hands! | 08:52 |
| carthik | freakabcd, apt-cdrom add | 08:53 |
| === xnull is now known as xnull- | ||
| === TheRabbit [n=andrew@adsl-70-228-140-13.dsl.akrnoh.ameritech.net] has joined #ubuntu | ||
| === KenSentMe [n=root@a82-92-80-8.adsl.xs4all.nl] has joined #ubuntu | ||
| === TheRabbit [n=andrew@adsl-70-228-140-13.dsl.akrnoh.ameritech.net] has left #ubuntu ["Leaving"] | ||
| === neoxan [n=neoxan@i577BD386.versanet.de] has joined #ubuntu | ||
| freakabcd | intelikey, ok. that will install kubuntu for me? also last time my brother installed kubuntu n his ubuntu machine it replaced the startup splash with 'kubuntu' . i lie the ubuntu splash | 08:53 |
| freakabcd | s/lie/like.. damn laptop keyboards | 08:54 |
| holler | hello...im looking for an application i used a good while back, cant remember the name of it. basically it lets u setup a chatroom in one pane, and the other was a pane that allowed u to load code(ie c/c++/python/etc)...and u can invite anybody to collaborate with you on the code | 08:54 |
| === michael__ [n=michael@m242.net85-169-190.noos.fr] has joined #ubuntu | ||
| === antoninus [n=anthony@cpc1-ptal1-0-0-cust555.swan.cable.ntl.com] has joined #ubuntu | ||
| KenSentMe | hi, can anyone tell me how i can add new fonts to ubuntu, i've copied some in the /usr/share/fonts folder but scribus doesn't recognize them | 08:54 |
| carthik | freakabcd, at http://ubuntu.wordpress.com/index.php?s=usplash there is a solution to restore the ubuntu usplash | 08:54 |
| intelikey | freakabcd no that will only add the cd to your sources list so you can install what is on the cd at will. | 08:54 |
| === michael__ [n=michael@m242.net85-169-190.noos.fr] has left #ubuntu ["Ex-Chat"] | ||
| Madpilot | holler, gobby? | 08:55 |
| freakabcd | err.. ok. i'm a new ubuntu user. so i don;t really know what packages to install for kde | 08:55 |
| holler | Madpilot: that sounds like it...let me look it up.. | 08:55 |
| freakabcd | other than the ones that look obvious to me (kde-admin kde-artwork, etc.) | 08:55 |
| === ebaad [n=ebaad@c-67-181-129-148.hsd1.ca.comcast.net] has joined #ubuntu | ||
| === Suture [n=suture@63-231-21-223.tukw.qwest.net] has joined #ubuntu | ||
| Madpilot | freakabcd, kubuntu-desktop is the meta-package for the whole thing | 08:55 |
| carthik | freakabcd, you can install kubuntu-desktop to get the "ubuntu project" recommended/modified/adapted kde setup, and then follow the instruction to get back the ubuntu usplash | 08:55 |
| Blippe | freakabcd you install kubuntu-desktop | 08:55 |
| triceratops | freakabcd: May be via 'apt-get install kde'? | 08:56 |
| freakabcd | cool. | 08:56 |
| holler | madpilot: yes! thats it...thank you very much! | 08:56 |
| freakabcd | so i need: sudo apt-cdrom; apt-get install kubuntu-desktop | 08:56 |
| carthik | freakabcd, added the cdrom okay? | 08:56 |
| carthik | yeah, sudo in both cases. | 08:56 |
| triceratops | freakabcd: But this will install (most) everything from kde | 08:56 |
| intelikey | freakabcd after adding the cdrom sudo apt-get install kubuntu-desktop if you want all the k-apps and theems or sudo apt-get install kdebase for the minimum kde and add apps as you lke. | 08:56 |
| intelikey | like | 08:56 |
| carthik | freakabcd, and before you install kubuntu-desktop, do an apt-get update | 08:56 |
| freakabcd | ok, i have the stuff like universe enabled. | 08:57 |
| Sir_Fawnpug | Anybody familiar with acer_acpi? I'm having trouble building a module that will load, and I have an Acer Aspire 3004WLCi | 08:57 |
| freakabcd | will it try to grab the(newer if any) packages from internet | 08:57 |
| freakabcd | ? | 08:57 |
| === cobalt [n=ubuntu@c-67-166-167-125.hsd1.tx.comcast.net] has joined #ubuntu | ||
| intelikey | yes | 08:57 |
| triceratops | freakabcd: the right order would be: 'add-cdrom' then 'apt-get update' and at last 'apt-get install kde' | 08:58 |
| intelikey | apt is queer that way at always trys to get the latest. | 08:58 |
| === Ribs [n=ribs@riblet.plus.com] has joined #ubuntu | ||
| freakabcd | triceratops, just kde or kubuntu? | 08:58 |
| freakabcd | i mean kubuntu-desktop | 08:58 |
| mahangu | freakabcd, just get kubuntu-desktop | 08:58 |
| === Beleys [i=sauget@tolkien.iut-bm.univ-fcomte.fr] has joined #ubuntu | ||
| intelikey | kubuntu-desktop = full load of kde kdebase = all of kde but no add ons like koffice and theems and that junk. | 08:59 |
| triceratops | freakabcd: Good question. Both will do it. IMHO the recommended way is installing kubuntu-desktop. So you will have the full look and feel of kubuntu | 08:59 |
| === intelikey is a minimalist so i would say kdebase :) | ||
| triceratops | freakabcd: AFAIK kubuntu-desktop has a dependency to kde, at least it has a lot dependencies to kde-$whatsoever. | 09:00 |
| intelikey | kdebase - KDE Base metapackage | 09:01 |
| === ChaKy [n=chaky@lns02-0687.dsl.iskon.hr] has joined #ubuntu | ||
| triceratops | As we can see there are a lot of ways to have kde installed. :-)) | 09:02 |
| === laffer-pt [n=laffer@bl6-192-203.dsl.telepac.pt] has joined #ubuntu | ||
| === Amaranth [n=amaranth@ubuntu/member/amaranth] has joined #ubuntu | ||
| intelikey | hehhe doing urpmi kubuntu-desktop says "0 upgraded, 475 newly installed,..." that's a lot of dependancies. | 09:03 |
| === czbiao [n=czbiao@218.90.174.162] has joined #ubuntu | ||
| === overrider88 [n=override@218.16.58.208] has joined #ubuntu | ||
| czbiao | asdf | 09:04 |
| czbiao | hello | 09:04 |
| === Khisanth [n=Khisanth@pool-71-247-81-57.nycmny.east.verizon.net] has joined #ubuntu | ||
| intelikey | but urpmi ubuntu-desktop is bigger. 0 upgraded, 563 newly installed... | 09:04 |
| moxshax | 6c | 09:04 |
| intelikey | After unpacking 1135MB of additional disk space will be used. | 09:05 |
| === robitaille [n=daniel@ubuntu/member/robitaille] has joined #ubuntu | ||
| freakabcd | intelikey, urpmi is there on ubuntu? | 09:05 |
| triceratops | intelikey: ?urpmi? $whatthehellisthis | 09:05 |
| intelikey | for kubuntu After unpacking 923MB of additional disk space will be used. | 09:05 |
| freakabcd | i like urpmi on my mdk machines | 09:05 |
| === e-spy [n=metod@tech.spijon.com] has joined #ubuntu | ||
| czbiao | how to install skype | 09:05 |
| intelikey | oh i told yall i customizzzed everything. | 09:05 |
| === oneleaf [n=oneleaf@59.36.4.210] has joined #ubuntu | ||
| Hobbsee | !tell czbiao about skype | 09:06 |
| freakabcd | triceratops, yum->rh/fedora, urpmi->mdk, apt->deb | 09:06 |
| intelikey | yeah and i liked the way urpmi works so... | 09:06 |
| triceratops | freakabcd: OK, I see. Never used mandrake so far... | 09:06 |
| freakabcd | heh.. i've used many many iterations of mdk | 09:07 |
| freakabcd | s/iterations/releases(even cooker) | 09:07 |
| intelikey | well don't try it now. i hear they really pooped in their nest when the name changed to mandriva | 09:07 |
| triceratops | freakabcd: Wasn't there a drakconf used by mandrake? Thats what I have in mind, from long lasting times ago... | 09:07 |
| === ebaad [n=ebaad@c-67-181-129-148.hsd1.ca.comcast.net] has left #ubuntu ["Leaving"] | ||
| freakabcd | well, i don;t have any mandriva machines. only some mdk machines :) | 09:08 |
| freakabcd | i was still using 7.2 on one machine when they announced the name change | 09:08 |
| moxshax | hmm.. Mandrake, my first love. :D | 09:08 |
| intelikey | yeah drakconf harddrak mousedrak | 09:08 |
| freakabcd | harddrake mousedrake | 09:08 |
| freakabcd | why do you swallow the 'e' :p | 09:09 |
| === Profichilla [n=Miranda@p548DF7CD.dip.t-dialin.net] has joined #ubuntu | ||
| intelikey | i spent them all eariler | 09:09 |
| intelikey | sorry | 09:09 |
| === Amaranth [n=amaranth@ubuntu/member/amaranth] has joined #ubuntu | ||
| intelikey | i installed mdk9.0 on a lappy via floppy disks. old lappy. | 09:11 |
| === cerebrix [n=christia@cpe-66-27-155-245.socal.res.rr.com] has joined #ubuntu | ||
| freakabcd | heh.. after apt install kubuntu-desktop df shows used space 2.1 gig to 3.3 gig :O | 09:11 |
| Madpilot | freakabcd, neither Gnome nor KDE are really small setups... :P | 09:12 |
| triceratops | freakabcd: What else did you expect? It's quite the same for all the gnome stuff which is installed for ubuntu. | 09:12 |
| freakabcd | no. just mentioning it. | 09:12 |
| freakabcd | although i will end up using e17_cvs on here anyway | 09:12 |
| intelikey | hmm oh you still have the deb's in /var/cache do a sudo apt-get clean and then check. | 09:12 |
| freakabcd | i just love e :) | 09:13 |
| === Klowner_ [n=klown@porky118.revealed.net] has joined #ubuntu | ||
| triceratops | freakabcd: If you would like a system which has a small footprint give xubuntu a try. It damned good since dapper | 09:13 |
| === xstation [n=bliss1@4096.net] has joined #ubuntu | ||
| xstation | hi | 09:13 |
| === TSCHAK2 [n=thomas@71-208-166-27.hlrn.qwest.net] has joined #ubuntu | ||
| === aeolist_ [n=aeolist@ppp-229-039.dialup.ntua.gr] has joined #ubuntu | ||
| freakabcd | thanks intelikey. came down to 2.9 now. thats nto too bad | 09:14 |
| radiodog | xstation: hi | 09:14 |
| intelikey | triceratops will it fit on a 500m disk ? | 09:14 |
| === tvo [n=tobi@5354EA9B.cable.casema.nl] has joined #ubuntu | ||
| === Profichilla [n=Miranda@p548DF7CD.dip.t-dialin.net] has joined #ubuntu | ||
| moxshax | quit | 09:14 |
| === eduardo [n=eduardo@201.153.243.190] has joined #ubuntu | ||
| xstation | is there a gui where I can look at other OS which are in the ext3 format | 09:15 |
| xstation | on the the same hard drive | 09:15 |
| triceratops | intelikey: Hhhm, never had a xubuntu installation alone so far. But it will be at least a lot smaler than the regular (k)ubuntu installation. May be you will ask for this on #xubuntu? | 09:15 |
| === xsquared [n=mike@dsl-58-6-121-220.qld.westnet.com.au] has left #ubuntu ["Leaving"] | ||
| aeolist_ | xstation, that made little sense, do you want a cpu emulator or something? qemu? | 09:15 |
| aeolist_ | xstation you can just chroot to another system | 09:15 |
| aeolist_ | and do whatever there | 09:15 |
| === xota [n=neoworld@hiscpdprx01.upsa.es] has joined #ubuntu | ||
| triceratops | intelikey: But due to the fact that xorg is a big bunch of apps I would say it will need more disk space even if you use xubuntu | 09:16 |
| xstation | aeolist: I want to acess the grub conf file on dev/hda1 | 09:16 |
| xstation | I am in dev/hda3 | 09:16 |
| elkbuntu | intelikey, use DSL for a disk that small :) | 09:16 |
| narg | intelikey: with a disk that small, I'd suggest doing 'server' and picking stuff yourself to keep as small as possible. | 09:16 |
| narg | intelikey: or what elkbuntu said! | 09:17 |
| elkbuntu | DSL really is incredible | 09:17 |
| xstation | I cannot acess /dev/hda1 because of a segmentation error so since /dev/hda1 has set up grub I need to access the conf file | 09:18 |
| xstation | aeolist_: any ideas | 09:19 |
| === xota saluda! | ||
| === vijay [n=vijay@221.134.213.86] has joined #ubuntu | ||
| maxkelley | where are ssh logs in ubuntu? | 09:19 |
| Sir_Fawnpug | Anybody happen to know much about setting up the hotkeys on the Acer Aspire 3004WLCi? I need to get one of them working for my wireless. | 09:20 |
| === Donvinzk [n=vincent@26.43.101-84.rev.gaoland.net] has joined #ubuntu | ||
| aeolist_ | xstation, umount /dev/hda1, fsck it and then mount it and go to /boot | 09:20 |
| vijay | hi all, how to connect via vnc to another system | 09:20 |
| === Kritica [n=kritical@203.109.201.134] has joined #ubuntu | ||
| === neo_morpheus [n=neo@59.182.68.115] has joined #ubuntu | ||
| vijay | another ubuntu system | 09:21 |
| === mikul [n=mikul@81-233-78-174-no73.tbcn.telia.com] has joined #ubuntu | ||
| neo_morpheus | any idea when dapper is expected | 09:21 |
| elkbuntu | !dapper | 09:22 |
| ubotu | Dapper Drake will be the next release of Ubuntu - due June 1 (see: http://tinyurl.com/qyrkq). Join channel #ubuntu+1 for discussion :) | 09:22 |
| intelikey | hmmmm just got back and read all your "input" :) | 09:22 |
| === lloydinho [n=andreas@rosinante.egmont-kol.dk] has joined #ubuntu | ||
| === binary777 [n=binary@221.236.102.56] has joined #ubuntu | ||
| elkbuntu | intelikey, i have DSL installed on a 540mb disk, with a swap of like 128, and still space left over, so give it a go | 09:23 |
| neo_morpheus | are there any known issues of breezy with win98 ? | 09:23 |
| intelikey | dsl is ok. i have ubuntu hoary installed on here right now, because it is a full system rather than... whatever dsl is. oh and i have this hugh 96m ram so i don't use swap. | 09:24 |
| triceratops | elkbuntu: By DSL you are talking of ubuntu-server plus xubuntu-desktop? | 09:24 |
| neo_morpheus | it works fine with microshit XP for me | 09:24 |
| elkbuntu | DSL (damn small linux) is a full system | 09:24 |
| === phreak97 [n=phreak97@ppp223-64.lns2.adl4.internode.on.net] has joined #ubuntu | ||
| triceratops | elkbuntu: OK, damned acronyms... | 09:24 |
| elkbuntu | intelikey, http://damnsmalllinux.org | 09:24 |
| === intelikey thinks his idea of full system and elkbuntu's don't jive. | ||
| elkbuntu | lol | 09:25 |
| === ben [n=ben@iolaptop.rh.rit.edu] has joined #ubuntu | ||
| triceratops | elkbuntu: DSL, isn't epiaOS a derivate of DSL? | 09:25 |
| carthik | vijay, you need to have a vnc server running in one system, and connect to it from the other using tightvnc or similar. you can set up the server using system->administration-> and use tightvnc or similar. searching on google will yield better results than asking here :) | 09:26 |
| elkbuntu | triceratops, never heard of epiaOS, but DSL is a kneecapped debian | 09:26 |
| === rob [i=Robert@freenode/staff/ubuntu.member.rob] has joined #ubuntu | ||
| === domster [n=dominics@202-154-146-126.actrix.co.nz] has joined #ubuntu | ||
| === mahangu_ [n=mahangu@unaffiliated/mahangu] has joined #ubuntu | ||
| carthik | vijay, i recommend freenx, https://wiki.ubuntu.com/FreeNX gives full instructions. I got it working for me using only those instructions | 09:27 |
| intelikey | elkbuntu i said, i know about dsl i have it here on cd. and have used it some... if i was going to install a linux on a 100m hdd i'd use dsl. on this big 500m any flavour is fine. | 09:27 |
| carthik | d'oh, vijay quit sometime ago.... | 09:27 |
| === Bab2 [n=Bab2@211.220.36.63] has joined #ubuntu | ||
| intelikey | :) | 09:27 |
| === [SEAWOLF] [n=seawolf@host166-57.pool8261.interbusiness.it] has joined #ubuntu | ||
| === antoninus is now known as anto9us | ||
| elkbuntu | intelikey, i was actually telling triceratops what DSL was just then | 09:28 |
| === jtkawa [n=jtkawa@netblock-66-245-215-125.dslextreme.com] has joined #ubuntu | ||
| intelikey | i type slow. | 09:28 |
| === mendred [n=mendred@59.92.57.186] has joined #ubuntu | ||
| === Zappa [n=zappa@81-86-167-73.dsl.pipex.com] has joined #ubuntu | ||
| === RaphAstronome [n=sp01_nos@ADijon-256-1-75-176.w81-49.abo.wanadoo.fr] has joined #ubuntu | ||
| === FliesLikeALap [n=Ryan@vpnwl-228-125.net.rpi.edu] has joined #ubuntu | ||
| RaphAstronome | Bonjour, | 09:29 |
| === Selucresh [n=Selucres@CPE-65-30-180-7.wi.res.rr.com] has joined #ubuntu | ||
| intelikey | kneecapped ? ankletted maybe :) | 09:29 |
| === Tomcat_ [n=Tomcat@p54A18B7C.dip0.t-ipconnect.de] has joined #ubuntu | ||
| RaphAstronome | Oup, Hello ! | 09:29 |
| elkbuntu | intelikey, it's excellent for the laptop i have it on, which has the whole of 16mb ram | 09:30 |
| frank23 | !fr | 09:30 |
| ubotu | Allez a #ubuntu-fr ou #kubuntu-fr pour de l'aide et de la discussion en francais. | 09:30 |
| intelikey | main problem is know the guy that did dsl.... nough said. | 09:30 |
| === anstei [n=anstei@adsl-84-227-116-30.adslplus.ch] has joined #ubuntu | ||
| === johanbr [n=j@d154-20-231-240.bchsia.telus.net] has joined #ubuntu | ||
| RaphAstronome | elkbuntu > ok | 09:31 |
| === RaphAstronome [n=sp01_nos@ADijon-256-1-75-176.w81-49.abo.wanadoo.fr] has left #ubuntu [] | ||
| elkbuntu | o.O | 09:31 |
| intelikey | elkbuntu the lappy 'nec versa 80486' that i installed mdk8 on has 16m of ram and 256m hdd :) | 09:31 |
| intelikey | err mdk9 ^ | 09:31 |
| === jeddy3 [n=mattias@81-234-85-40-o1122.telia.com] has joined #ubuntu | ||
| elkbuntu | mdk? | 09:32 |
| freakabcd | mandrake | 09:32 |
| intelikey | yup. | 09:32 |
| elkbuntu | ah | 09:32 |
| elkbuntu | dsl is at least current | 09:32 |
| intelikey | oh sorry thought you went back that far in our convo ^ | 09:32 |
| === Kritical [n=kritical@203.109.201.134] has joined #ubuntu | ||
| === Imsdle [n=fesf@203.184.1.107] has joined #ubuntu | ||
| triceratops | elkbuntu: epiaOS is a gentoo derivate for via epia boards | 09:33 |
| intelikey | like software needs to be the latest release on a 486.... | 09:33 |
| elkbuntu | triceratops, yeah, i've gathered that from all this emerge talk in the forum | 09:33 |
| elkbuntu | intelikey, whatever tickles you ;) | 09:34 |
| maxkelley | triceratops: it's epiOS | 09:34 |
| Imsdle | my clock keeps going out.. its driving me nuts... i have setup the sync to internet servers thing but it still don't work | 09:35 |
| elkbuntu | Imsdle, how far out? | 09:35 |
| === hsienwen [i=hsienwen@hsnl20.cs.nthu.edu.tw] has joined #ubuntu | ||
| Imsdle | HOURS! | 09:35 |
| intelikey | battery ? | 09:35 |
| elkbuntu | Imsdle, which ubuntu version? | 09:35 |
| Imsdle | its only 7.36.. its showing 9.36 now | 09:35 |
| triceratops | maxkelley: Thats why it needed me so long oogling for it... :)) | 09:36 |
| === maskd [n=jacob@dsl-220-253-74-218.NSW.netspace.net.au] has joined #ubuntu | ||
| Imsdle | how do i find that out.. i have no idea | 09:36 |
| elkbuntu | Imsdle, ubuntu version as in dapper, or breezy? | 09:36 |
| selinium | Imsdle, sounds like your battery is on its way out, need replacing real quick, can cause other problems. | 09:36 |
| === gromitigo [n=gromitig@cpe-24-27-32-202.austin.res.rr.com] has joined #ubuntu | ||
| intelikey | hmmmm minutes correct, hours wrong; timezone error ? | 09:36 |
| selinium | Imsdle, how old is your machine? | 09:36 |
| === ubuntu [n=ubuntu@221-136-222-201.adsl.terra.cl] has joined #ubuntu | ||
| Imsdle | hmm ok i'll check it out | 09:36 |
| Imsdle | no time zone is right | 09:36 |
| === ubuntu [n=ubuntu@221-136-222-201.adsl.terra.cl] has left #ubuntu ["Leaving"] | ||
| elkbuntu | selinium, if you're aussie, join #ubuntu-au | 09:37 |
| elkbuntu | errr | 09:37 |
| elkbuntu | Imsdle --^ | 09:37 |
| Imsdle | the sync now button on time/date isn't activeated | 09:37 |
| Imsdle | how do i get that to work | 09:37 |
| triceratops | Imsdle: What says 'cat /etc/adjtime'? | 09:37 |
| selinium | elkbuntu, :) | 09:37 |
| maxkelley | mmm.. epia | 09:37 |
| elkbuntu | selinium, talking in tooo many places at once :P | 09:37 |
| === rixth [n=rixth@httpcraft/advocacy/rixth] has joined #ubuntu | ||
| === aphasia^jstad [n=justin-s@12-217-241-68.client.mchsi.com] has joined #ubuntu | ||
| rixth | How would I go about using te S-Vide out on my laptop under linux? | 09:37 |
| Imsdle | bash: /etc/adjtime: Permission denied | 09:38 |
| maskd | lmsdle, use sudo | 09:38 |
| Imsdle | i did | 09:38 |
| Imsdle | im in root | 09:38 |
| triceratops | elkbuntu: That's real multitalking... | 09:38 |
| intelikey | Imsdle do a ntpdate pool.ntp.org && hwclock --systohc | 09:38 |
| triceratops | Imsdle: Ok, so try 'sudo cat /etc/adjtime'? | 09:39 |
| rixth | I'm using the i810 driver | 09:39 |
| Imsdle | 30 Mar 21:39:51 ntpdate[19058] : the NTP socket is in use, exiting | 09:39 |
| === lucaaas [n=lucas@h91n8c1o1124.bredband.skanova.com] has joined #ubuntu | ||
| elkbuntu | Imsdle, where are you from, please? | 09:39 |
| Sir_Fawnpug | Anybody happen to have an Aspire 3004WLCi? I'm having probems getting my wireless to scan the networks | 09:40 |
| intelikey | improper setup in ntpdate. | 09:40 |
| triceratops | Imsdle: '30 Mar 21:39:51 ntpdate[1...' is not what I would expect seeing in /etc/adjtime... | 09:40 |
| elkbuntu | Imsdle, if you are australian, there is a time bug due to the delayed daylight savings time this year | 09:41 |
| intelikey | triceratops that wasn't from /etc/adjtime it was from ntpdate pool.ntp.org | 09:41 |
| Imsdle | im a kiwi.. in nz but using australian time servers.. might be the issue | 09:41 |
| elkbuntu | yes, it could be | 09:41 |
| Eleaf | kiwi!! | 09:41 |
| === Selucresh [n=Selucres@CPE-65-30-180-7.wi.res.rr.com] has joined #ubuntu | ||
| intelikey | akin to limey | 09:42 |
| === glbriones__ [n=jond3rd@203.131.79.132] has joined #ubuntu | ||
| === [129-CarNagE] [n=CarNi@dslb-084-057-229-117.pools.arcor-ip.net] has joined #ubuntu | ||
| Imsdle | catch you later guys.. thanks for the input | 09:42 |
| Imsdle | cya | 09:42 |
| === pitti [n=pitti@ubuntu/member/pitti] has joined #ubuntu | ||
| === [129-CarNi] [n=CarNi@dslb-084-057-229-117.pools.arcor-ip.net] has joined #ubuntu | ||
| triceratops | Imsdle: If the timeshift isn't growing I would say it is an argument for the delayed daylight savings time | 09:43 |
| intelikey | -:- SignOff Imsdle: #ubuntu ("Leaving") | 09:43 |
| rob | ? | 09:44 |
| intelikey | what it is rob ? | 09:44 |
| rob | whats the signoff thing? | 09:45 |
| maskd | he was just mentioning to triceratops that lmsdle was gone | 09:45 |
| === xstation [n=bliss1@4096.net] has joined #ubuntu | ||
| xstation | hi | 09:45 |
| maskd | or she | 09:45 |
| rob | ah | 09:45 |
| xstation | where is the grub conf file normally stored | 09:45 |
| triceratops | elkbuntu: Would using nz.pool.ntp.org help resolving Imsdle's problem. Just for curiosity | 09:46 |
| elkbuntu | triceratops, no idea. i'm not even sure that's his problem since he didnt even know what version of ubuntu he was using | 09:46 |
| intelikey | xstation none | 09:46 |
| Selucresh | Hey guys | 09:46 |
| intelikey | xstation see /boot/grub/menu.lst | 09:46 |
| elkbuntu | triceratops, i had a similar but unrelated problem using dapper, the timezone bug only affects breezy and older | 09:47 |
| maskd | hey Selucresh | 09:47 |
| fek | moin | 09:47 |
| === Hobbsee_ [n=Hobbsee@ubuntu/member/hobbsee] has joined #ubuntu | ||
| triceratops | elkbuntu: So let's hope that the aussies are the only ones who fizzle around delaying daylight saving times... | 09:47 |
| xstation | intelikey: thanks | 09:47 |
| elkbuntu | triceratops, it was cos our govt delayed daylight savings for the commonwealth games | 09:47 |
| intelikey | triceratops no pool.ntp.org hits random time servers all over the world. | 09:47 |
| triceratops | elkbuntu: I don't need to have this to be honest.. | 09:47 |
| === Hobbsee_ is now known as Hobbsee | ||
| === YaH00 [n=YaH00@cpmsq.epam.com] has joined #ubuntu | ||
| === monger [n=peter@cc613448-a.groni1.gr.home.nl] has joined #ubuntu | ||
| maskd | the bloke could have just manually changed it with set date and time, i dont see why he didnt | 09:48 |
| === aeolist [n=aeolist@ppp173.dialup.ntua.gr] has joined #ubuntu | ||
| === bingogu [n=bingogu@211.161.61.224] has joined #ubuntu | ||
| triceratops | intelikey: But didn't nz.pool.... give timesavers from nz only? So it is at least in Germany for de.pool... | 09:48 |
| elkbuntu | maskd, because it resets to the wrong time at every single reboot | 09:48 |
| === FreeDoom [n=liven@58.Red-80-38-21.staticIP.rima-tde.net] has joined #ubuntu | ||
| === glbriones__ is now known as jond3rd | ||
| intelikey | maskd but two hours off is not a daylight savings issue. it looks like a time zone issue to me. | 09:49 |
| === FreeDoom [n=liven@58.Red-80-38-21.staticIP.rima-tde.net] has left #ubuntu [] | ||
| triceratops | intelikey: s/timesavers/timeservers/ Timesavers would be a good idea to have... *laugh* | 09:49 |
| maskd | oh ok, i wasnt here when he mentioned that it was 2 hours off | 09:49 |
| intelikey | triceratops :) | 09:50 |
| === mahangu [n=mahangu@unaffiliated/mahangu] has joined #ubuntu | ||
| elkbuntu | intelikey, it could be a combination of bad timezone choice and also the daylight savings bug | 09:51 |
| intelikey | triceratops i don't see how using only local servers/savers :) would help tho. it still looks like a config problem. | 09:51 |
| intelikey | elkbuntu yes i agree. | 09:51 |
| triceratops | intelikey: Only if nz and au use different timezone / daylight saving time | 09:51 |
| aphasia^jstad | goodbye fedora, hello ubuntu | 09:52 |
| === st_lim [n=st_lim@cm85.sigma247.maxonline.com.sg] has joined #ubuntu | ||
| Hobbsee | elkbuntu: i'm in aussie, and the timezones seem fine here...not sure why | 09:52 |
| === GigaByte_ [n=kranian@222.114.149.180] has joined #ubuntu | ||
| intelikey | triceratops but all time servers report gmt time don't they ? | 09:52 |
| elkbuntu | hobbsee only some people had the prob i believe | 09:52 |
| === Morphs [n=morphs@ns0.bsdbox.co.uk] has joined #ubuntu | ||
| === render [n=render@213-140-21-234.fastres.net] has joined #ubuntu | ||
| === xstation [n=bliss1@4096.net] has joined #ubuntu | ||
| Hobbsee | elkbuntu: ah ok | 09:53 |
| === Morphs [n=morphs@ns0.bsdbox.co.uk] has left #ubuntu ["Leaving"] | ||
| xstation | hi | 09:53 |
| maskd | gday | 09:53 |
| elkbuntu | Hobbsee, why dont i see you in #ubuntu-au? | 09:53 |
| === hsienwen [i=hsienwen@hsnl20.cs.nthu.edu.tw] has left #ubuntu [] | ||
| liable | why bother with a n -au channel? | 09:53 |
| Hobbsee | elkbuntu: didnt know it existed | 09:53 |
| === khisanth_ [n=Khisanth@pool-71-247-81-57.nycmny.east.verizon.net] has joined #ubuntu | ||
| liable | out of interest | 09:53 |
| === Hobbsee is kind of already connected to enough channels as it is lol | ||
| elkbuntu | you do now! *cracks a whip and herds you in* | 09:54 |
| xstation | looking into /dev/hd1 from dev/hda3 get this from command line brw-rw---- 1 root disk 3, 1 2006-03-30 08:14 /dev/hda1 | 09:54 |
| xstation | how to explore further | 09:54 |
| triceratops | Hobbsee: May be you are out of sync to your local time and are not aware yet. Which might be in a country as big as au and beeing somwhere in the outback. (yust joking) | 09:54 |
| elkbuntu | hobbsee, /whois me, you aint got nuttin on my list | 09:54 |
| Hobbsee | hehe | 09:54 |
| rob | elkbuntu, oh? :P | 09:55 |
| Hobbsee | hehe | 09:55 |
| elkbuntu | rob, i dont even -want- to see yours | 09:55 |
| === _spiritz [n=spiritz@61.12.41.143] has joined #ubuntu | ||
| maskd | you know.. ive never been to the outback | 09:55 |
| intelikey | xstation if you could reword that question, i might be able to answer it. | 09:55 |
| intelikey | ? | 09:55 |
| Hobbsee | triceratops: well, according to my watch, its the correct time | 09:55 |
| elkbuntu | Hobbsee, it could have been a vic/nsw problem, qld/wa/nt/tas may not have been affected, i really dont know the intracate details | 09:56 |
| Hobbsee | elkbuntu: it's only 1 more than yours, not that bad... | 09:56 |
| Hobbsee | elkbuntu: i'm in nsw | 09:56 |
| maskd | Hobbsee: Syd? | 09:56 |
| Hobbsee | maskd: yes | 09:56 |
| === FliesLikeALap [n=Ryan@vpnwl-228-9.net.rpi.edu] has joined #ubuntu | ||
| triceratops | Hobbsee: According to my watch I'm always in the office when I should be. But my collegues told me that I'm an hour late. So it was sometimes in the past. What says that a watch don't help if you miss the daylight savings time change... | 09:57 |
| === dr3as [n=dr3as@56.84-48-126.nextgentel.com] has joined #ubuntu | ||
| Hobbsee | hehe | 09:58 |
| === Flik [n=mbamford@d205-250-148-56.bchsia.telus.net] has joined #ubuntu | ||
| xstation | intelikey: yes your correct, I am trying to look at /dev/hda1 from /dev/hda3 you see I cannot boot into this partition because of a segmentation error I need to get at the grub conf file | 09:58 |
| === redxninja [n=redxninj@c-67-189-39-74.hsd1.or.comcast.net] has left #ubuntu [] | ||
| === jj__ [n=jj@c-69-143-50-245.hsd1.va.comcast.net] has joined #ubuntu | ||
| jj__ | hi | 09:59 |
| jj__ | Where can I fild a bug report about KDE 3.5.2 ?? | 09:59 |
| triceratops | Hobbsee: For this it is always good to have a long wave radio clock somwhere arround... (BTW this year I noticed that it got broken. Ive been an hour late to the office last week... (murpys law) | 09:59 |
| intelikey | xstation you do know that /dev/hda3 is the device node for, the third primary partition on your first ide master hard drive ? so you need to mount /dev/hda1 /mnt/ and work in /mnt/boot/grub/ i think that is what you are asking. | 10:00 |
| jj__ | I mean for KBUNTU | 10:00 |
| === emuzesto [n=einar@56.80-203-123.nextgentel.com] has joined #ubuntu | ||
| Hobbsee | triceratops: ouch. i've done that before - walked into work, an hour out | 10:00 |
| === Deserir [i=greeny@226gis182.gulftel.com] has joined #ubuntu | ||
| rixth | Adding "Option "MonitorLayout" "DFP, TV" to xorg.conf made S-Video out work BUT there is no colours | 10:00 |
| === _apollo2011_ [n=Kevin@69.177.182.215] has joined #ubuntu | ||
| triceratops | Hobbsee: What I would like to see is beeing honoured to be an hour early in autum. What till now never happened, and I've been an hour early in the past. | 10:01 |
| Hobbsee | hehe | 10:01 |
| xstation | intelikey: yes you are correct I will try as suggested thankyou | 10:01 |
| === triceratops laughing | ||
| === lukasz [n=lukasz@klient-213-210.petrus.com.pl] has joined #ubuntu | ||
| === Tomcat_ [n=Tomcat@p54A18B7C.dip0.t-ipconnect.de] has joined #ubuntu | ||
| lukasz | witam | 10:02 |
| lukasz | wie ktos moze jak zainstalowac | 10:02 |
| === WolfLaptop [n=wolf@213.196.14.254] has joined #ubuntu | ||
| lukasz | jaki komunikator gg i tlena ? | 10:02 |
| intelikey | xstation if english is not your native language, it might help you also to try #ubuntu-<your_language> just a thought. | 10:02 |
| bingogu | how can i put a shortcut of rabish bin on my desktop? | 10:03 |
| === phr023n [n=phr023n@219.95.99.246] has joined #ubuntu | ||
| intelikey | like /join #ubuntu-es for spanish speaking peoples. | 10:03 |
| xstation | intelikey: yes I will try | 10:03 |
| === we2by [n=jiji@h8441153081.dsl.speedlinq.nl] has joined #ubuntu | ||
| we2by | hi | 10:04 |
| maskd | bingogu: use synaptic to install gtweakui | 10:04 |
| we2by | what do I need to install to compile kernel and software?? | 10:04 |
| intelikey | !b-e | 10:04 |
| ubotu | methinks b-e is no make ? you need build-essential or if you get errors saying gcc cannot create executables, or that you can't find header files like stdio.h, you need to do a sudo apt-get install build-essential. | 10:04 |
| === lukasz [n=lukasz@klient-213-210.petrus.com.pl] has left #ubuntu ["Konversation] | ||
| === wangwei [n=wangwei@222.172.221.99] has joined #ubuntu | ||
| maskd | bingogu: Then go to Preferences > gTweakUI - Nautilus | 10:04 |
| we2by | ? | 10:05 |
| intelikey | we2by b-e that's what you are looking for, | 10:05 |
| wangwei | hi, everyone | 10:05 |
| === TranceRiver [n=Jedwady@c-24-118-40-167.hsd1.mn.comcast.net] has joined #ubuntu | ||
| we2by | I want to reocmple the kernel | 10:05 |
| we2by | I need the develepment packages | 10:05 |
| bajek | which command I can display usage memory and cpu ? | 10:06 |
| intelikey | free | 10:06 |
| === xstation [n=bliss1@4096.net] has joined #ubuntu | ||
| intelikey | cpu.... hmmmmm | 10:06 |
| maskd | bajek: gnome-system-monitor | 10:07 |
| maskd | that is if your in gnome | 10:07 |
| xstation | intelikey: it is saying at prompt mount: you must specify the filesystem type | 10:07 |
| bajek | i mean " top " - but thanks :) | 10:07 |
| === maton [n=maton@12-219-201-80.client.mchsi.com] has joined #ubuntu | ||
| DBO | free doesnt seem to be terribly accurate for large amounts of RAM | 10:07 |
| === tepez [n=dontknow@85-65-135-108.barak-online.net] has joined #ubuntu | ||
| === s1 [n=magnus@c-61ed70d5.042-203-6c756e10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| we2by | when you compile a kernel on a amd 64. should I apply the same steps I used on a 32bit cpu?? | 10:07 |
| === foxpaul [n=phendric@host81-138-210-156.in-addr.btopenworld.com] has joined #ubuntu | ||
| xstation | ext3 but where at prompt is this inserted | 10:07 |
| triceratops | we2by: praat u duits? If so maybe the dahb (debian Anwender Handbuch) by Frank Ronneberg might be a good starting point. There are some chapters about building kernels the Debian way. | 10:08 |
| intelikey | xstation that's not good. what type is it ? | 10:08 |
| intelikey | xstation use fdisk -l /dev/hda | 10:08 |
| tepez | Anyone knows what is the page size on Linux/i386? | 10:08 |
| intelikey | memry pages ? | 10:09 |
| xstation | intellikey: it is ext3 | 10:09 |
| tepez | yes | 10:09 |
| intelikey | xstation then you may not be root or the directory /mnt may not exist. | 10:10 |
| === possie [n=Possie@cp19535-a.dbsch1.nb.home.nl] has joined #ubuntu | ||
| xstation | intelikey just a minute please | 10:10 |
| intelikey | tepez sorry i don't know. maybe Hobbsee or someone does. | 10:11 |
| xstation | intelikey; /dev/hda1 * 1 2690 21607393+ 83 Linux | 10:11 |
| tepez | is there any forum I can post my question on? | 10:11 |
| === [1] wenko [n=wenko@142.232.8.200] has joined #ubuntu | ||
| intelikey | mount sometimes blurts out some funny errors when it fails. try ls /mnt | 10:12 |
| TranceRiver | Could someone quickly run a shell script for me? I don't have access to a linux computer currently. To create a txt file and send it to me via email or DCC? | 10:12 |
| we2by | what do I need to install to compile kernel and software?? | 10:12 |
| intelikey | tepez yeah ubuntu forums look on the main page for the link. | 10:12 |
| xstation | intelikey : you mean mnt command is not installed or the /dev/hda1 cannot be mounted | 10:13 |
| TranceRiver | for i in `seq 1 14500`; do echo http://faceanalyzer.com/images/members/$i_rs.jpg; done > file | 10:13 |
| TranceRiver | could someone do that command and send me the product? | 10:13 |
| intelikey | we2by sudo apt-get install build-essential linux-source-<version> | 10:13 |
| mahangu | how can i make /media/hda5 writeable by all users? | 10:14 |
| jj__ | Is it NTFS? | 10:14 |
| maskd | your trying to capture all the images of people's faces TranceRiver | 10:14 |
| intelikey | xstation no i mean the dirrectory/folder /mnt may not exist. | 10:14 |
| === Frogzoo [n=Frogzoo@202.155.165.25] has joined #ubuntu | ||
| === cadenss [n=null@68-234-226-249.lmdaca.adelphia.net] has joined #ubuntu | ||
| TranceRiver | :). I do have a purpose. | 10:15 |
| TranceRiver | Could you do it and send me the txt maskd? | 10:15 |
| jj__ | mahangu is hda5 ntfs or fat32 or what? | 10:15 |
| === ToadZzZztool is now known as Toadstool | ||
| mahangu | jj__, fat32 | 10:15 |
| xstation | intelikley: dmdm@xstation:~$ sudo mount /dev/hd1 /mnt/ | 10:15 |
| xstation | Password: | 10:15 |
| xstation | mount: you must specify the filesystem type --what is other option if it does not exist | 10:15 |
| === eth42 [n=peter@b132.ext.vpn.lrz-muenchen.de] has joined #ubuntu | ||
| me2win | xstation, you aren't defining a file system type, what kind is it? | 10:16 |
| jj__ | you'll need to have it mounted as rw, check your /etc/fstab | 10:16 |
| === Hobbsee is now known as Hobbsee_away | ||
| intelikey | sudo mount /dev/hd1 /mnt | 10:16 |
| xstation | me2win: do you mean it is a ext3 file system? | 10:16 |
| eth42 | does anyone know what "usb 1-1: device descriptor read/64, error -71" in dmesg means? | 10:16 |
| eth42 | this is the message that I usually get if I plug in my usb mouse... | 10:16 |
| mahangu | jj__, i edited fstab but havent booted yet. how can i do it atm? | 10:17 |
| me2win | mahangu, http://ubuntuguide.org/#mountunmountfat | 10:17 |
| me2win | read that | 10:17 |
| mahangu | thanks me2win | 10:17 |
| me2win | its 2 lines of reading, solves all your problems :P | 10:17 |
| === atollena [n=antoine@acces1368.res.insa-lyon.fr] has joined #ubuntu | ||
| intelikey | xstation you can not mount /dev/hd1 no such device. it is /dev/hda1 | 10:17 |
| intelikey | sudo mount /dev/hda1 /mnt | 10:17 |
| jj__ | mahangu do a 'umount /dev/hda5' then a 'mount -a' | 10:17 |
| jj__ | sudo in front of both of those | 10:18 |
| me2win | jj__, doesnt he only have to mount -a, it umounts and remounts them all anyway | 10:18 |
| me2win | or it remounts fstab | 10:18 |
| me2win | i suppose it doesnt matter anyway, lol | 10:19 |
| jj__ | Not sure but I don't think mount -a unmounts anything | 10:19 |
| === C-O-L-T [n=hunika@193.231.163.10] has joined #ubuntu | ||
| malv | it mounts everything | 10:19 |
| malv | in the /etc/fstab file | 10:19 |
| malv | man mount | 10:19 |
| === _apollo2011_ [n=Kevin@69.177.182.215] has joined #ubuntu | ||
| jj__ | I know.. but it doesn't unmount anything | 10:20 |
| xstation | intelikey: sorrey my mistake now what happens it just excutes the command and promt is back which means I thionk it is mounted? | 10:20 |
| C-O-L-T | there is no newer version of xmms which supports video too? | 10:20 |
| Tallia1Kubuntu | guys? someone knows if i can get out the HD 20GB from my creative touch and use it as an external ? | 10:20 |
| intelikey | mount -a doesn't umount | 10:20 |
| === TheRabbit [n=andrew@adsl-70-228-140-13.dsl.akrnoh.ameritech.net] has joined #ubuntu | ||
| intelikey | xstation yes now you may access your files in /mnt/ | 10:20 |
| me2win | i didnt mean to say unmount, i just meant remount | 10:20 |
| === TheRabbit [n=andrew@adsl-70-228-140-13.dsl.akrnoh.ameritech.net] has left #ubuntu ["Leaving"] | ||
| jj__ | you said mount | 10:21 |
| === [Nige] [n=nige@ppp127-77.lns2.bne3.internode.on.net] has joined #ubuntu | ||
| s1 | where do I change the preferred desktop to KDE from GNOME? | 10:21 |
| jj__ | :) | 10:21 |
| mahangu | jj__, i had to mount as rw,umask=000 , but thanks anyway :) | 10:21 |
| mahangu | s1, you need to apt-get install kubuntu-desktop | 10:21 |
| xstation | intelikey : but at command prompt must I always use /mnt/ before each command is invoked? | 10:22 |
| jj__ | yw mahangu | 10:22 |
| intelikey | me2win but it doesn't remount them either. it only mounts things not mounted that are setup in fstab to mount automaticly | 10:22 |
| === G0SUB [n=ghoseb@ubuntu/member/g0sub] has joined #ubuntu | ||
| s1 | mahangu: alright, and when I want to change back I emerge ubuntu-desktop? | 10:22 |
| mahangu | s1, emerge is a gentoo command afaik | 10:22 |
| mahangu | s1, you can switch between gnome/kde at startuip | 10:22 |
| mahangu | *login | 10:22 |
| intelikey | xstation no. cd /mnt/boot/grub/ | 10:22 |
| mahangu | s/startup/login | 10:22 |
| sfaris | s1, you can select "session" at login :) | 10:23 |
| intelikey | then you can just nano menu.lst xstation | 10:23 |
| s1 | mahangu: sorry, you see where I come from... ;) | 10:23 |
| intelikey | if that is the target.... | 10:23 |
| sfaris | so you can have both at the same time actually | 10:23 |
| s1 | mahangu: alright, sounds easy | 10:23 |
| === anto9us [n=anthony@cpc1-ptal1-0-0-cust555.swan.cable.ntl.com] has joined #ubuntu | ||
| xstation | intelikey or use kedit | 10:23 |
| s1 | mahangu: thank you! | 10:23 |
| intelikey | yes. i was only giving an example. xstation | 10:24 |
| === obontu [n=obontu@80.179.185.46.static.012.net.il] has joined #ubuntu | ||
| obontu | hello, any good mp3 tagging apps for ubuntu? | 10:24 |
| === mendred [n=mendred@59.92.36.98] has joined #ubuntu | ||
| === stamen [n=stamen@84.54.190.158] has joined #ubuntu | ||
| Tallia1Kubuntu | guys? someone knows if i can get out the HD 20GB from my creative touch and use it as an external ? | 10:24 |
| intelikey | mp3 yuch ! use ogg. | 10:24 |
| Madpilot | obontu, EasyTag or Cowbell (I like EasyTag more, but try them both) | 10:25 |
| maskd | obontu: http://help.ubuntu.com/starterguide/C/ch03.html#id2526617 | 10:25 |
| maskd | i'd use ogg, but then i couldnt listen to them on my ipod | 10:25 |
| xstation | intelikey: thankyou for time and help it is very kind of you | 10:26 |
| === johanbr [n=j@d154-20-231-240.bchsia.telus.net] has left #ubuntu [] | ||
| === firepol [n=firepol@62.48.118.133] has joined #ubuntu | ||
| === [1] wenko is now known as wenko | ||
| intelikey | you're welcome xstation | 10:26 |
| === Digis [n=digis@193.219.137.203] has joined #ubuntu | ||
| stamen | 10:27 | |
| stamen | hello | 10:27 |
| sfaris | hello dude | 10:27 |
| stamen | how can I get a kind of plugin for windows media player | 10:28 |
| stamen | and to play online movies | 10:28 |
| maskd | through firefox stamen? | 10:29 |
| stamen | in linux, they made the web site to play the movies with windows media player | 10:29 |
| stamen | ok | 10:29 |
| stamen | I will watch for plugin | 10:29 |
| === SKoRM [n=SKoRM@d58-104-149-243.dsl.nsw.optusnet.com.au] has joined #ubuntu | ||
| stamen | thank you | 10:29 |
| maskd | if you can get the url of the movie, you can always play it with VLC | 10:29 |
| intelikey | !vlc | 10:30 |
| ubotu | I guess vlc is a video/audio player that supports almost everything - See http://www.videolan.org/ for more information (VLC is in the repos) | 10:30 |
| maskd | i love vlc | 10:30 |
| SKoRM | hey people, can any one hint me towards some way of speeding up ubuntu, im running it on a old laptop | 10:30 |
| intelikey | !botsnack | 10:30 |
| ubotu | :) | 10:30 |
| intelikey | drop the lappy out the window.... that will speed it up for a few seconds... | 10:31 |
| jj__ | might be easier to use a linux distribution that has a smaller impact | 10:31 |
| maskd | SKoRM: try a distribution that doesnt use gnome | 10:31 |
| maskd | or kde | 10:31 |
| === chrono13 [n=devnull@68-118-73-120.dhcp.rsbg.or.charter.com] has joined #ubuntu | ||
| === phr023n_ [n=phr023n@219.93.196.136] has joined #ubuntu | ||
| SKoRM | hmm | 10:31 |
| jj__ | You could put the laptop on a jet.. that would speed it up. | 10:31 |
| === khisanth_ [n=Khisanth@pool-71-247-3-37.nycmny.east.verizon.net] has joined #ubuntu | ||
| maskd | SKoRM: xubuntu might work well | 10:31 |
| === SKoRM googles xubuntu | ||
| me2win | !xubuntu | 10:32 |
| ubotu | somebody said xubuntu was Ubuntu using XFCE instead of Gnome for the desktop. Details here: https://wiki.ubuntu.com/Xubuntu | 10:32 |
| === chrono13 [n=devnull@68-118-73-120.dhcp.rsbg.or.charter.com] has left #ubuntu [] | ||
| === _eliphas [n=eliphas_@host217-41-36-56.in-addr.btopenworld.com] has joined #ubuntu | ||
| maskd | i couldnt get xubuntu to work properly with an old IBM | 10:32 |
| maskd | video was completely screwed | 10:33 |
| === xvlun [n=jan@wll192-68.wlan.hu-berlin.de] has joined #ubuntu | ||
| intelikey | SKoRM but seriously. it can be trimmed to a lean system but turning off all the un-nesseccery stuff that starts at boot time and removing gnome and using xfce4 or fvwm or the like. | 10:33 |
| SKoRM | ubuntu was the only distro i could actully get to run, most other distros fall on it :( | 10:33 |
| === jond3rd [n=jond3rd@203.131.79.132] has joined #ubuntu | ||
| SKoRM | how can i remove uncessery stuff at boot time, havnt used linux for a very very long time | 10:34 |
| === JustinLei [n=justinle@222.188.203.108] has joined #ubuntu | ||
| maskd | xubuntu should work if ubuntu works | 10:34 |
| === croftyboy_30 [n=crofty_b@213-162-105-135.markcr930.adsl.metronet.co.uk] has joined #ubuntu | ||
| stamen | 10:35 | |
| stamen | I found one plugin for media player | 10:35 |
| SKoRM | its under a init file or somthing aint it ? | 10:35 |
| stamen | but there is no version for Linux | 10:35 |
| intelikey | if possable even remove udev although you loose a lot of automation, automation is expancive. | 10:35 |
| stamen | I am searching in FF site | 10:35 |
| === Journich [n=journich@219-90-162-149.ip.adam.com.au] has joined #ubuntu | ||
| intelikey | stamen yes symlinks in /etc/rc?.d/ dirs. | 10:36 |
| jj__ | mplayer is another good media player | 10:36 |
| === slack_prad [n=slack_pr@59.92.52.163] has joined #ubuntu | ||
| stamen | yes, but how to make him to play the movies | 10:36 |
| === slack_prad [n=slack_pr@59.92.52.163] has left #ubuntu [] | ||
| croftyboy_30 | I am having problems with macromedia flash on ubuntu 5.04,the flash programme comes up and there is no text on the screen like the font is the same colour at the background | 10:36 |
| intelikey | ooops SKoRM ^ not stamen | 10:36 |
| === nemo__ [n=nemo@dsl-16-247.parnet.fi] has joined #ubuntu | ||
| stamen | aa ok | 10:37 |
| stamen | :) | 10:37 |
| anstei | croftyboy_30: this looks like you don't have the fonts that flash uses | 10:37 |
| === me2win [n=me2win@adsl-69-152-250-70.dsl.snantx.swbell.net] has joined #ubuntu | ||
| === eth42 [n=peter@b132.ext.vpn.lrz-muenchen.de] has left #ubuntu [] | ||
| croftyboy_30 | How would I find out the fonts it needs? | 10:37 |
| anstei | croftyboy_30: try downloading mstcorefonts from the multiverse repository | 10:37 |
| SKoRM | thnkz intelikey | 10:37 |
| croftyboy_30 | Will i find that in the package manager , I am still quite new too linux | 10:38 |
| intelikey | SKoRM want a list of what i have running so you kinda know what is needed ? | 10:38 |
| SKoRM | is the normal init is 6 | 10:38 |
| Madpilot | croftyboy_30, yes, it's in Ubuntu repos | 10:38 |
| rubso | hey guys, do you know how to share my connection to my Xbox 360? | 10:38 |
| SKoRM | yes please intelikey | 10:38 |
| Madpilot | croftyboy_30, search for corefonts | 10:38 |
| jj__ | rubso, yes get one of those router/firewall hubs at the computer store | 10:39 |
| intelikey | SKoRM runlevel will show what you are in now. | 10:39 |
| rubso | i have a router, and i'm connected to the ineternet by this wireless router, i want to share my internet connection from my PC to the X360 .. | 10:39 |
| jj__ | rubso, a linksys WRT54GS is a good one | 10:40 |
| me2win | rubso: need a wireless adapter for your xbox | 10:40 |
| me2win | either that or jack it into a network cable | 10:40 |
| === GutterPunk [n=steven@d51526A3E.access.telenet.be] has joined #ubuntu | ||
| jj__ | or use an ethernet cable from your xbox to your router, not your PC | 10:40 |
| intelikey | SKoRM you probably only want to mess with S and 2 | 10:40 |
| croftyboy_30 | its not finding anything when i do a search for corefonts | 10:40 |
| === geargolem [n=geargole@pool-72-72-128-72.hrbgpa.dsl-w.verizon.net] has joined #ubuntu | ||
| SKoRM | k thnkz | 10:41 |
| anstei | croftyboy_30: did you enable the multiverse repository? | 10:41 |
| intelikey | SKoRM i think everything listed there is pretty essential. | 10:41 |
| croftyboy_30 | how do i do that sorry? | 10:41 |
| anstei | !tell croftyboy_30 about repos | 10:41 |
| === noaXess [n=noaxess@adsl-du-217-11-45-147.cybernet.ch] has joined #ubuntu | ||
| stamen | please give the link for the mozilla plug in that plays windows media player files | 10:42 |
| === skuldfan [n=skuldfan@222.109.238.131] has joined #ubuntu | ||
| stamen | I can't find him | 10:42 |
| LoCusF | !b-e | 10:42 |
| ubotu | b-e is, like, totally, no make ? you need build-essential or if you get errors saying gcc cannot create executables, or that you can't find header files like stdio.h, you need to do a sudo apt-get install build-essential. | 10:42 |
| jj__ | rubos, you can get a crossover ethernet cable to connect your xbox to your pc.. then enable ip forwarding on your pc | 10:42 |
| === Hari [n=ubuntu@62.38.68.185] has joined #ubuntu | ||
| intelikey | flashplayer-mozilla - Macromedia Flash Player | 10:43 |
| intelikey | mozilla-mplayer - MPlayer-Plugin for Mozilla, Konqueror and OpenOffice.org | 10:43 |
| Hari | Hi | 10:44 |
| maskd | hey | 10:44 |
| intelikey | from you friendly apt-cache command. | 10:44 |
| Hari | I am new in ubuntu | 10:44 |
| stamen | ok | 10:44 |
| me2win | Hari: welcome | 10:44 |
| stamen | I will try now | 10:44 |
| === J_element [n=freebsd@83.229.111.115] has joined #ubuntu | ||
| Hari | new to linux2 | 10:44 |
| J_element | where can i get my hands on the fstab file that automatically mounts vfat ( windows ) partitions | 10:45 |
| maskd | ubuntu has helped the learning curve thats for sure | 10:45 |
| Hari | I am running the live cd | 10:45 |
| geargolem | hello I apt-got blender 2.41 for dapper and I get this error; 'failure to allocate back buffer' | 10:45 |
| J_element | ubotu fstab | 10:45 |
| ubotu | the /etc/fstab file lists all drives and partitions but can be easily configured automatically with the diskmounter file found here http://www.ubuntulinux.nl/files/diskmounter See <partitions>. | 10:45 |
| Hari | How can I find my Hard Drives? | 10:45 |
| === Kritica [n=kritical@203.109.201.134] has joined #ubuntu | ||
| === eccf [n=fubar@cm111.sigma201.maxonline.com.sg] has joined #ubuntu | ||
| === sylvain [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has joined #ubuntu | ||
| === sylvain [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has left #ubuntu ["Quitte"] | ||
| intelikey | well Hari you need to format your hard drive burn your cd's and get rid of every trace of linux in your possession. cause if you don't do it now you will soon be hooked and never get away from it. | 10:46 |
| intelikey | !ntfs | 10:46 |
| ubotu | methinks ntfs is the filesystem used in Windows NT and newer; to automatically mount your NTFS partition: https://wiki.ubuntu.com/AutomaticallyMountMSWindowsPartitions | 10:46 |
| intelikey | hari ^ probably what you want. | 10:46 |
| stamen | I cant find a such plugin there | 10:46 |
| stamen | give me a link if you can | 10:46 |
| Hari | Sorry but it is not like that.I wish it was | 10:47 |
| === joe_ [n=joe@ppp43-76.lns2.syd6.internode.on.net] has joined #ubuntu | ||
| J_element | ubotu ndiswrapper | 10:47 |
| ubotu | I heard ndiswrapper is a way to support Windows wireless drivers, but it is buggy compared to native support. More info at https://wiki.ubuntu.com/WifiDocs/Driver/Ndiswrapper | 10:47 |
| maskd | stamen, open up synaptic and search for mozilla-mplayer | 10:47 |
| === scav [n=larsj@198.36.eidsiva.net] has joined #Ubuntu | ||
| intelikey | stamen do you have universe and multiverse setup in your sources.list ? | 10:47 |
| Hari | I am an advansed windows user | 10:47 |
| J_element | ubotu u rule :D | 10:47 |
| ubotu | J_element: I haven't a clue, try searching at http://ubuntu.cc.com.au/ | 10:47 |
| === honkzilla is now known as honk|afk | ||
| === malv [n=arthur@pool-71-103-34-110.lsanca.dsl-w.verizon.net] has joined #ubuntu | ||
| stamen | wait I will see | 10:48 |
| Hari | It is the fifth time I try to work with a linux. | 10:48 |
| intelikey | hari i feel sorry for you. really i do. that will make it a thousand times harder to learn linux. | 10:49 |
| Hari | I hope it is the lucky one | 10:49 |
| SKoRM | Hari, do you live in australia? | 10:49 |
| Hari | No , Greece | 10:49 |
| === harm [n=harm@82-171-74-86.dsl.ip.tiscali.nl] has joined #ubuntu | ||
| === ompaul [n=ompaul@ubuntu/member/ompaul] has joined #ubuntu | ||
| SKoRM | k, i know a hari, you sound at little like him ;) | 10:49 |
| intelikey | being a windows guru makes it very hard to learn linux. young kids and old granies pick it up real quick. | 10:49 |
| Hari | from Gr? | 10:50 |
| harm | intelikey thats not true | 10:50 |
| sfaris | true intelikey | 10:50 |
| === khisanth__ [n=Khisanth@pool-71-247-22-178.nycmny.east.verizon.net] has joined #ubuntu | ||
| harm | no i dont find that at all | 10:50 |
| SKoRM | i do | 10:50 |
| sfaris | well, in general its true | 10:50 |
| SKoRM | i think its quite true | 10:50 |
| intelikey | harm it's been my observation. | 10:50 |
| sfaris | people who only use the computer to write emails anb surf the web will do very well in linux | 10:50 |
| tonyyarusso | Hari: Did that link help get them mounted for you or are you still stuck? | 10:51 |
| harm | ah well iam very used to windows but with KDE the switch was easy,, and i loved apt-get install instead of finding software installers | 10:51 |
| SKoRM | intelikey, whats the defult password for root? | 10:51 |
| tonyyarusso | sfaris: But may need to have someone else install it for them. | 10:51 |
| cerebrix | someone have a handy link to some gaim beta 3 debs for dapper? | 10:51 |
| === darkness_ [n=darkness@cor11-ppp3647.hay.dsl.connect.net.au] has joined #ubuntu | ||
| Hari | what link? | 10:51 |
| tonyyarusso | Hari: From ubotu, about ntfs | 10:51 |
| harm | steam servers are so slow =X they cant even hook me up with 500kb/s | 10:51 |
| intelikey | SKoRM there is no root password unless you set one. | 10:51 |
| intelikey | !sudo | 10:51 |
| ubotu | sudo is, like, a command that will let users run commands as root. Look at http://wiki.ubuntu.com/RootSudo for all information. | 10:51 |
| intelikey | !root | 10:51 |
| ubotu | By default, the root password is locked in Ubuntu. Look at http://wiki.ubuntu.com/RootSudo for all information. | 10:52 |
| sfaris | tonyyarusso, evolution and firefox is shipped with ubuntu..and if they need help finding it, they probably would need that help in windows too :) | 10:52 |
| Hari | I do not anderstand. What link r u talking about? | 10:52 |
| === reiner_ [n=reiner@p54B22BA1.dip0.t-ipconnect.de] has joined #ubuntu | ||
| tonyyarusso | sfaris: I know that. A lot of those users wouldn't be comfortable sticking an install CD in and running it. They get scared. | 10:52 |
| SKoRM | thnkz | 10:52 |
| tonyyarusso | Hari: https://wiki.ubuntu.com/AutomaticallyMountMSWindowsPartitions | 10:52 |
| === StarKruzr [n=jtd@adsl-70-224-58-247.dsl.sbndin.ameritech.net] has joined #ubuntu | ||
| Hari | I will have a go now, Thanks | 10:53 |
| === phos-phoros [n=phos-pho@unaffiliated/phos-phoros] has joined #ubuntu | ||
| Eleaf | ,lll | 10:53 |
| harm | does anybody know how i might get my keyboards shortcut keys to work? like forward/vulumeup/browser keys? | 10:54 |
| === LeeJunFan_ [n=junfan@adsl-69-210-207-5.dsl.klmzmi.ameritech.net] has joined #ubuntu | ||
| sfaris | tonyyarusso, true.. but it's still easier for them to adapt to linux than more advanced windows users | 10:54 |
| tonyyarusso | sfaris: I agree. | 10:54 |
| sfaris | \o/ | 10:54 |
| tonyyarusso | sfaris: I'm hoping to convert a few myself here, through disk handouts, blogging, and recommending open source alternatives when their Windows apps break. | 10:55 |
| === ctd [i=ctd@incubus.progsoc.uts.edu.au] has joined #ubuntu | ||
| sfaris | me too :) | 10:55 |
| === tonyyarusso ponders the advanced Windows user: "I can't find the defraggin tool! Or my .NET framework stuff, for that matter. Maybe if I reboot..." | ||
| harm | tonyyarusso i found that i hated gnome.. any other ex-windows users had that? | 10:56 |
| harm | yah i still reboot after i install things :P instead of restarting things | 10:56 |
| CuriousCat | how do you screen capture in xfce? | 10:57 |
| tonyyarusso | harm: Well, my take on it was that I personally love Gnome, but fully understand why a Windows user would prefer KDE. I like the simplicity on my desktop. Maybe it will change, we'll see (I have a almost a dozen options in my "Sessions" menu right now to try). | 10:57 |
| BlueHeron | CuriousCat: do you have the gimp installed? | 10:57 |
| === vdm [n=vdm@82-217-43-204.cable.quicknet.nl] has joined #ubuntu | ||
| sfaris | thats a very annoying thing with windows.. when you do a fresh install, there is like 100 reboots needed (after updating, installing drivers, installing software (antivirus and so on)) | 10:57 |
| CuriousCat | BlueHeron, yup | 10:58 |
| BlueHeron | CuriousCat: you can open gimp, go to i believe capture or import and you can do it from their, a whole screen or one window. | 10:58 |
| tonyyarusso | sfaris: Nah, it's only like 15. Oh, and a few more for the other software you got. I'd say 50, tops. Until it breaks. | 10:58 |
| BlueHeron | CuriousCat: it is in file>acquire. | 10:58 |
| intelikey | oh you have played MicroReboot Windows also ? | 10:58 |
| tonyyarusso | intelikey: Eh? | 10:59 |
| intelikey | it's really not much of a game if you ask me | 10:59 |
| BlueHeron | sfaris: i know what you mean. | 10:59 |
| === sfaris agrees with intelikey | ||
| sfaris | game over all the time | 10:59 |
| intelikey | lol yep | 10:59 |
| CuriousCat | ok, thanks BlueHeron | 10:59 |
| BlueHeron | CuriousCat: you are welcome. | 10:59 |
| cerebrix | someone have a handy link to some gaim beta 3 debs for dapper? | 11:00 |
| harm | well i rember 98 required lots of reboots due to BSODs | 11:00 |
| === TiffOn [n=TiffOn@unaffiliated/tiff0n] has joined #ubuntu | ||
| SKoRM | sif | 11:00 |
| tonyyarusso | The worst is when you do a fresh install of original release XP, and then take the trek to windowsupdate... | 11:00 |
| SKoRM | slowly getting there.... | 11:00 |
| === Den [n=knoppix@dhcp-40-162.EECS.Berkeley.EDU] has joined #ubuntu | ||
| === vdm [n=vdm@82-217-43-204.cable.quicknet.nl] has joined #ubuntu | ||
| === Kezzer [n=Kezzer@88-105-244-13.dynamic.dsl.as9105.com] has joined #ubuntu | ||
| intelikey | iirc windows 3.1 was the last of the 'single reboot' installs..... | 11:01 |
| === AshenSugar [i=godfight@c-67-164-101-249.hsd1.or.comcast.net] has joined #ubuntu | ||
| === mahangu [n=mahangu@unaffiliated/mahangu] has joined #ubuntu | ||
| === BesoinAide [i=BSmaxScr@247.157.98-84.rev.gaoland.net] has joined #ubuntu | ||
| harm | tonyyarusso i have a pirated XP version which i cant update, but if i do a good firewall and use firefox w. noscript and more small security things i never have any problems | 11:01 |
| tonyyarusso | Has anyone heard the faintest rumour of a timeline for vv in Gaim? | 11:01 |
| AshenSugar | <<<<noob | 11:01 |
| tonyyarusso | intelikey: 3.1 is d*** stable too, don't know what happened to that. We still have a lappy running it. | 11:01 |
| BesoinAide | is nomewone speak french please ? | 11:01 |
| tonyyarusso | harm: Interesting. | 11:01 |
| === moklop [n=poop@ool-457518a1.dyn.optonline.net] has joined #ubuntu | ||
| tonyyarusso | !fr | 11:02 |
| ubotu | Allez a #ubuntu-fr ou #kubuntu-fr pour de l'aide et de la discussion en francais. | 11:02 |
| BesoinAide | merci | 11:02 |
| moklop | Hey does anyone here know the default password for root in the live ubuntu? | 11:02 |
| === BesoinAide [i=BSmaxScr@247.157.98-84.rev.gaoland.net] has left #ubuntu [] | ||
| AshenSugar | how hard is it to replace gnome with icewm on a clean ubu instal? | 11:02 |
| intelikey | moklop there aint one | 11:02 |
| anstei | !root | 11:02 |
| ubotu | By default, the root password is locked in Ubuntu. Look at http://wiki.ubuntu.com/RootSudo for all information. | 11:02 |
| moklop | aww | 11:02 |
| moklop | :( | 11:02 |
| moklop | ooh | 11:03 |
| moklop | thanks | 11:03 |
| rob | err.. not if you do an expert install :) | 11:03 |
| intelikey | do a sudo passwd and set if you like. | 11:03 |
| tonyyarusso | AshenSugar: Not much :) Especially if you leave Gnome on the disk and just don't use it; the removal's the only tricky part. | 11:03 |
| intelikey | rob on a live cd ^ | 11:03 |
| AshenSugar | thx im trying to setup an ancient laptop with linux | 11:03 |
| moklop | yeah thanks guys :D | 11:03 |
| AshenSugar | it hates 98% of the distros out there lol | 11:03 |
| harm | AshenSugar i suggest doing an ubuntu server install and then getting whichever GUI thing u want | 11:03 |
| rob | sure, I was commenting on the factiod though | 11:03 |
| BlueHeron | AshenSugar: how old? | 11:04 |
| === geargolem [n=geargole@pool-72-72-128-72.hrbgpa.dsl-w.verizon.net] has joined #ubuntu | ||
| === neo911 [n=neo911@220-245-214-98-act.tpgi.com.au] has joined #ubuntu | ||
| === Tidus [n=tidus@unaffiliated/tidus] has joined #ubuntu | ||
| tonyyarusso | AshenSugar: Just 'apt-cache search icewm' and install away. | 11:04 |
| AshenSugar | 233mmz 208mb ram 5.2gb hdd | 11:04 |
| sfaris | hehe | 11:04 |
| === e-spy [n=metod@tech.spijon.com] has joined #ubuntu | ||
| BlueHeron | AshenSugar: harm's suggestion is a good one, server install then gui. | 11:04 |
| harm | AshenSugar > DamnSmallLinux PuppyLinux | 11:04 |
| intelikey | but server install is not "default" rob | 11:04 |
| === dj-fu [n=deejay@60-234-218-124.bitstream.orcon.net.nz] has joined #ubuntu | ||
| === ozux [i=ozux@213.217.56.131] has joined #ubuntu | ||
| geargolem | $[sis_alloc.c:210] : Failure to allocate back buffer. | 11:04 |
| rob | intelikey, server install != expert install | 11:04 |
| tonyyarusso | AshenSugar: Pssht. That can run Ubuntu easy. | 11:04 |
| AshenSugar | needs to be easy to use and windows like harm | 11:04 |
| harm | yes instert the install CD, instead of hitting RETURN enter Server and then iht RETURn | 11:05 |
| AshenSugar | its got a shitty chips and tech 65530 video card :( | 11:05 |
| intelikey | <AshenSugar> 233mmz 208mb ram 5.2gb hdd <-- that will be fine for a default install. | 11:05 |
| AshenSugar | yeah i just want to get icewm installed because my mothers used that b4 | 11:05 |
| BlueHeron | intelikey: it will but doing a server install and then a gui install in my opinion is 50% faster. | 11:05 |
| harm | AsenSugar > DamnSmallLinux and Puppy linux are 50MB distro w. GUI and just complete... go check it out www.damnsmalllinux.org www.puppylinux.orgg | 11:05 |
| AshenSugar | shes use to win2k, but 2k runs soooo slow :P | 11:05 |
| ozux | How can I Start my Ubuntu Live in 1280x800 resolution?! in Knoppix I use screen=1280x800 cheatcoe (boot parameter) but in Ubuntu I can't find any thing! | 11:05 |
| === shreevatsa [n=shreevat@59.92.140.170] has joined #ubuntu | ||
| intelikey | rob server install != default install either | 11:06 |
| === rux_ [n=rux@203-214-5-30.dyn.iinet.net.au] has joined #ubuntu | ||
| AshenSugar | i have used dsl its ok for me to mess with but im talking for a 45yo woman whos a windows user(barly) | 11:06 |
| rob | yeah.. I did say it was :) | 11:06 |
| neo911 | guys what do you think of Compaq Presarion 2100? is it a good laptop? i'm planning to buy to use where i can experiment on Solaris... thx for any background info | 11:06 |
| SKoRM | time for the trail of truth, well my box boot up fully next boot ;) | 11:06 |
| e-spy | i have ati x800 when i switch betwen console and X computer frizes...:( i use draper drake | 11:06 |
| === me2win [n=me2win@adsl-69-152-228-72.dsl.snantx.swbell.net] has joined #ubuntu | ||
| BlueHeron | ozux: run sudo dpkg-reconfigure xserver-xorg and select the resolutions you want. you can then select them from the screen resolution area. | 11:06 |
| e-spy | can you halp me | 11:06 |
| === Pegasos989 [n=pekka@cs78165177.pp.htv.fi] has joined #ubuntu | ||
| AshenSugar | and i HATE xfce file manager | 11:07 |
| === rux_ is now known as [rux] | ||
| AshenSugar | total POS | 11:07 |
| AshenSugar | USELESS | 11:07 |
| tonyyarusso | AshenSugar: IceWM should work. You could also even try doing some changes to Gnome like putting the menu on the bottom instead of the top; could work too. | 11:07 |
| ozux | BlueHeron: Unfortunately 1280x800 is not in this List! | 11:07 |
| === MacSlow [n=mirco@dslb-084-063-004-204.pools.arcor-ip.net] has joined #ubuntu | ||
| === pierre__ [n=pierre@ip73.168.adsl.wplus.ru] has joined #ubuntu | ||
| intelikey | AshenSugar pull the cover, over clock that puppy. and do a default install. she'll love it. | 11:07 |
| harm | AshenSugar .. ur going to learn a 45 year old WOMAN no less howto use a computer.. wow respect | 11:07 |
| === AshenSugar grummbles about spending 45min trying to get a file off my usb drive under it | ||
| dj-fu | ozux, yes it is. I use 1280x800 right now | 11:07 |
| BlueHeron | ozux: yes you need to do sudo dpkg-reconfigure xserver-xorg | 11:07 |
| harm | my mother still makes me come over to empty her outlook Express | 11:07 |
| pierre__ | hello. How can i play some sound from console? | 11:07 |
| BlueHeron | ozux: do you mean in the xserver list? | 11:07 |
| AshenSugar | she knows windows basics | 11:07 |
| ompaul | AshenSugar, language, this channel is G rated :-)- | 11:07 |
| dj-fu | pierre__, what type of sound? There are many console players. | 11:08 |
| dj-fu | mpg321 <file.mp3> for mp3 | 11:08 |
| === _Robbo [i=Bob@CPE-203-45-224-245.qld.bigpond.net.au] has joined #ubuntu | ||
| geargolem | help, on blender startup-$[sis_alloc.c:210] : Failure to allocate back buffer. | 11:08 |
| dj-fu | err, mpg123 | 11:08 |
| ozux | Yes in Dpkg-reconfigure xserver-xorg :: monitor section I don't see any ting started with 128! | 11:08 |
| ozux | 1280! | 11:08 |
| pierre__ | dj-fu i'm looking for the simpliest wav player like 'play' in Fedora | 11:08 |
| SKoRM | lol, i wasw about to say | 11:08 |
| neo911 | guys what do you think of Compaq Presarion 2100? is it a good laptop? i'm planning to buy to use where i can experiment on Solaris... thx for any background info | 11:08 |
| harm | lol thx for the guide | 11:08 |
| croftyboy_30 | thanx ubotu for all your help going to have breakfast now and come back to it latter | 11:08 |
| === kleinlappies [n=kleinlap@dsl-165-230-14.telkomadsl.co.za] has joined #ubuntu | ||
| AshenSugar | i almost had desktopbsd installed but it lacks the xdriver for the c&t ct65530 video chip :( | 11:09 |
| === _Robbo [i=Bob@CPE-203-45-224-245.qld.bigpond.net.au] has left #ubuntu ["Leaving"] | ||
| harm | croftyboy ubotu is a bot | 11:09 |
| dj-fu | deejay@fuzionlaptop:~/Desktop/Music$ apt-cache search music|grep console | 11:09 |
| dj-fu | moc - ncurses based console audio player | 11:09 |
| kleinlappies | hi | 11:09 |
| harm | hi | 11:09 |
| kleinlappies | how do i open a bot in irssi? | 11:09 |
| === zaibiechu [n=woody@222.88.155.241] has joined #ubuntu | ||
| intelikey | open a bot ? | 11:10 |
| AshenSugar | i could use slax :P | 11:10 |
| kleinlappies | slax :P | 11:10 |
| kleinlappies | slax :P what does this do? | 11:10 |
| harm | AshenSugar iam not sure but SuSe10 is claiming to be the easiest distro atm.. | 11:10 |
| === rem [n=rem@adsl-136-183-bs1.datacomm.ch] has joined #ubuntu | ||
| SKoRM | intelikey, its diffentlay starting fastrer ;) | 11:10 |
| === khisanth__ [n=Khisanth@pool-71-247-58-217.nycmny.east.verizon.net] has joined #ubuntu | ||
| dj-fu | Ubuntu is by far the easiest | 11:10 |
| ozux | dj-fu: what is your Graphic Card?! | 11:10 |
| harm | kleinlappies slax has nothing to do w. ur bot qeustion | 11:10 |
| === rem_ [n=rem@adsl-136-183-bs1.datacomm.ch] has joined #ubuntu | ||
| === tonyyarusso is now known as tonyyarussosleep | ||
| kleinlappies | sorry | 11:11 |
| dj-fu | ozux, ATI x700 | 11:11 |
| === Hawk|- [n=Hawk@p549C87F4.dip0.t-ipconnect.de] has joined #ubuntu | ||
| AshenSugar | its ran vector b4 but the current versons have pos xfce, it runs ok but the file manager sux :( | 11:11 |
| harm | iam installing CounterStrike1.6 via steam.. but do i need some videocard drivers for my ATI-radeon9200!! | 11:11 |
| intelikey | SKoRM yes and will run faster, but at the price of making some thing manual rather than auto. | 11:11 |
| ozux | dj-fu: and you use 1280x800! I think My intel 915GM have problem in Ubuntu!! | 11:11 |
| === engla [n=ulrik@kr-lun-116-144-233-83.3.cust.bredband2.com] has joined #ubuntu | ||
| === Hobbsee [n=Hobbsee@ubuntu/member/hobbsee] has joined #ubuntu | ||
| dj-fu | ozux, intel 915GM's aren't very good. | 11:12 |
| dj-fu | ozux, It shouldn' thave any trouble with 1280x800, though. | 11:12 |
| TSCHAK2 | ozux, you need the 945 utilities to set how much video ram it thinks it has | 11:12 |
| zaibiechu | is there any OCR soft under linux | 11:12 |
| liable | !ati | 11:12 |
| ubotu | well, ati is https://wiki.ubuntu.com/BinaryDriverHowto/ATI or http://www.ubuntuforums.org/showthread.php?t=24557&page=1&pp=10 or http://ubuntuforums.org/showthread.php?p=423589 | 11:12 |
| === Madeye [n=Jad@213.186.178.5] has joined #ubuntu | ||
| TSCHAK2 | zaibiechu, gocr ... http://jocr.sourceforge.net/ | 11:12 |
| ozux | dj-fu: of course but my system is a laptop! | 11:12 |
| harm | laptops are awsome | 11:12 |
| === sphinx [n=sphinx@83.229.111.115] has joined #ubuntu | ||
| TSCHAK2 | the 845/915/945 chips all have the same weird...feature... | 11:13 |
| AshenSugar | is the driver for the chips and tech ct65530 a basic vesa driver or a true native driver? | 11:13 |
| TSCHAK2 | they have to be told how much video ram they have | 11:13 |
| sphinx | ubotu fstab | 11:13 |
| ubotu | the /etc/fstab file lists all drives and partitions but can be easily configured automatically with the diskmounter file found here http://www.ubuntulinux.nl/files/diskmounter See <partitions>. | 11:13 |
| === pschulz01 [n=paul@150.101.6.36] has joined #ubuntu | ||
| intelikey | SKoRM if you can do most of your work from console and don't need all the eye candy a gui provides. even a 386 is usable. not fast, but usable. | 11:13 |
| harm | btw if anyone is into anime let me know.. my friend just launched an anime site | 11:13 |
| SKoRM | i know | 11:13 |
| geargolem | how many here are running dapper? | 11:13 |
| TSCHAK2 | my first linux system back in 1991 was a 386sx/16 | 11:13 |
| dj-fu | ozux, so is mine ;] | 11:13 |
| SKoRM | i used to run red hat through shell for a server | 11:13 |
| dj-fu | geargolem, I am | 11:13 |
| geargolem | dj-fu, me too. :P | 11:14 |
| intelikey | nishe | 11:14 |
| SKoRM | :( didnt startx , and when i start it, it comes with errors :( | 11:14 |
| kleinlappies | wahar are some of the basic irssi commands man page not so helpful | 11:14 |
| TSCHAK2 | hmmm i wonder if anyone is listening to me? :-) | 11:14 |
| pschulz01 | geargolem: +1 | 11:14 |
| intelikey | TSCHAK2 no | 11:14 |
| geargolem | pschulz01, come again? | 11:15 |
| ozux | AshenSugar: I use i815 in Ubuntu! vesa don't support! | 11:15 |
| === TSCHAK2 loves smart asses, they make good rebuttal snacks later :-) | ||
| BlueHeron | i found the ati drivers are the best. | 11:15 |
| intelikey | SKoRM what errors ? and don't flood. use the pastebin if needed. | 11:15 |
| SKoRM | xfree -? connection reset by peer) | 11:15 |
| pschulz01 | geargolem: taks whatever count you have for dapper, and add 1 | 11:15 |
| AshenSugar | hehe i was asking about the chip on my crappy laptop | 11:15 |
| === bigfoot1 [n=opera@FLH1Acf092.fko.mesh.ad.jp] has joined #ubuntu | ||
| bigfoot1 | !deb | 11:16 |
| ubotu | To install a .deb file: sudo dpkg -i filename.deb (but note that the program you want might be installable using !apt from the !repos) | 11:16 |
| geargolem | lol. I just woke up. let my brain get working pschulz01 | 11:16 |
| === topyli [n=juha@dsl-hkigw3-fe23de00-139.dhcp.inet.fi] has joined #ubuntu | ||
| === g8m [n=evil@cp747435-a.dbsch1.nb.home.nl] has joined #ubuntu | ||
| AshenSugar | i so hate windows98/me hence linux on it | 11:16 |
| harm | i so got bored with XP.. hence linux | 11:16 |
| ozux | dj-fu: mine is chipper so has chipperGraphics ;-) | 11:16 |
| AshenSugar | could go with nt4 but i dont feel like tracking down working sound drivers :P | 11:16 |
| === chose [n=chose@severus.mzk.cz] has joined #ubuntu | ||
| TSCHAK2 | AshenSugar, the chips driver is no longer bundled with X, as of........ well, heh, the first releases of Xfree864 | 11:16 |
| SKoRM | hmm | 11:16 |
| === Kezzer [n=Kezzer@88-105-244-13.dynamic.dsl.as9105.com] has joined #ubuntu | ||
| === bigfoot1 [n=opera@FLH1Acf092.fko.mesh.ad.jp] has left #ubuntu [] | ||
| intelikey | SKoRM you didn't ^C that thing did you ? | 11:16 |
| ozux | Any body use SBS in Ubuntu?!I have some problems ! | 11:17 |
| === DJ_Tobias [n=tobias@ip68-10-203-7.hr.hr.cox.net] has joined #ubuntu | ||
| BlueHeron | ozux: SBS = ? | 11:17 |
| SKoRM | yeah i did | 11:17 |
| DJ_Tobias | whats the program to burn iso files? | 11:17 |
| === roylez [n=roy@147.8.84.132] has joined #ubuntu | ||
| BlueHeron | DJ_Tobias: gnomebaker can, or k3b. | 11:17 |
| SKoRM | i was thinking | 11:17 |
| TSCHAK2 | DJ_Tobias, right click an iso file, select Write to Disk | 11:17 |
| pschulz01 | geargolem: should have been dapperCount++ | 11:17 |
| TSCHAK2 | why does everybody forget that NAUTILUS HAS A BUILT IN ISO WRITER? | 11:17 |
| ozux | Nautilus good ISO burner! | 11:17 |
| geargolem | heh | 11:18 |
| TSCHAK2 | oh, let's install a whole other program that requires all of KDE to function | 11:18 |
| intelikey | well that is what the error said. "user killed me" skorm | 11:18 |
| TSCHAK2 | TO BURN CDs | 11:18 |
| TSCHAK2 | __REALLY SMART__ | 11:18 |
| TSCHAK2 | :-) | 11:18 |
| SKoRM | it says fatal IO error 104 (Connection reset bypeer) on X server ":0.0" | 11:18 |
| ozux | Nautilus work very simple ; and just work! | 11:18 |
| AshenSugar | u mean i gotta find and manualy install drivers*crys* | 11:18 |
| === jessy_ [n=jessy@4va54-1-81-56-98-29.fbx.proxad.net] has joined #ubuntu | ||
| TSCHAK2 | AshenSugar, the chips driver no longer exists. | 11:18 |
| AshenSugar | oh | 11:18 |
| SKoRM | i was wondering if maybe x was started somewhere else | 11:18 |
| AshenSugar | that sux :( | 11:18 |
| TSCHAK2 | it was completely phased out when xfree86 version 4.0 came out. | 11:19 |
| AshenSugar | so gotta use vesa drivers :/ | 11:19 |
| TSCHAK2 | yup | 11:19 |
| intelikey | SKoRM oh you want gdm/kdm/xdm to run at boot? | 11:19 |
| TSCHAK2 | i havent seen a C&T graphics chip in | 11:19 |
| BlueHeron | can anyone help me with this? i have the newest ver installed. http://pastebin.com/630437 | 11:19 |
| TSCHAK2 | ...... | 11:19 |
| TSCHAK2 | over a decade. | 11:19 |
| SKoRM | yeah, i ythink :S | 11:19 |
| AshenSugar | may just go with windows then at least its got real drivers for the c&t :/ | 11:19 |
| kleinlappies | what is the best way to delete some of the installed programs? | 11:19 |
| AshenSugar | i have seen lots with them mostly older boxes and laptops | 11:20 |
| liable | kleinlappies: the same way you install them | 11:20 |
| TSCHAK2 | kleinlappies, add/remove programs | 11:20 |
| === sexcopter8000m [n=james@dslb-082-083-214-140.pools.arcor-ip.net] has joined #ubuntu | ||
| ozux | kleinlappies: "dpkg -r pakage-name" | 11:20 |
| kleinlappies | dpkg or synaptic or add/remove? | 11:20 |
| === dinamizador [n=dinamiza@83.230.235.25] has joined #ubuntu | ||
| intelikey | sorry. i never set up that way. ok do this SKoRM ls /etc/init.d/ | grep dm and tell me what you've got and we | 11:20 |
| === barrilao [n=barrilao@83.230.235.25] has joined #ubuntu | ||
| intelikey | we'll fix it | 11:20 |
| AshenSugar | compcrap,gateway,nec and some others used them onboard in crappy desktops and laptops | 11:20 |
| SKoRM | k, thknz | 11:20 |
| liable | kleinlappies: synaptic | 11:20 |
| TSCHAK2 | kleinlappies, if it's in the applications menu, try add/remove programs first | 11:21 |
| TSCHAK2 | kleinlappies, if it's not, then try synaptic | 11:21 |
| ozux | kleinlappies: a way that you like! I think if you are newbie in Debian Synaptic. | 11:21 |
| kleinlappies | thsnks guys | 11:21 |
| === barrilao [n=barrilao@83.230.235.25] has joined #ubuntu | ||
| SKoRM | intelikey can i pm you? | 11:21 |
| liable | ozux: um, isnt this *ubuntu*?? | 11:21 |
| intelikey | SKoRM ok | 11:21 |
| shreevatsa | liable: same thing :) | 11:22 |
| intelikey | SKoRM if you are regestered you can.... | 11:22 |
| TSCHAK2 | guys, don't give someone a command line solution if there is a gui solution that is simpler. | 11:22 |
| ozux | liable: Why?! | 11:22 |
| liable | shreevatsa: no. | 11:22 |
| SKoRM | sec... | 11:22 |
| === lesshaste [n=lesshast@87.113.21.47.bbplus.pte-ag1.dyn.plus.net] has joined #ubuntu | ||
| lesshaste | anyone here used gaim-latex? It appears to work but only shows blank icons instead of the correct latex | 11:22 |
| lesshaste | http://pastebin.com/630441 appears in the xterm which looks promising | 11:23 |
| liable | ozux: um, because ubuntu != debian and vice versa | 11:23 |
| ozux | TSCHAK2: I love CLI becuse save my time!! but everey body have they're opinios! | 11:23 |
| === jeddy3 [n=mattias@81-234-85-40-o1122.telia.com] has joined #ubuntu | ||
| liable | ozux: if you believe so, try adding sid to your sources list | 11:23 |
| === bimberi [n=bimberi@pdpc/supporter/active/bimberi] has joined #ubuntu | ||
| TSCHAK2 | ozux, i understand.... but ask yourself, would a new user know WHAT to remove, much less how to use the CLI? | 11:23 |
| ozux | liable: Yes, it mean Ubuntu is Debian base; and use debian package manager | 11:23 |
| cerebrix | god im about to stick my hand thru my monitor | 11:23 |
| liable | ozux: yes, and ubuntu has add/remove prgrams, that debian doesnt | 11:24 |
| shreevatsa | wow, what's gaim-latex? | 11:24 |
| liable | well, by default.. | 11:24 |
| ozux | TSCHAK2: Yes !!! CLI is a little difficult for new users, and GUI is more simple. | 11:24 |
| lesshaste | shreevatsa: A plugin which translate LaTeX code into image in your IM conversation | 11:24 |
| liable | if it even is in debian.. | 11:24 |
| === e-spy [n=metod@tech.spijon.com] has left #ubuntu ["Ex-Chat"] | ||
| === TSCHAK2 is taken aback by ozux's loud voice | ||
| === kRaKoN [n=krakon@201.145.197.21] has joined #ubuntu | ||
| pierre__ | how can i chown a directory recursively? | 11:25 |
| Ribs | cerebrix: I wouldn't do that if I were you | 11:25 |
| Ribs | cerebrix: could break things ;) | 11:25 |
| shreevatsa | lesshaste: nice, where's that package? | 11:25 |
| TSCHAK2 | pierre__, chown -R <folder> | 11:25 |
| lesshaste | did it from source | 11:25 |
| lesshaste | it's only small | 11:25 |
| ozux | liable: I don't use add/remove program! it like add/remove on Window$ and Fedora! but I heared that it is good tool! | 11:25 |
| pierre__ | TSCHAK2: thx | 11:25 |
| lesshaste | shreevatsa: http://sourceforge.net/projects/gaim-latex | 11:25 |
| shreevatsa | lesshaste: thanks | 11:25 |
| lesshaste | np | 11:25 |
| TSCHAK2 | pierre__, or in nautilus, right click, properties, permissions tab, set permissions, and check "set same permissions for folders underneath this one." | 11:25 |
| liable | ozux: yes. me either. | 11:26 |
| === Rdde [n=Rdde_@c-efa8e455.53-0004-74657210.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| Ribs | ozux: no, the add/remove program in Ubuntu actually does remove the programs, and not just the shortcuts a la M$ | 11:26 |
| === yolanda [n=yolanda@82.198.125.30] has joined #ubuntu | ||
| TSCHAK2 | nowotny, take what pierre__ asked.. he asked specifically how to chown files... that automatically means he wants the command line solution.. so give that one first. | 11:26 |
| yolanda | no.org 6667 | 11:26 |
| TSCHAK2 | damned nick complete | 11:26 |
| TSCHAK2 | :-P | 11:26 |
| pierre__ | TSCHAK2: thx, but i hate nautilus... console rocks | 11:26 |
| TSCHAK2 | pierre__, and you just proved my point. | 11:26 |
| pierre__ | TSCHAK2: you're right :-) | 11:27 |
| === Tidus [n=tidus@unaffiliated/tidus] has left #ubuntu [] | ||
| === Karlprof [n=karl@ACD5DE7F.ipt.aol.com] has joined #ubuntu | ||
| TSCHAK2 | when helping people, pay very close attention to how the question is asked | 11:27 |
| ozux | Ribs:I realy don't try this tool. add/remove can manage Repositories?! or reonfigured packages?! show dependencies?! | 11:27 |
| TSCHAK2 | the smallest words, make all the difference. | 11:27 |
| === ccc__ is now known as ccc_ | ||
| TSCHAK2 | ozux, does a new user care? he just wants to install common applications | 11:28 |
| TSCHAK2 | ozux, for that, add/remove does a wonderful job.. | 11:28 |
| Ribs | indeed | 11:28 |
| TSCHAK2 | ozux, and if you notice... there is an advanced button. | 11:28 |
| TSCHAK2 | ozux, which does... guess what? LAUNCH SYNAPTIC :-) | 11:28 |
| AshenSugar | ahhh got the download finnishes finnely | 11:28 |
| TSCHAK2 | the add/remove programs menu item is in plain view... | 11:28 |
| TSCHAK2 | which is one of the things ubuntu did very right. | 11:29 |
| === seraphim [n=seraphim@dslb-088-072-206-066.pools.arcor-ip.net] has joined #ubuntu | ||
| === cerebrix [n=christia@cpe-66-27-155-245.socal.res.rr.com] has joined #ubuntu | ||
| AshenSugar | true | 11:29 |
| === TSCHAK2 is now known as TSCHAK | ||
| Kezzer | where's fstab located? I want to stop drives being mounted on startup | 11:29 |
| ozux | TSCHAK: Ok ;-) I'm forget .. Ubuntu aim to be usable for every type of users, New and middle ... | 11:29 |
| === GTroy [n=galen@207-109-184-188.spkn.qwest.net] has joined #ubuntu | ||
| TSCHAK | yeah | 11:30 |
| bimberi | Kezzer: /etc/fstab | 11:30 |
| sfaris | ubotu tell Kezzer about fstab | 11:30 |
| === mrtwister|mobile [n=andrius@cable-10-68.cgates.lt] has joined #ubuntu | ||
| TSCHAK | you can't aim to please everyone with a single idea | 11:30 |
| AshenSugar | for linux to get new common users it needs to take an ease of use lesson from win :/ | 11:30 |
| TSCHAK | but you can try to get the most common stuff correct. | 11:30 |
| cerebrix | anyone here have gaim2 beta 3 running in dapper? | 11:30 |
| === shadow` [i=shadow@shadow.fi] has joined #ubuntu | ||
| TSCHAK | AshenSugar, well, i consider the macintosh one of the standards for ease of use | 11:30 |
| TSCHAK | AshenSugar, moreso than windows. | 11:30 |
| ompaul | cerebrix, ask in #ubuntu+1 the place for dapper conversation | 11:31 |
| AshenSugar | would be nice if somebody made a feturefull distro that was made for low end/old hardware | 11:31 |
| TSCHAK | AshenSugar, there are a few | 11:31 |
| TSCHAK | AshenSugar, try MepisLite for example | 11:31 |
| cerebrix | didnt even know the channel existed. thanks for the heads up | 11:31 |
| === torque [n=torque@unaffiliated/sgrgc] has joined #ubuntu | ||
| ompaul | AshenSugar, xubuntu-desktop does, even if you don't personally like it | 11:31 |
| AshenSugar | meh TSCHAK i support a mac and pc, have more issues with the mac users messin things up or the macs just desiding not to play nice with the pc's | 11:31 |
| ompaul | AshenSugar, the projects resources can only go so far | 11:32 |
| AshenSugar | i dont like the file manager in xf | 11:32 |
| TSCHAK | AshenSugar, as i said, try mepislite | 11:32 |
| AshenSugar | mepis will not load on this laptop it errors on cd boot :P | 11:32 |
| TSCHAK | do you have a floppy? | 11:32 |
| AshenSugar | yeah ofcorse | 11:32 |
| ompaul | AshenSugar, you could always start a team and manage ice or whatever you want do | 11:32 |
| === torque ompaul (resp message): hi | ||
| AshenSugar | its a floppy/cd combo drive | 11:32 |
| TSCHAK | AshenSugar, try making a boot floppy | 11:33 |
| === torque TSCHAK (resp message): hi | ||
| === telemaco [n=telemaco@84.77.61.106] has joined #ubuntu | ||
| === carlos [n=carlos@212.166.227.171] has joined #ubuntu | ||
| === kleinlappies_ [n=kleinlap@dsl-165-230-14.telkomadsl.co.za] has joined #ubuntu | ||
| AshenSugar | its the cd boot, something about this laptop dosnt play nice with most distros of *nix | 11:33 |
| === d-o-b [n=nxt@58.69.220.245] has joined #ubuntu | ||
| === roaet [n=roro@cpe-66-69-104-180.satx.res.rr.com] has joined #ubuntu | ||
| === triceratops [n=tricerat@dyndsl-085-016-009-103.ewe-ip-backbone.de] has left #ubuntu ["Leaving"] | ||
| ompaul | AshenSugar, what lappy is it? | 11:33 |
| === torque ompaul (resp message): hi | ||
| ompaul | !bot | 11:34 |
| === torque ompaul (resp message): hi | ||
| ubotu | Yep, that's me! I'm a bot alright. Read http://wiki.ubuntu.com/UbotuUsage to find out how to use me. Do NOT play with me in any channel except #debian-bots. | 11:34 |
| === mode/#ubuntu [+o ompaul] by ChanServ | ||
| AshenSugar | an old gateway 2000 2001 pos | 11:34 |
| === mode/#ubuntu [+b *!*@*unaffiliated/sgrgc] by ompaul | ||
| === torque was kicked off #ubuntu by ompaul (ompaul) | ||
| === mode/#ubuntu [-o ompaul] by ChanServ | ||
| zaibiechu | if i want to read a soft's src, what should i do, and is there any tool | 11:34 |
| AshenSugar | not the one with trident video oh no i got the one with chips and tech video >.< | 11:35 |
| === sleeptyper [n=b@2001:618:400:0:0:0:51c5:3c4f] has joined #ubuntu | ||
| TSCHAK | zaibiechu, do you need an integrated development environment ? | 11:35 |
| liable | um, download the source and open it in whatever text editor you like?? | 11:35 |
| ompaul | AshenSugar, please stop with the tla of bad language this is a G rated channel | 11:35 |
| === nadjyla [n=nadjyla@ALyon-209-1-4-56.w80-14.abo.wanadoo.fr] has joined #ubuntu | ||
| TSCHAK | zaibiechu, if not, you can just click on a source file in nautilus, and it will open in the gnome text editor (Gedit) | 11:35 |
| === lwelyn [n=lwelyn@p549A664F.dip.t-dialin.net] has joined #ubuntu | ||
| AshenSugar | what bad language? | 11:36 |
| === nadjyla [n=nadjyla@ALyon-209-1-4-56.w80-14.abo.wanadoo.fr] has left #ubuntu ["tcho] | ||
| geargolem | help, on blender startup-$[sis_alloc.c:210] : Failure to allocate back buffer. | 11:36 |
| TSCHAK | AshenSugar, i think ompaul was talking about the use of "pos" | 11:36 |
| zaibiechu | TSCHAK, i mean an convenient tool | 11:36 |
| TSCHAK | zaibiechu, that is an awfully ambiguous term | 11:36 |
| TSCHAK | zaibiechu, can you be more specific on what you want ? | 11:36 |
| AshenSugar | sheesh | 11:37 |
| cerebrix | they use that in car commercials | 11:37 |
| Rdde | anyone using samba or is good at it? | 11:37 |
| TSCHAK | AshenSugar, *shrug* :-) | 11:37 |
| cerebrix | if that term is ok for network television during prime time its ok for irc | 11:37 |
| TSCHAK | AshenSugar, apparently acronyms are not G rated language :-) | 11:37 |
| === panik [n=panik@193.41.76.133] has joined #ubuntu | ||
| TSCHAK | (yeah yeah, i am joking around) :-) | 11:37 |
| AshenSugar | then u better not mention that small linux distro | 11:38 |
| === mescaline [n=wordup@v-424-adsl-250.bitnet.nu] has joined #ubuntu | ||
| zaibiechu | TSCHAK, maybe with that i can get some def easily | 11:38 |
| mescaline | hello. i need some help. anyone alive? | 11:38 |
| AshenSugar | after all its name starts with a foul word | 11:38 |
| ompaul | AshenSugar, now with that laptop, some of the small distros work well grab a couple of them around the 50 meg mark use lspci and id what hardware you have | 11:38 |
| sfaris | DSL is a piece of source | 11:38 |
| liable | mescaline: just ask.. | 11:38 |
| === samitheberber [n=stb@dsl-083-102-064-254.lohjanpuhelin.fi] has joined #ubuntu | ||
| liable | mescaline: not me, the channel | 11:38 |
| === Akonkwa [n=ubuntu@user-85-201-8-58.tvcablenet.be] has joined #ubuntu | ||
| ompaul | !anyone | 11:38 |
| ubotu | probably 90% of the first questions asked in this channel start with "Does anyone/anybody..." Why not ask your next question (the real one) and find out? <hint> | 11:38 |
| TSCHAK | zaibiechu, well, I asked what you need... do you want a text editor? or an integrate development environment? | 11:38 |
| zaibiechu | TSCHAK, ide | 11:39 |
| TSCHAK | zaibiechu, install eclipse | 11:39 |
| === ubuntu_ [n=ubuntu@237.Red-217-126-203.staticIP.rima-tde.net] has joined #ubuntu | ||
| shreevatsa | zaibiechu: emacs? gedit? kate? | 11:39 |
| pierre__ | ubotu: it's the polite form of stupid question :-) | 11:39 |
| ubotu | I haven't a clue, try searching at http://ubuntu.cc.com.au/, pierre__ | 11:39 |
| kingspawn | emacs! | 11:39 |
| mescaline | I installed Ubuntu, and i was never asked to set a root password, but i was asked to set another username/password so i added mescaline/******, but i cant login with any of it... | 11:39 |
| ubuntu_ | hello | 11:39 |
| TSCHAK | shreevatsa, he wants an IDE | 11:39 |
| kingspawn | or, thats if you need a new os | 11:39 |
| === mode/#ubuntu [+o ompaul] by ChanServ | ||
| === mode/#ubuntu [-b *!*@*unaffiliated/sgrgc] by ompaul | ||
| ubuntu_ | fuck | 11:39 |
| === mode/#ubuntu [-o ompaul] by ChanServ | ||
| === mode/#ubuntu [+o ompaul] by ChanServ | ||
| === khisanth__ [n=Khisanth@pool-71-247-58-45.nycmny.east.verizon.net] has joined #ubuntu | ||
| ompaul | ubuntu_, language | 11:40 |
| ubuntu_ | fuck my pussy abre | 11:40 |
| zaibiechu | sorry my english is poor and i do not know how to express | 11:40 |
| === mode/#ubuntu [+b *!*@237.Red-217-126-203.staticIP.rima-tde.net] by ompaul | ||
| === ubuntu_ was kicked off #ubuntu by ompaul (ompaul) | ||
| liable | bye bye | 11:40 |
| === jeremy1 [n=jeremy1@c2-39-1.eno.dial.mweb.co.za] has joined #ubuntu | ||
| === xdarCx [n=kjd@c-71-196-229-240.hsd1.co.comcast.net] has joined #ubuntu | ||
| TSCHAK | ubuntu_, dude, chi...hahaha | 11:40 |
| shreevatsa | TSCHAK: That's what he *says*, but maybe he only wants to look at the source, not change it and compile it :) | 11:40 |
| zaibiechu | maybe sth like VC under win | 11:40 |
| TSCHAK | shreevatsa, rule 1.. GIVE THE CUSTOMER WHAT THEY WANT | 11:40 |
| xdarCx | does the latest release of ubuntu include the sk98lin driver? | 11:40 |
| TSCHAK | shreevatsa, not what you THINK they want | 11:40 |
| kingspawn | zaibiechu: what are you going to program? which language? | 11:40 |
| TSCHAK | zaibiechu, install eclipse. | 11:40 |
| === mode/#ubuntu [-o ompaul] by ChanServ | ||
| kingspawn | or just listen to TSCHAK | 11:41 |
| === mrtwister|mobile [n=andrius@cable-10-68.cgates.lt] has joined #ubuntu | ||
| liable | huh? | 11:41 |
| === sylvain [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has joined #ubuntu | ||
| shreevatsa | TSCHAK: of course I agree... but also don't believe everything the customer says; if you give them choices and they're not sure, they'll just pick one :) | 11:41 |
| TSCHAK | shreevatsa, he was very clear, "something like vc on windows" | 11:41 |
| === souly [i=soul@85-250-139-80.bb.netvision.net.il] has joined #ubuntu | ||
| ompaul | TSCHAK, give the customer what they ask for, just make sure they ask for what you are doing | 11:42 |
| xdarCx | anyone? | 11:42 |
| souly | Hello, someone can help me with a post-install prob? | 11:42 |
| zaibiechu | gocr do not support my language so ... i just want to see it's code | 11:42 |
| shreevatsa | TSCHAK: Yeah, I realise that... (but that came after I mentioned the editors) | 11:42 |
| sfaris | hello can make x i restart ubuntu if could windows like program? | 11:42 |
| ompaul | !anyone | 11:42 |
| ubotu | probably 90% of the first questions asked in this channel start with "Does anyone/anybody..." Why not ask your next question (the real one) and find out? <hint> | 11:42 |
| === Yoric [n=ElYoric@cpc1-brig7-3-0-cust74.brig.cable.ntl.com] has joined #ubuntu | ||
| ompaul | xdarCx, ^^ | 11:42 |
| shreevatsa | zaibiechu: Do you want to just see the code, or do you want to make changes? | 11:42 |
| sfaris | *kidding* | 11:42 |
| AshenSugar | costomers ask for better file manager in xfce :P | 11:43 |
| Rdde | anyone using samba in here? | 11:43 |
| zaibiechu | and don't ubuntu have that package "eclipse" | 11:43 |
| liable | AshenSugar: mc! | 11:43 |
| xdarCx | uh i already asked my ? | 11:43 |
| TSCHAK | AshenSugar, and i agree there.. XFCE as a whole desktop solution, falls horribly short. | 11:43 |
| ompaul | AshenSugar, you have the source make one | 11:43 |
| zaibiechu | just see , i have not the skill | 11:43 |
| souly | hmm ubotu, nice hint. Well.. I've just finished installing Ubuntu but whenever it starts it presents the shell.. I would like Gnome to start on startup. I also can't load gnome on the shell and therfore am stuck.. can anyone help? | 11:43 |
| AshenSugar | <<<<<noooob | 11:43 |
| AshenSugar | <<<not programer geek | 11:43 |
| liable | AshenSugar: theres lots of file managers, you arent limited to the xfce4 one | 11:44 |
| shreevatsa | "ls" and "cd" constitute the only file manager I need :) | 11:44 |
| === rusakk0 [n=tiina@hoas-fe25dd00-76.dhcp.inet.fi] has joined #ubuntu | ||
| ompaul | AshenSugar, look let me help you out here, this is the help channel go to #ubuntu-offtopic and chat away you can install nautilus and use it under xfce | 11:44 |
| TSCHAK | souly, your video card isn't supported for some reason. The best solution would be for you to use another video card, rather than trying to hack configuration files. | 11:44 |
| AshenSugar | yes but it would help if the default one wasnt such a pitb | 11:44 |
| zaibiechu | TSCHAK, i can not install eclipse, can not find the package | 11:44 |
| AshenSugar | working on downloading stuff now | 11:44 |
| === TSCHAK tries to think if there's an apt repo for eclipse. | ||
| liable | AshenSugar: well, it is. deal with it, and install one you like... | 11:44 |
| xdarCx | The best place to start for general help with Ubuntu or just to meet other Ubuntu users is #ubuntu | 11:44 |
| AshenSugar | keeping stuff i download limited im almost out of cd=rs :P | 11:45 |
| TSCHAK | I only use RadRails, which uses the Eclipse embedded runtime | 11:45 |
| souly | TSCHAK: How can it be? I use Radeon 9600. besides, when I type 'X' it loads a screen but it doesnt go anywhere from there | 11:45 |
| shreevatsa | zaibiechu: What exactly do you want to do? In what langauge is the code you want to look at? Why do you want to look at it? | 11:45 |
| xdarCx | righ toff the site | 11:45 |
| TSCHAK | souly, really? | 11:45 |
| souly | yup | 11:45 |
| TSCHAK | souly, wow. it shoult.d at LEAST use the "ati" driver if it can't figure anything else ou | 11:45 |
| ompaul | !ati | 11:45 |
| ubotu | [ati] https://wiki.ubuntu.com/BinaryDriverHowto/ATI or http://www.ubuntuforums.org/showthread.php?t=24557&page=1&pp=10 or http://ubuntuforums.org/showthread.php?p=423589 | 11:45 |
| TSCHAK | souly, read the link ubotu pasted. | 11:46 |
| ompaul | souly, read that ^^ | 11:46 |
| zaibiechu | shreevatsa, "C", | 11:46 |
| === traveller2k [n=kenneth@202.126.108.183] has joined #ubuntu | ||
| zaibiechu | shreevatsa, just study | 11:46 |
| souly | hmm, well, perhaps its an install bug? I used the install DVD | 11:46 |
| souly | alright, I will ;-) | 11:46 |
| === hartym_ is now known as hartym | ||
| xdarCx | so.. can anyone plz tell me if sk98lin driver is included in the latest release | 11:46 |
| shreevatsa | TSCHAK: see? :) | 11:46 |
| AshenSugar | slax is almost booted on the pitb laptop :P | 11:46 |
| === raphink [n=raphink@ubuntu/member/raphink] has joined #ubuntu | ||
| TSCHAK | shreevatsa, indeed. ;-) | 11:46 |
| AshenSugar | whopping 8x cdrom | 11:46 |
| shreevatsa | zaibiechu: The default editor (gedit) will do for that | 11:47 |
| ompaul | xdarCx, I have to boot the worlds almost slowest laptop want to wait a moment for it? | 11:47 |
| xdarCx | sure. | 11:47 |
| zaibiechu | but there are too many .c files | 11:47 |
| ompaul | xdarCx, or go to #ubuntu+1 for conversation with people who use dapper all the time | 11:47 |
| shreevatsa | zaibiechu: Just go and double-click on the files, they should open in a good-enough program | 11:47 |
| TSCHAK | AshenSugar, 8x is not slow. my first cdrom drive was purchased in 1985, and had a data rate of 86K a second.. less than what most people consider 1X :-) | 11:47 |
| souly | also, Is it OK I used the AMD64 DVD Install for my AMD Athlon? | 11:47 |
| zaibiechu | i do not know where to start | 11:47 |
| TSCHAK | souly, NO | 11:47 |
| souly | -_- | 11:47 |
| AshenSugar | how slows that laptop :P | 11:48 |
| souly | what install should I use then? | 11:48 |
| === pvanhoof [n=pvanhoof@mailhost.newtec.be] has joined #ubuntu | ||
| TSCHAK | souly, use the x86 install | 11:48 |
| maskd | souly: x86 | 11:48 |
| AshenSugar | its slow when you havent used slower then 32x in years :P | 11:48 |
| TSCHAK | AshenSugar, :-D | 11:48 |
| souly | damn, knew something is wrong. there goes another DVD disc :P | 11:48 |
| souly | thanks for help | 11:48 |
| TSCHAK | souly, no problem :-) | 11:48 |
| TSCHAK | souly, you should have better luck this time | 11:48 |
| TSCHAK | :-) | 11:48 |
| souly | hehe, hopefully. I've waited for so long to use Ubuntu and now I finally have free time off to install it. ;-) | 11:49 |
| AshenSugar | my systems such a beast that i get annoied by slow comps :P | 11:49 |
| mescaline | another question, when i boot the screen turns black after initializing, then i have to type ctrl+alt+f1 to get into console, how can i configure so i go to X by default instead? | 11:49 |
| ompaul | AshenSugar conversation in the channel #ubuntu-offtopic this is _the_ help channel | 11:49 |
| zaibiechu | shreevatsa, any idears? ths | 11:49 |
| TSCHAK | i'm off to bed, almost 3am. later guys. | 11:50 |
| AshenSugar | ok what info do i need about the hardware in my system | 11:50 |
| zaibiechu | shreevatsa, i can even not find the main func | 11:50 |
| souly | see you TSCHAK, thanks again | 11:50 |
| === Kamping_Kaiser [n=Kaiser@ppp201-15.lns1.adl4.internode.on.net] has joined #ubuntu | ||
| AshenSugar | well other then knoing the video chips not supported by anything but vesa drivers :P | 11:50 |
| === radioman59 [n=john31@82-34-141-65.cable.ubr03.gray.blueyonder.co.uk] has joined #ubuntu | ||
| shreevatsa | zaibiechu: Oh.. | 11:51 |
| shreevatsa | zaibiechu: Why do you want to look at them, anyway? :) | 11:51 |
| shreevatsa | zaibiechu: I mean, do you have any special purpose in mind, or do you want to just study them in general? | 11:51 |
| mescaline | When i try to start X i get this message: "Server is already active for display 0" | 11:52 |
| mescaline | When i try to start X i get this message: "Fatal Error: Server is already active for display 0" | 11:52 |
| ^Odd^ | AshenSugar, i have a question this woulden't happen to be with nvidia drivers would it? | 11:52 |
| === G0SUB [n=ghoseb@ubuntu/member/g0sub] has joined #ubuntu | ||
| AshenSugar | nope | 11:52 |
| AshenSugar | chips and tech video with ancient chipset | 11:52 |
| AshenSugar | 233mmx cpu :P | 11:52 |
| AshenSugar | i got a slower laptop though 386+387+4mb ram+80mb hdd | 11:53 |
| === Khamael [n=Khamael@196.80-203-85.nextgentel.com] has joined #ubuntu | ||
| === gorduxxo [n=pvf@nat2.iscte.pt] has joined #ubuntu | ||
| zaibiechu | shreevatsa, i want to know some technology about OCR, but i can find any useful info ,so i want to read the source | 11:53 |
| Khamael | can gparted convert ntfs to vfat? partititon magic won`t do it for me | 11:54 |
| shreevatsa | zaibiechu: What is OCR? Optical Character Recognition? | 11:54 |
| === viper [n=gregf@p2153-adslbkksp6.C.csloxinfo.net] has joined #ubuntu | ||
| dextro_dude | hey people, is there any good video editing software for linux ? | 11:54 |
| TSCHAK | dextro_dude, i've used cinelerra professionally | 11:54 |
| zaibiechu | shreevatsa, yes | 11:54 |
| dextro_dude | TSCHAK: is it free ? | 11:54 |
| TSCHAK | dextro_dude, and while it's not quite as feature laden as Adobe After Effects, or Final Cut Pro, it is very capable. | 11:54 |
| TSCHAK | dextro_dude, yes | 11:55 |
| dextro_dude | TSCHAK: thank you. | 11:55 |
| TSCHAK | dextro_dude, you can also google for Jahshaka too | 11:55 |
| shreevatsa | zaibiechu: Believe me, if you're looking for information like that, looking at the Linux source code is NOT the best way to learn about it | 11:55 |
| TSCHAK | dextro_dude, which is a fantastic 3d video effects package that makes extensive use of 3D GPUs. | 11:55 |
| === oneleaf [n=oneleaf@59.36.43.133] has joined #ubuntu | ||
| === seraphim [n=seraphim@dslb-088-072-206-066.pools.arcor-ip.net] has joined #ubuntu | ||
| TSCHAK | dextro_dude, or if you need just a basic DV capture and edit deck, Kino does that well too | 11:56 |
| zaibiechu | shreevatsa, and i want to study C | 11:56 |
| shreevatsa | zaibiechu: Better to start from, say, Wikipedia (http://en.wikipedia.org/wiki/Optical_character_recognition) and proceed from there | 11:56 |
| === AshenSugar frys sugar ants with lighter and waits for laptop to finish booting................ | ||
| shreevatsa | zaibiechu: You shouldn't try to do two things at once (or at least, not combine them). Learn C from a C book, and OCR from an OCR book. Looking at the source code is not a good way of learning either, IMHO. I'm not trying to discourage you, it's just my opinion | 11:57 |
| === deus_ [n=deus@dsl207-46.adsl.no] has left #ubuntu [] | ||
| === khisanth_ [n=Khisanth@pool-71-247-58-45.nycmny.east.verizon.net] has joined #ubuntu | ||
| zaibiechu | shreevatsa, ths | 11:58 |
| Rdde | anyone running a samba server? | 11:58 |
| === xstation [n=bliss1@4096.net] has joined #ubuntu | ||
| xstation | hi | 11:58 |
| maskd | hey xstation | 11:58 |
| xstation | maskd: hi such a cool day here in london | 11:58 |
| zaibiechu | shreevatsa, i have some base knowledge of c,ths but i can not open the page you give me | 11:59 |
| xstation | need some sun | 11:59 |
| shreevatsa | zaibiechu: Are you sure? It's on the internet -- http://en.wikipedia.org/wiki/Optical_character_recognition | 11:59 |
| xstation | ok anybody use vm workstation | 11:59 |
| xstation | I have vm workstation as a exe for windowds how to run it in linux | 12:00 |
| === treyh0_ [n=trey@pintnight.com] has joined #ubuntu | ||
| maskd | xstation: you need to download the linux version from the vmware site | 12:00 |
| zaibiechu | shreevatsa, i just can't open it | 12:01 |
| shreevatsa | zaibiechu: Where are you? Can you open other websites? | 12:01 |
| xstation | maskd: I did a silly thing I purchased the exe vmware a10 months ago | 12:01 |
| === davidmcq [n=david@test.kenpro.com.au] has joined #ubuntu | ||
| === gilianima [n=yanimax_@lab75-3-82-235-26-179.fbx.proxad.net] has joined #ubuntu | ||
| zaibiechu | shreevatsa, of course, i am in china | 12:01 |
| viper | qemu or wine is a good alternative | 12:02 |
| kingspawn | china prolly doesnt allow wikipedia | 12:02 |
| kingspawn | mheh | 12:02 |
| shreevatsa | zaibiechu: Oh, I think China blocks Wikipedia :( | 12:02 |
| maskd | viper: i thought qemu could only emulate linux | 12:02 |
| davidmcq | any one here had any luck installing breezy on an ibm r32? | 12:02 |
| neo911 | what does the ff mean? im trying to join #java and get this error: * #java ##java :Forwarding to another channel | 12:02 |
| neo911 | * ##java :You need to be identified to join that channel | 12:02 |
| xstation | good bloggs in china | 12:02 |
| viper | maskd no take a look at the docs | 12:02 |
| RemoteViewer | "Add comment to this bug" in malone doesn't work or is it just me? | 12:03 |
| kingspawn | neo911: means that you need to register with nickserv to join it | 12:03 |
| === elsvent [n=elsvent@59-105-105-247.adsl.dynamic.seed.net.tw] has joined #ubuntu | ||
| davidmcq | neo911 .. i think it means you ahve to be identified to join that channel :) | 12:03 |
| xstation | maskd: install win2003 server and vm ware and ubuntu as guest | 12:03 |
| elsvent | hello, i have a xorg setup problem could i ask here? | 12:03 |
| RemoteViewer | JavaScript console in firefox throws errors and i don't get a textfield to enter something | 12:03 |
| maskd | xstation: is thatwhat you're doing? | 12:04 |
| neo911 | davidmcq, i think i had that idea but it didnt really tell me what to do | 12:04 |
| === DarkMageZ [n=DarkMage@ppp9-174.lns1.syd7.internode.on.net] has joined #ubuntu | ||
| kingspawn | neo911: but i did | 12:04 |
| shreevatsa | zaibiechu: Try http://desktoppub.about.com/od/ocr/ But with China blocking a lot of sites, I don't know if you can access anything at all | 12:04 |
| davidmcq | neo911 .. sorry. ... i shouldn't be a smartarse :) | 12:04 |
| davidmcq | you have to register your nick i thin | 12:04 |
| davidmcq | think | 12:04 |
| xstation | mashd: no but since I have purchased the vm software whats the alternative? | 12:04 |
| neo911 | like "/register neo911"? | 12:04 |
| DarkMageZ | can an amd64 breezy user do "sudo modprobe sk98lin" for me please | 12:05 |
| kingspawn | neo911: /msg nickserv help, probably | 12:05 |
| neo911 | i get unknown ommand | 12:05 |
| davidmcq | check the freenode website.. i seem to remember something there | 12:05 |
| === Sonderblade [n=muh@host-213.131.147.169.addr.tdcsong.se] has joined #ubuntu | ||
| maskd | xstation: if viper is right, then you could try QEMU | 12:05 |
| maskd | xstation: im giving it a go now | 12:05 |
| zaibiechu | shreevatsa, ok i can open this | 12:06 |
| viper | I got WinXp working with qemu just the other day | 12:06 |
| xstation | maskd: did look at it looks pretty complicated, how you finding it | 12:06 |
| maskd | just installed it with synaptic | 12:06 |
| davidmcq | has anyone had a problem installing breezy where the installer hangs at the message: "loading archive copier"??? | 12:07 |
| xstation | maskd; you need allthe extra bits | 12:07 |
| === rob_ [n=rob@host-80-194-146-18.static.telewest.net] has joined #ubuntu | ||
| rob_ | hi | 12:07 |
| SKoRM | hi | 12:07 |
| rob_ | what package provides dh_clean? apt-file doesn't give me anythign for it? | 12:07 |
| === klm [n=isometsa@a81-197-211-180.elisa-laajakaista.fi] has joined #ubuntu | ||
| xstation | maskd: what do you use it with or for | 12:08 |
| rob_ | also, I have an application shat shows a square for each character in a font when it's run under nxclient, has anyone seen this? | 12:08 |
| === genevieve [n=geneviev@relay2.cnca.ph] has joined #ubuntu | ||
| xstation | maskd: whats the config file like pretty strightforward | 12:09 |
| === Hobbsee is now known as Hobbsee_away | ||
| DarkMageZ | no amd64 breezy users? | 12:09 |
| maskd | xstation: i'm pretty sure you need kqemu | 12:09 |
| xstation | maskd: so did you install kqemu with synaptic | 12:11 |
| === dssjon [i=dssjon@silenceisdefeat.org] has joined #ubuntu | ||
| davidmcq | anyone here running breezy on an IBM r32 or similar? | 12:11 |
| rob_ | and the answer is..... debhelper | 12:11 |
| === pitti_live [n=ubuntu@195.227.105.180] has joined #ubuntu | ||
| maskd | xstation: nope, installed qemu, you can download kqemu off the website | 12:12 |
| dssjon | im running on a t43 | 12:12 |
| maskd | but you have to complile it from source | 12:12 |
| === GNU_Style [n=GNU_Styl@124.6.172.91] has joined #ubuntu | ||
| === pitti_live [n=ubuntu@195.227.105.180] has left #ubuntu ["Ex-Chat"] | ||
| neo911 | my acpid doesn't seem to work, i leave my computer idle for the time set in the Preferences-> Screensaver ->Advanced->Display Power Management but it doesn't turn off like XP does... what could be wrong | 12:12 |
| davidmcq | dssjon did you have any special tricks installing? | 12:12 |
| === GnarusLeo [n=gnaleo@33.80-203-115.nextgentel.com] has joined #ubuntu | ||
| davidmcq | dssjon: i've just bought a second hand r32 and it hangs during the install :( | 12:13 |
| xstation | maskd: so you installed qemu with manager and downloaded kqemu and installed it--hows it running any snags | 12:13 |
| neo911 | i just want it like when it powers down after the time set, when i turn it on again it will have all the previously opened apps up and running again as when before it turned itself off | 12:13 |
| dssjon | david, everything worked for me.. didnt really have to do much except configure the acpi stuff | 12:13 |
| === shreevatsa [n=shreevat@59.92.140.170] has left #ubuntu ["Things] | ||
| davidmcq | dssjon: i've never had this problem with ubuntu before.... must have done a dozen installs :( | 12:14 |
| neo911 | what's a IDE for java in ubuntu? | 12:14 |
| dssjon | thats wierd.. | 12:14 |
| === oneleaf [n=oneleaf@219.130.24.233] has joined #ubuntu | ||
| dssjon | have you installed another OS on your machine? | 12:15 |
| davidmcq | it hangs during the message "loading archive copier" | 12:15 |
| neo911 | dssjon, are you addressing that to me? if so yes i have dual boot | 12:15 |
| === sleeptyper [n=b@2001:618:400:0:0:0:51c5:3c4f] has left #ubuntu [] | ||
| === AshenSugar [i=godfight@c-67-164-101-249.hsd1.or.comcast.net] has left #ubuntu [] | ||
| davidmcq | yea.. i hate to say this.. but it has that other OS on it | 12:15 |
| dssjon | neo, you can use eclipse | 12:16 |
| === LoPMX [n=lopmx@83.19.133.162] has joined #ubuntu | ||
| === lbm [n=lbm@x1-6-00-13-10-7a-d1-e4.k233.webspeed.dk] has joined #ubuntu | ||
| dssjon | neo911, i was referring to david before.. i will try to clarify next time :) | 12:16 |
| xstation | maskd; whats the url for kqemu? | 12:17 |
| dssjon | david, so its safe to assume this is an ubuntu specific problem | 12:17 |
| davidmcq | hehe.. the art of irc cross conversation :) | 12:17 |
| === blujay [n=blujay@adsl-68-95-135-135.dsl.rcsntx.swbell.net] has joined #ubuntu | ||
| davidmcq | dssjon: actually.. i tried suse 9.1 and that hangs too :( | 12:17 |
| === hatake_kakashi [n=meh@60-241-2-216.tpgi.com.au] has joined #ubuntu | ||
| davidmcq | but XP installed fine | 12:17 |
| SKoRM | sif, Ubuntu = good, installiistion = "needs a little work" but still unbuntu it good :) | 12:18 |
| neo911 | hey what's the danger installing a pkg either throu apt-get/dpkg or synaptic with very low hdisk space? will it mess up my ubuntu install if it runs out during the install? | 12:18 |
| davidmcq | i have a sneaking feeling it's a bios thing.. but can't think what | 12:18 |
| === david2 [n=david2@136.Red-80-32-206.staticIP.rima-tde.net] has joined #ubuntu | ||
| david2 | hola a todos los usuarios de UBUNTU | 12:18 |
| viper | xstation I dont think you need kqemu | 12:18 |
| dssjon | hmm.. sounds interesting. | 12:18 |
| david2 | hello | 12:18 |
| SKoRM | hi david2' | 12:19 |
| viper | xstation just do qemu-img create os.img 8G | 12:19 |
| davidmcq | dssjon: depressing.. i hate it when xp works and ubuntu doesn't :( | 12:19 |
| david2 | something can help me to configure the net with ubuntu | 12:19 |
| davidmcq | david2... ask away :) | 12:19 |
| viper | xstation then qemu -hda os.img -cdrom /dev/cdrom -boot d -win2k-hack -m 256 | 12:19 |
| SKoRM | david2, what type of internet connection do you have and how do you connect to it | 12:20 |
| david2 | ok | 12:20 |
| david2 | thank | 12:20 |
| xstation | viper: your going to fast but thanks | 12:20 |
| david2 | see you | 12:20 |
| david2 | i come here in 5 minutes | 12:20 |
| === oneleaf_ [n=oneleaf@59.36.4.100] has joined #ubuntu | ||
| === gremid [n=middell@p54BDE287.dip.t-dialin.net] has joined #ubuntu | ||
| SKoRM | lol | 12:21 |
| xstation | viper: just like you said sounds pretty good whats the -hack for?? | 12:21 |
| viper | xstation thats for a winxp bug | 12:22 |
| viper | but you can take it out | 12:22 |
| dssjon | davidmcq: is your R32 used/refurb? | 12:22 |
| SKoRM | sif, still installing | 12:23 |
| viper | xstation its used to stop windows hanging | 12:23 |
| xstation | viper: thing is I have xp on RESUE disks for my laptop but I suppose I could borrow a copy he he | 12:23 |
| === holler [n=holler@cpe-66-69-101-208.satx.res.rr.com] has left #ubuntu [] | ||
| === student [n=student@pc-655.puv.fi] has joined #ubuntu | ||
| davidmcq | dssjon: refurbished by IBM | 12:24 |
| === tombs [n=tombs@ip5650dcfa.direct-adsl.nl] has joined #ubuntu | ||
| xstation | viper: the above instrcutions sound really strightforward | 12:24 |
| xstation | viper: or even a win2k dick | 12:25 |
| xstation | disk | 12:25 |
| === Aidamina [n=aa@145.33.160.93] has joined #ubuntu | ||
| tombs | hi all | 12:25 |
| viper | xstation yeah it would be alot quicker - kqemu module can be installed but is not required | 12:25 |
| dssjon | unfortunately ibm doesnt care if linux works or not :[ | 12:25 |
| === Black_Bishop [i=vic@ip68-96-173-125.lv.lv.cox.net] has joined #ubuntu | ||
| davidmcq | dssjon: i'm sure that's true.. but i would be surprised if they deliberately STOPPED it working | 12:26 |
| pierre__ | how can i make a text terminal from stand-alone keyboard and monitor? which hardware do i need? | 12:26 |
| === neomancer911 [n=neo911@220-245-214-98-act.tpgi.com.au] has joined #ubuntu | ||
| viper | xstation your going to need a disk | 12:26 |
| xstation | viper: so whats the purpose of kqemu | 12:26 |
| xstation | viper: disk for what? | 12:26 |
| davidmcq | i've read reports on line about it having been installed...i checked that before i bought it | 12:26 |
| xstation | viper: you win2k or xp | 12:27 |
| dssjon | no they wouldnt do that.. but i remember one time they would not help me with system restore partition issues because i had a linux dual boot setup.. | 12:27 |
| === oneleaf__ [n=oneleaf@59.36.7.18] has joined #ubuntu | ||
| viper | xstation kqemu is required to build from src | 12:27 |
| davidmcq | yea.. that's just brain dead help desks though | 12:27 |
| davidmcq | what do you expect? | 12:28 |
| === Hobbsee_away is now known as Hobbsee | ||
| dssjon | hehe | 12:28 |
| davidmcq | they have enough trouble remembering where the power button is :) | 12:28 |
| dssjon | yeah i was pretty much trying to bum a free rescue CD.. | 12:28 |
| viper | xstation if your building from src your going to need it - and you also need an opperating disk of the os you would like to emulate | 12:28 |
| dssjon | but they dont do that anymore | 12:28 |
| === notmobius [n=notmobiu@cpc2-colc1-0-0-cust454.colc.cable.ntl.com] has joined #ubuntu | ||
| === lwelyn [n=lwelyn@p549A664F.dip.t-dialin.net] has joined #ubuntu | ||
| davidmcq | i must admit i'm pretty annoyed.. but oddly there is nothing on google about this that i can find | 12:29 |
| === GaDeRaTuX [i=gaderatu@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| xstation | viper: when you install kqemu from source and run config where would you point the files to go and since its from source I would need to later bash to find it | 12:29 |
| === ramvi [n=ramvi@113.80-202-106.nextgentel.com] has joined #ubuntu | ||
| === notmobius [n=notmobiu@cpc2-colc1-0-0-cust454.colc.cable.ntl.com] has left #ubuntu ["Leaving"] | ||
| dssjon | david, what part of the install process does suse hang? | 12:29 |
| === gremid [n=middell@p54BDE287.dip.t-dialin.net] has left #ubuntu [] | ||
| Yoric | I'm writing a script and I need a little help. | 12:29 |
| Yoric | Is this the right place to ask ? | 12:29 |
| === __Ace__ [n=love@kr-lun-162-144-233-83.3.cust.bredband2.com] has joined #ubuntu | ||
| SKoRM | maybe | 12:30 |
| === darc [n=darc@c-71-196-229-240.hsd1.co.comcast.net] has joined #ubuntu | ||
| davidmcq | it seems to be similar to ubuntu.. but it wasn't my CD.. a friend tried it for me in case it was just ubuntu | 12:30 |
| Yoric | Ok, here I go. | 12:30 |
| davidmcq | so i'm not really sure | 12:30 |
| === ohoel [n=beshy@unaffiliated/eruin] has joined #ubuntu | ||
| === darc [n=darc@c-71-196-229-240.hsd1.co.comcast.net] has left #ubuntu ["Leaving"] | ||
| Yoric | I'm writing a small daemon to resume my bt downloads. | 12:30 |
| Yoric | I name the user bt. | 12:31 |
| viper | xstation try apt-get install qemu | 12:31 |
| Yoric | The download directory is on a disk belonging to group disk. | 12:31 |
| === mahangu [n=mahangu@220.247.248.149] has joined #ubuntu | ||
| dssjon | if it was me i would compare the distros and see if they hang on a similar part of the install.. i have a dell that ubuntu wont install on because of cd-rom issues | 12:31 |
| === rob_ is now known as bobbyd_ | ||
| === G0SUB [n=ghoseb@ubuntu/member/g0sub] has joined #ubuntu | ||
| xstation | viper: thats done already | 12:31 |
| davidmcq | wont.. as in "never" .. or you can get around it? | 12:31 |
| Yoric | I'd like to give bt write access to one directory of that disk (say, /mnt/storage/bt) | 12:31 |
| viper | wget http://fabrice.bellard.free.fr/qemu/kqemu-0.7.2.tar.gz | 12:31 |
| Yoric | but not to the whole disk. | 12:31 |
| === Terminus [n=justin@210.213.130.239] has joined #ubuntu | ||
| === marco__ [n=marco@p508FFA5A.dip.t-dialin.net] has joined #ubuntu | ||
| dj-fu | Yoric, so chmod the directory correctly | 12:32 |
| === obontu [n=obontu@80.179.185.46.static.012.net.il] has joined #ubuntu | ||
| marco__ | hi | 12:32 |
| dj-fu | chmod u+rwx /mnt/storage/bt && chown bt:bt /mnt/storage/bt | 12:32 |
| Yoric | dj-fu, that's done and seemingly insufficient | 12:32 |
| xstation | viper before I run wget then I need a answer to my question re config and bash see above for my question | 12:33 |
| dssjon | david, wont until i write custom drivers.. which isnt going to happen. :) | 12:33 |
| davidmcq | ouch | 12:33 |
| dssjon | or until someone else does... | 12:33 |
| === DarkMageZ [n=DarkMage@ppp9-174.lns1.syd7.internode.on.net] has left #ubuntu ["^-^"] | ||
| obontu | hello, how do i create a launcher for my dvd drive? | 12:33 |
| dssjon | i primarily use my T43 though | 12:33 |
| xstation | viper: when you install kqemu from source and run config where would you point the files to go and since its from source I would need to later bash to find it | 12:34 |
| davidmcq | dssjon: that sounds like a worry for me then.... | 12:34 |
| === vicks [n=vicks@c-d68870d5.033-42-67626719.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| dssjon | david, what does? | 12:34 |
| viper | xstation take a look at this --->http://www.codepoets.co.uk/docs/qemu_windows2000_on_ubuntu_linux_howto | 12:34 |
| Yoric | dj-fu, /mnt/storage is rwx | 12:35 |
| === SWAT_laptop [n=SWAT@145.48.11.233] has joined #Ubuntu | ||
| Yoric | dj-fu, /mnt/storage/bt belongs to group bt | 12:35 |
| davidmcq | well.. i haven't got the skills to write custom drivers even if i had the time | 12:35 |
| === thefish [n=thefish@unaffiliated/thefish] has joined #ubuntu | ||
| Yoric | oh, wait, maybe that's the problem | 12:35 |
| === Yoric will do a chown. | ||
| davidmcq | i would hate to think i was stuck with XP :( | 12:35 |
| dssjon | your not stuck with XP | 12:35 |
| === HIURIKAS [n=hiurikas@e180100169.adsl.alicedsl.de] has joined #ubuntu | ||
| === brenner [n=brenner@144.134.159.192] has joined #ubuntu | ||
| SKoRM | you have 98 and 95 and 200 to goto | 12:36 |
| SKoRM | *2000 | 12:36 |
| === Halarick [n=lestat@ACCE7AF0.ipt.aol.com] has joined #ubuntu | ||
| dssjon | its just a matter of troubleshooting.. check out the plethora of linux-thinkpad forums | 12:36 |
| davidmcq | SKoRM .. that's not even funny :) | 12:36 |
| SKoRM | not to mention 3.11 2 windows dos 6,5,4,3,2 then theres pc dos | 12:36 |
| === HIURIKAS [n=hiurikas@e180100169.adsl.alicedsl.de] has left #ubuntu ["Leaving"] | ||
| davidmcq | dos.. now there IS a possibility | 12:36 |
| dssjon | linux-thinkpad.org has helped me out before | 12:36 |
| === jj__ [n=jj@c-69-143-50-245.hsd1.va.comcast.net] has joined #ubuntu | ||
| davidmcq | i've never run a dos machine | 12:36 |
| === hawaisurf [n=jaume@dejamesal2.campus.luth.se] has joined #ubuntu | ||
| === LoPMX84 [n=lopmx@83.19.133.162] has joined #ubuntu | ||
| === Pecisk [n=pecisk@62.85.86.242] has joined #ubuntu | ||
| Yoric | (well, thanks dj-fu in absentia) | 12:37 |
| SKoRM | i've gone way further back, i have a BASIC laptop | 12:37 |
| davidmcq | thanks dssjon .. i haven't heard of them.. i'll go looking there | 12:37 |
| SKoRM | 10 print 'hello world' | 12:37 |
| hawaisurf | hi! wich applications is used to run ssh session? | 12:37 |
| xstation | viper; now I understand why you did the windows hack nice one | 12:37 |
| SKoRM | openssh | 12:37 |
| === HIURIKAS [n=hiurikas@e180100169.adsl.alicedsl.de] has joined #ubuntu | ||
| === mathias_ [n=mathias@chello213047054216.31.11.tuwien.teleweb.at] has joined #ubuntu | ||
| hawaisurf | thx | 12:38 |
| === mumcoco [n=coco@dyn-83-153-196-180.ppp.tiscali.fr] has joined #ubuntu | ||
| === markymarknz [n=mark@219-88-75-156.jetstream.xtra.co.nz] has joined #ubuntu | ||
| === petitohaime| [n=petit@dyn-83-152-26-97.ppp.tiscali.fr] has joined #ubuntu | ||
| === HIURIKAS [n=hiurikas@e180100169.adsl.alicedsl.de] has joined #ubuntu | ||
| === markymarknz [n=mark@219-88-75-156.jetstream.xtra.co.nz] has left #ubuntu [] | ||
| === Nolt [n=Nolt@aul190.internetdsl.tpnet.pl] has joined #ubuntu | ||
| xstation | viper: no need to get source and install ubuntu version and then do what you said before umm wondering if you could two seperate static ips like in vm ware one for ubuntu one forwindows | 12:39 |
| === erlends_ is now known as Fudge | ||
| === Fudge is now known as Fudgie | ||
| viper | xstation if you get networking working with qemu let me know ;) | 12:41 |
| === tsrj [n=tsrj@218.78.236.175] has joined #ubuntu | ||
| === Sturek [n=jens@dialin-clp-080-228-34-037.ewetel.net] has joined #ubuntu | ||
| SKoRM | sif ;(, i might have to put winblows on my laptop | 12:41 |
| === JLiquorish [n=jliquori@cpc2-mapp1-6-0-cust3.nott.cable.ntl.com] has joined #ubuntu | ||
| xstation | viper: I could do but it seems inferoir to vm ware whats your email send it on a seperate channel | 12:42 |
| dssjon | davidmcq: it appears that many suse users have installed successfuly on the R32.. | 12:42 |
| === TheFuzzball [n=TheFuzzb@212.32.120.168] has joined #ubuntu | ||
| TheFuzzball | hello? | 12:43 |
| Frogzoo | xstation: kqemu is pretty good | 12:43 |
| viper | xstation hmm - private msg's not alowed here? | 12:43 |
| === joachim-n [n=joachim@ACCAFC73.ipt.aol.com] has joined #ubuntu | ||
| maskd | it'd be cool if there was a gui for qemu | 12:43 |
| SKoRM | if your regged you can | 12:43 |
| Frogzoo | viper: you need to be regist'd | 12:43 |
| maskd | or is there already one there | 12:43 |
| === pjv [n=pjv@cor8-ppp54.bur.dialup.connect.net.au] has joined #ubuntu | ||
| TheFuzzball | who knows how to fix Adept when it says... | 12:43 |
| maskd | i know there is one for mac os x | 12:43 |
| TheFuzzball | You will not be able to change your system settings in any way (install, remove or upgrade software), because another process is using the packaging system database (probably some other Adept application or apt-get or aptitude). Please close the other application before using this one. | 12:43 |
| === mescaline is droppin out (autoaway).. [log:on] | ||
| xstation | frogzo: did you install from source | 12:43 |
| maskd | TheFuzzball: have you got synaptic, aptitude or update manager or anything open? | 12:44 |
| TheFuzzball | no | 12:44 |
| Frogzoo | xstation: there's a script to install kqemu - totally hands free install | 12:44 |
| === lucaas [n=lucas@h250n1c1o1124.bredband.skanova.com] has joined #ubuntu | ||
| Frogzoo | !kqemu | 12:44 |
| TheFuzzball | the last thing I did with it was update to 3.5.2 | 12:44 |
| maskd | Frogzoo: kqemu goes a lot faster then qemu? | 12:44 |
| TheFuzzball | but its supposed to be stable | 12:44 |
| xstation | viper: ok do you have any form of commiucation | 12:44 |
| pjv | is there a evolution plugin that keeps evolution on the systems tray on gnome? | 12:44 |
| xstation | Frogzoo: what are you running | 12:45 |
| === PHDJYHLEU [n=PHDJYHLE@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| === KRQPLFFAP [n=KRQPLFFA@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| === ZZMIHKXHG [n=ZZMIHKXH@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| === BIZJFATDZ [n=BIZJFATD@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| === SKDICMISL [n=SKDICMIS@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| === CNZJEKNEM [n=CNZJEKNE@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| === CGWQEWFJB [n=CGWQEWFJ@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| === IOLGSCMEE [n=IOLGSCME@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| === SMRNZACBI [n=SMRNZACB@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| SKDICMISL | IQKHOSIXVQPAPLFRFWLVLXJNWEDDLTJGQHLIZKHTSNZSZIWLQIPDTWTMQOXYSHXXRHODSCCDYANPHVBJFORVYRCXYXUUTWIJBSQTHEIEFYXCDCQJAWREFSCQIRWDWVGURCPWWWQVTMETSFZLWVUJIFLEHZMOMKQFHHIQXHBCEUUWCKYATULEBOCFKGDAVPRSBPGEMASTYNWDMHGSLQFPXUDLIQZROJRLMKSIJWKARUHZZOPSXKAIUGXSMQXZYTAZDUFHPJQVTXQSHXEYDIVCVZHXYQNPDSUUGNFVUBJMSJGGE | 12:45 |
| === SKDICMISL is now known as ODAIERFYZ | ||
| ODAIERFYZ | STLZXNTORWIXPGPNFHWNCSWZTRENHPESFQNAQPFSQEVEZNJQVAKNHXLLFVUMMRRFPWNSPRQUCHXHTGGRHVEBZNMBGIKHMGLXJHJLFSEPFJOFEKEMDYISZEXLXHMDCAGWMAQPTNECSEGXLPHCCZAVOJWUHUMPAXAFEEVYLHSTNAPPHHDIVGIHPQHJFTMDFCMBCCUSXNKXQFZJZNLOOMRNFZYIPTFUVTJMIHGNWQGIHWQUTBHJQAQBRUZSYPQJNOFRAAJYCLEVOMOPFBLBBFJREOUZJDNEWFHTQSOWALCLEDGSD | 12:45 |
| PHDJYHLEU | PCDCABFQBMRTZMKHMZGZMGHYAXXNHQYVWBINIMOGTUGZKBNJBXUQIBEBPSQBYQWMDVKRGZTFVWDJYQEUWREXILGEFEQJUZRWFFIHSJDBDTZTUQSJVBHIAASAMRHRBMSDSIWLQUAGTYUATXIXOCQXIFXOEPZGAFDQTRJBGNXFLXPQNGTKHFGRVREGNCLOIDXBUIZATAWQYUEXWWKUHKKOHNQGYKMRCZAGGFQLXYMTWUSUCNSZPWVCFSSSVLIOVHQCHTVUFSGTOKDXXDEANGRISAIENWMWBYSRWNPHUIXMQCQXY | 12:45 |
| KRQPLFFAP | EEHCKFUGHZLFYYNEKMIKAOZDVEKGBJHQAKQVUQWZYLBPHDXMWNZLDWYCITSZMDHYBQMNAYVJTVHGRIPODHEUQQJGTWKYOCAEZMSAFHUAIPDEISFUNFZGPQJUDEFZJULIEJRIHXJUATMWGGBWUNJDLVHDIUESCJHOOOYAQKBLBKSOGUGIFSNJHGIWIAMTXLRCGDJUTLYHTWWYOAQUZJEMZNPYZSGKNAKFQLXIIFSCOKEBYNIFMYJYJDBQFGUBQEJAMXELWLUYKXZVGQWUNUGCFJAFUTHWARVRBVAUQHRVJHALW | 12:45 |
| BIZJFATDZ | DWYXHRMWCFREBGCJZGHZNZMFJVCMWHLSFZHRWNTBSSYUJCQUNRKHFQTQGDGJJRBZKUONJLJUAXLUYKFGUGVQBJWHFSKUODGGOIFCIUQJYDOREYBMYVTBUPWTKBMSZASTCLDAMJFTWFNIIZBGKEPSRXKOHNRPXVOCCYPDRUEMIDBOYODJWFJNEKHCGOAEAWZJFGQWYPTSYTWBPHKDSWWBEGBBCZMEOZURNFFHHVZCONFVOHGYGNMDJZFJLFOWEXIZHIVQBRPSTVEKNDCFCDPPNXAMQAZCLVPZVBPWZEDKFNKHU | 12:45 |
| CNZJEKNEM | DGTPBBCFHEIAVYFHXQZDGQUJYBPUCBYUIYHQYDBDFVLHLAETBFMZSOKWQKBTGWIKUNSMYVMJZNPBXEGHTZYPUIVFFXPGVGRYJEHFBQBZNKCEQZLUCSXROPHAVAGVHCBRSAWPRRNFCSOHPUMSMHXGUUQTTARTMGNACNCFSSJQUIEOAETBZVEYMPJNLKSUDBODRFXBNZUSMTTLMFNCPEOHJNKHUKIRKZKGHHEXOHJVRQYNZWQKSFOKREYDMWVCODOLDHPEUNBIRCYYCERLFKTACFCLZWLPCOQKXZSXSDNUILXRN | 12:45 |
| === CNZJEKNEM is now known as VZAJBSVUN | ||
| VZAJBSVUN | AVPLTBWKTASJZCUCOBOPRUJWYQUIFJBKUWCRMOQEPYQYVFMNQPDVRLHHZSZMDERFYRSSZTFHPWIYCDFSMBQSLVHGEICJJHWFWKDZBSOFQQCQOWQELVQGUSYKMHHXQMASZRYHOFDMFTGXQCPOSJTSBCYHDHITPRIKDMZCGLFQZRSKOSXAAXWLNOUDKAHUCTSJLHUXGMMKYSBZJQIOAKLJZSSOIHXQUEHLNXFUCAMCLLLAUOSLNRIELYNFYIUYZJSWIRAKXONUHURCJFRIJEPXCRCRLDHZFIPOOJZUIKBUXMQWN | 12:45 |
| CGWQEWFJB | UGGTBTDHOPPTMWZGAZNRIZOLQMLWSDUDKHBMGXKDEROSPDWNMHLFOLBLYAQEXAKQYBRMWCLQHIPARWUDHMPDRXMFEMYTQYRVDGEERIJLKUHBYNFRMQZVASKUWDDFOPQIPFYAFHSYRZGICTYRLOSVWOKCXSPRFUUDQOSXPSYZXOLVHBYVVRYAFDNRONZOXEYMTURVPYMJUKPXVLBMTUMWQWCYDRBGSYKERUAEWSWOUNDUUCVYRPWBHCQYQDVRGKJOLKADWBFWVWOYKYUTJAEOKYOSXRJJXCGRQHZIOBOWHCRKU | 12:45 |
| === CGWQEWFJB is now known as AEYOUXHLS | ||
| AEYOUXHLS | WJOAQUVMALQOYTGUMMDVDQPXSQNMYROZZWMPVGTGWRZFINOBCCXUGURNCVKFHYDSAWBCRFRIFFICONBXKVMXZLRHLJKVMGOTOKNJVDZVAJBYFUPMHHNHCAFCVMNEKAXNETWDNQHGCUVWMHRXNRIXLAHIYGXWZAVUVLGXRAXCGSJRAPDZEXFNTOVZFQWHELGKWYHKCJJNKPEEMHUMZZUUBTCCLZENKHMWKIBNEHPUJXFTZIQHFQPNFYOAWDKHAYJIFWUQABUROFIIPNVNJEXAXYKEQOEIXFVGCVWZFSSVOWUAD | 12:45 |
| IOLGSCMEE | UFEZBTWSAWZBCBYBEBOSHSWJCAUMDFYKNXKUZGELCZOYKBOARZFNBEJAVAJUAUMQXQDDLSVLMWAGFTSHVEWRCJHWCXKJGEDKUNCPPLKSYIWFEEVXKWZDECRMLORTLZUXLZEGXKKCEHMIYBBLJAFMHPQGJVLUKWCRDKOMMOOSDZBUQAVWRXMPVLIGUJFFZCCUGRXWHXTHPZBRYQUWIDALIFOIDRKMXBFMRVEZECUNEONHZMDNVJKDMTYLFTZLIRPFGADAATSQIYJNHCXVKWHYUCERAEUBHKBSXLVQNZVESUQHF | 12:45 |
| SMRNZACBI | XPQSGLRBXKGHLWAYBITRZANCWODIWLHPBHXXMAEPNPMKNMVYSXYNZCQRMGEPHKVSZLYRPMXWWTNLDOASEVLVYGYUDESAQRPIUAVCLZLCIKSBHOUEJUNZSLOPBYMPBZSZJFSERZJDLXLCFNQSPDENQPCAHYHFQDZBOIIBBZKKOBYSDNGTBMRAKTTQDNPTMDHXEFADXVFRJXYORSLPPQNOIWYGYAHHNFNUXPQCNXYEWPMKPXJLTELXKYOSELQPUDAYXZEWNDIMBFKKUMKMHWQIWAWYTPPFHRLDUMJYNAHLWIKLY | 12:45 |
| === IOLGSCMEE is now known as MDSXILJEA | ||
| MDSXILJEA | VCHEEKMUNMKFDOXBMFERBHRNQIMKEFKACRSULPWZREXEEBMBTJEXWYQOWLFTLWANRSIPLQWZCOMMZGAIVUPDBEWWAJWJSACHCYZXVBHEZCXSTQDRYFLATWQCIMDQGEANYORKQLSGIRERZPFAHNEECGYEEPDZHYOHNPWTXOBBZJAIYTUGXBUIFYJENFSJJQBOCHEITBNNXWZMFIFAUXZCJJNJERXPRJLJCMRJKIMOITKJYLGMZWKPDLHEXBRZOJKJYUXAQVMVXQWXSXEIYIQKGHDFEXMRIFUGVLPYODNNRWNJU | 12:45 |
| === SMRNZACBI is now known as SRFZTRKYS | ||
| SRFZTRKYS | NPVLWKHRFDQXHLRDKKFPHPXQJWYGNZFVWXZTHQYQLVSIBDGPJKYRLGHEJUTJDNLQJIVGGZOBJEQJYYIITCIOJZOLIMGZQPVHBGOSHKGLUAXTTTSOTYBOPKQIYMYQCHMLWQEORODQTDOLFUXWTBJLVWVADKFJIJCWRTUFSHBEDFPVITVDIMGLHHKBWZFTFBTZMEGDBBBIVDIYLZQHYHEKJNPHNDGAAQTFWWIVCVVPDFJNSMOZIOLQWFGRJIKXCGEIAQVSRRLYYVQOISRCCGTFFNXKPZPRKHFDQLAGFTVWACJWV | 12:45 |
| ZZMIHKXHG | NUFADKJTKTVBPVWWEGMKNLWTYJGDMIPIYEKNAWNXVZVFVPIWCFLRPXGAWBDTPCVDIYIICXRAJLSLCPPXKZIGKJMJLRNRPPWIMVXWKMELDPZMSAIZJOMGFYJAVPGBGYSWOPCJKBKWPKYTDUGBDRYZWOHQACXOMWBLALSTUYTBFRJTPOMKIAVTXCIICVDHBEHVQCELGRMXUAWTEXYWJJPYWDFYHBASWGUFUKZFCDBUXQWVBMJVCBLWNYDCZUXTMYNOFNAIYOLAKMUDENEZWQPKIJYLBAQUVRGINJGUSYWNWSVFB | 12:45 |
| maskd | TheFuzzball: i hate to say it but have you tried rebooting? | 12:45 |
| === ODAIERFYZ is now known as MWYAZTIOW | ||
| === MDSXILJEA is now known as AUDGNPJJD | ||
| === SRFZTRKYS is now known as EEYRJAVAH | ||
| === VZAJBSVUN is now known as FRCJXSNCW | ||
| === AEYOUXHLS is now known as UISCSMMOC | ||
| === PHDJYHLEU is now known as XCTSKBKEV | ||
| XCTSKBKEV | HINOYLNVPJBZYIQRAFTVYSBIZKIAWVJYQGHMTBYTJBUUXZVZDSJKBENRFGJRRHFKQLZGHJCQAABJGJHXNLKBKIWDEUFKNEURUWRWRDQKNTKIONCANHRZDGHQPEUMJZROCPTHKDOYINUOJVDGWIQNLEWSRAVNAQCMDKIWBHUNKDGIGJQIZGITYZTAYRMFYVZXRMGFXGYJZCMEGLDDJYPUXCJDGRAAQZDAVXHLYTPVPPLCTYMRXSKBJRIZSEQKJACQLRYVNSFUDTRHMBDZOGLQJYBXOWEPKWRFQJFTKBZOGGEMP | 12:45 |
| === XCTSKBKEV is now known as GOSXRABKX | ||
| === KRQPLFFAP is now known as GIBYAWXPZ | ||
| GIBYAWXPZ | BEOPDBYLCMVBIRYFXRZPDBXCPIXYNZQSRTYQKHAANLBRNOBCJXHSRJQCMIOCCCNZXOARNRNJFZAAXYRJRSZGIINQJHPOZJUEYRMCHBTBPKGOEFXGOCDYPGBJKJMILEGTRXIWQLVJGOYLPRJGMRJBGXQAWROIZJPDRVOAKMHNJYACQOVYUIZPWSKFZPTQQFHVINCUASHFXZPIWRTCTXPHITZLKSCAJEQGPJWJUZXSXJBPGDHTOCLBZGLZWIWISXAXYPKYDZFJKIFTNYDQEGJSEUSHKVXBYMJOFUGAVTITOBMHI | 12:45 |
| === GIBYAWXPZ is now known as CRLHZGFJD | ||
| === ZZMIHKXHG is now known as SOYVILPZK | ||
| SOYVILPZK | MXTVSOKIQHSZJJIWWUHSMAFASFABWGGBOOWTLRBAPBAZIWYPIYFRLJUMQHBWLHLMSEJIAJOXRGTDHZTLXJYYWCQBVOYYMKPTDKWMOJRWBJRMBRNBHRGUIDJLLAQZFYOEVVZZSEFKUFCSEMJCEKBWTEUJNWQYFVIZERRFZKKBOMSYXGSELBLCKIFLPIYUUHTYWAZYNRRZJEBFFAWZWJGOSXJVCMHNNJJIZGHMNNZVMVDPUMXGSIVNALCFJRPWFXQOMQOTPAGCZOLXBOUYGOOCNTJIYNNTXSCHVLSSUMBTNENWC | 12:45 |
| === SOYVILPZK is now known as TTUDPDNJY | ||
| === BIZJFATDZ is now known as ZVWODZJIS | ||
| ZVWODZJIS | LAIPAYWUOTSJDSWNXKVLTPPUIPEUAUMCWYTBVOGJANMROABUSJARLAWBWCUMJSPOLFNWLWDGCWYFHAANIUKTAMWSVWZPDHATGCCHCMXRQYIOPUSNONLESNYAWWDOLXXMLLCTSEBVQLTPZSVRGWCVYGCGLUBSFNFLJPFMETVFIAXEMGOTUEYFRCZYCUWWOCLNGCZQFWIZKQYPJOHKKJZWNJBCQKEIFUTILALEMFVKPDUUMXDJMXSITZIRKFLYTJXFAAHPUGIHTPFZUCTQDNBOTUOQPIYERFJLVWXWREJYHJUMY | 12:45 |
| === ZVWODZJIS is now known as KDAMZUBJO | ||
| === zenbum [n=zenbum@c-71-198-208-194.hsd1.ca.comcast.net] has joined #ubuntu | ||
| Frogzoo | maskd: actually could never get xp to install properly on qemu, but the install alone seemed to have much faster disk access | 12:45 |
| === bimberi [n=bimberi@pdpc/supporter/active/bimberi] has joined #ubuntu | ||
| MWYAZTIOW | LXRYZTYGEFIMMJFQRKJZQLQKPNINJYUCMWOWAJBZKLDOXNITJWRHMLEQFVETBHJJSZFZRYIFDEGBVJJXFIKPOPUTSCOLHUZJRHGJQJIKBZLZLPLINQJHZFLBVUOSFZOAXEZWKZAGMQMPEEDTCFRKPILQDFILOTFJZFKNYLWTDKZDOPTDXKAWWQGKTALCLCMRCMFKUWRGSEXCLGJICLSBCOMUQAKMGXRMFQYMRSTYNRBLTJVIABHLZPTWEPUHDZESMOVWRMCVIGRWWVBPLWEIFRNSTOHZFRSVPHEJQAFCESRXE | 12:45 |
| FRCJXSNCW | NCXFBMGFMJECWMMQYPPXXOODIJYQQWQTVXAVMUBPQNBBDSZDFIBSAAEMDKPZCPCDQWOUFABUQUQJCWQXZKJGYMVJWKLRPYHBGIIUUFKAYLGCONHXTYHHURSUBZALZDFHVHLHVQTPNLVDTHMBGVAVYKKLLUUBFYLJNUQPYDMJCNNAFVWZZQQQFEZGNQKFCMOJGPKCIRTGJURHFDWJQKLGIECVSWGXHPLBIHKTHOLILSLUYTSEVUQBTTDSETMVOBAVLCITDYYDYUZZJBICHFNGGEODUUIPIQRCBXICUUQBVZWQI | 12:45 |
| UISCSMMOC | EGAZDZIJTUYYUEBOAYMYTWZXXUYNQFCSKMQYORHLNGHHFSMQBJQWCAJLANSQIIHCDGLEIPLIQJHQUTNVTXCGIPMFDJEAOEMMMHKHQOCGACTFTWSGMHXWFOLQJZJXZDPEUQPZXLMYSRFYNUBTBNXDZIMWUBXJCMAEDEKEZNCDPLHKZXXKFSYZGQXQHDXOFZESAKAXIKTHHKAYYXEZIZTLZJCYHGFNMWZSMQVWGDLBFTIWWTKPXXKVJIWEGBDQIWRSHTLKUTUTFGJNZFQWBRTUBOMYBKAFPQBHQFUQOTJJCMFJX | 12:45 |
| AUDGNPJJD | HLYITIFZMKCAWWBIRKSIOZGAASRAPEHFKKQEZOWFZLMPIZLXTAFPQCEREBYTXHGEVVTOGKETZOOGAOBFNWNECXXYINZSQDZAMBBAFKBHPMWVFMCLKHYLXYBOGPXTRLDTEJGEARIMWXBOPGTDVZZEHESIPOYALLLHUEFFTGUEZOGNMONLWIWSPPQSKZSRMGMGMGOFIZVRYPHOXXCNBKPZCTUOJPYUYFBUFSYBRZBLRHCJWTEVLEXYCPDGXTULKNRDUVPEEOAKFWBSJVYTPCSOYENGJQDQRRARDKRGCPNYDPPYM | 12:45 |
| MWYAZTIOW | OZMDPMZWZJMOFICKYXLMCPDJHZYQGPADVLAIHXWBFTJMTHSOHKOGERRUIYXGHPBYRZWJYSSVXBYOTVUWIBYLBDALDAEGWIAKYYAQRYRWMIVAYZADWIKMUSLJCGGRCFCAUUQYDBJDAIYTEBTEEFYQDYFNIGXMYGGREMWBJKDSLQJLRAAWQDCUGVHDEKAWTLKEGECWGZRDYGBMUADVAIHHUNFNGGKOBUXGCJMGHSJDTVJPHBXAWVSKDQJKSCXWSFPEZDODFPFJEDIZKVHELPURIYAOKVJPTYGBRGSRKMKTYLGUI | 12:45 |
| FRCJXSNCW | GHZYLLKTAKPTYZPLCXHOFVVCBMVNISMZXOZXYPUQNDUZVWGPOFGOEGEKORYMZZWPFUZIZPBHZCVKUXZYUFTAPHXWOWBJXAQOBHLRGQFOUKSEHOWLFZZDWPSZKRUVNPGFJXATBCEOWSZUQXOWKZZAJSPTRSYPGCQLNENUNURPDHTXNIUEJZZYPIMOPFEMUFHBYEWSPVAOIXXKJOXYOZJNNFBCGKGZBJUAOLHTQVDXYSEKLVPHLKCAFZRDSMPZXSHQYATSPOCXITCGCMYWAMFGTABGWVIUUZKWYHDXLXYLHSFDI | 12:45 |
| UISCSMMOC | QONIKOPCODGARSAQIDLQNAIFITNNCBTICOUDLZGOWLZRFSMHJHITYGIDXOVAFTSHKWCJXAHVPQIJKBLRWCKMSIJBWOGWMDFLVJAZJXYRXSCZOSPLAQMZHWJMJFRRTLNGDLJSEFQNGLLMNVIAKKUHITOPYBWGNOIZCHUPWQQAQCQOKXKWCFXQPQHRHOMRGDYPZICLNKIJVGTNZIISWTKXGFTANEGLYWFMTGFUNNBXXPDGWGDNGUVMWEHXEIMLETPZGVTUNLORWIFNIZIEFZNPVTLCESRRXASWGIREKMVUIHHXE | 12:45 |
| AUDGNPJJD | SPFRATIRKQVWFBWOZYWFAZOAQQQAMDLTKFUEYLGABJVMPNTSCQYDOEJXZGFJQVUKGDHQRGZNUYZBBILQCFVMIUYNZVXKXCJIMZADVMTDIJHBCLIJNINBLZSHDPCNZEFWOIFJWPFSTIIHWKVOUPSFPBCXHMEYOABQXAPTXFOUHBDSTLHKRQKMKSEEVQXQVKYJEZJCVTCPUWPNIKDQKKDXROCXCPNWSGGUJIYQHQUZBHLDWLKGGSLNQYQJILYJOYTUYDMGTAFBEXFXNAOBBEOLPQOTBADFFAGEKNVWAYJVBUJQB | 12:45 |
| KDAMZUBJO | QKVRXPZSFGPUYPKWBOVVLHIYFYNEPSYJSSZZZESXWRFOYYEIBUVYFHOGPEOGWDRGTFSQUXLXEUYCZNANKQTJHBBZZCEIEDQRKCZSFOMLANZQTFSHSSTDVYBZNAUAKNMOYABCZMFBWXWMPHGYRTIUFHQEHTMHJXQXZJNPGOEDSZPWEKPWRBERROWQWHUHYKGGWUIFMVHUJPXQWXZAOCPRJKAIHVZXIKYVVTZCYAEHNLIQBGEAOOERJDBENWMPBPANRMQMKQTUGGKJEMGTXMDUHHVJGRLOJSYKHCZDACVMIMOFW | 12:45 |
| KDAMZUBJO | SGCNCUNWWALISIKCTJWGGIQHFJMAGSPYCVFLDTSZERCJGPRBERHDHIUJFPYJLRANGKVEYTPDENJAYNMDSQCSTHECQPWJPVGHKZCOKWALUEWRKAPPNSJQQWOGMMGDLFAKIKAIURRDUSCCUXAJAVYYDYQNAXTWCDAALHJDMBEAHRSGOYRLOZQBWFIEWSAUONDFSUDWISTLQLERRPLCWBALDMSACCJTTAPKLUFODTCHDVXQPZYESZUHBHOTVLFGVUTWCZGOJSWTYJIOSSKUOPZVNUKWAHVNGAWMNFLRQTKNOPVCP | 12:45 |
| CRLHZGFJD | PNMVADPGNHADIYVPFFTNDEFDRNPHSDIDCBZHSDTAGYUMKXMODNNGFYEVGECBRRIKJGGOORUUYOTHMEJTWZUCTRVKQDZFAOZCLZAOLUASCRKBSHFECXIDBYYQRBNDFIZDFZOTHNGWDOHSUHIBZIFPJNDDXWDVRGFPCFGPLZIJXGCJLMYYBIQFDZJHGHAPUHHBGNUVMRYVXLNMTBXKYYHBJXLOHAFRRFPDONKFAXBPPXJEMKPNPTVDRAFRHZPRBIWIDIAJUCHRONHTLMJVNGWUVPHIFFVDCXKHNQZRJTUSXLHQB | 12:45 |
| CRLHZGFJD | ANXTZGPSCAPOMTLBPMOQDDCRWONNOXPWQOUDFCHKWDNHJNSZMRSBTPLMPBDYKDGNHTIJCESWAGQKIFNMRZYLSWNZBZGEXRNSJQRGAPRNHPIMSRXFBBKNTYMXXMNGBBVVNTBWBRRAZLAPDEPZUVDUCPWUSQPDOMUTKJFAKEEGFEDKDSYXNEGTPTEGIYUIFIYBEERZTBCYXZBSBUAFAKLRQNPMNQMWQSOSHKPQTFYUJAHQBFFADQGEHQAFHOTADBNBDJGIYAXHYAOKIYILBKKPTOINPEVPDSBORFLCOHGDORBAO | 12:45 |
| TTUDPDNJY | RKRQOBWYVEMOCJGYEKBSMSLBPFIPHXLIRDPQYVGVKYSMKRUTFVMJBEEKADIUZKNMPEEYBOQOCFDNHLJGZXPRPFZGKYLFHBMKIEAPHDGTWULJAZRVTWIMPGYFHUDBINAKMBAFLPFNRMOFMGIOUOODNXKUUKWCQBNAIHBBGPHMVEZXHIVOASSAIHQDKAGUUUODVDQDNIMTBVXZKFUBUQILTCZSHBPVOMJNXGJIQOJDYAAFCJVUZLYSUASPIOARPWZZXIWCDUEQOFIBSRJAHOOTGDUPZSIOAXYAMRLCLIZRPBAPU | 12:45 |
| TTUDPDNJY | SINIPODUCQGGNYLDNGKVAFCIWFGOZTCZVDTCLFUECXYLNNOHTBKOAQFPCOEZYDJDGAPVCWICSMFFKNQLPBQHLKOWMGXKFIIGVYQRRHPZCQBLETFMNUDNNXBRFSMRYORPOTSHHTXZFBWWYBFGRORTLZFKRHGTADQGDTEFQJENLYJNGHAGZLAPDGXPWNQWDFGJRJFWQQTGWNPVSNIUUTPGFEPXZRGYRASALKMXNFWTJYRPJFHQFVNUSRAPILRENIVTMKNEIIYJIBXDTKDJMNOXOLXKPDEHPZJVLKACFWEDKILWS | 12:45 |
| GOSXRABKX | SPBSVMHRFJDZPETHTRNTRSSMLWKVFTLJFAQZUQQPRUVILLBLDNZGZZJUUOXFJZEKIIXTUEHKEWRFEMWTIRBDUGAOBNIMQFDKPALKSRWSZKXVWTEAIDRTLEQNNLARKZOFPDIERSDNWSVOSMCYPQLPLJBXHQUCBZDVWQPIXYVKUPMOTKVZOPFDNUBBZWNANQXIAQYDGCPHGVCLEGTJYPSDVGRJUDSOQCEISXFCZPTQMKVZRXWWFDZULUHVHKGDKMCFDOPIPHTRBDCKEEBJMWARIZRDALNSFIUEPNWRTHLEXDRUC | 12:45 |
| GOSXRABKX | TFZFDDDSSDDMAFXYCPHIUQISSINGDOMUERKIJXHETQQYYTULUIUEIOQIRXGACVETTBVYLCUUHFUCYVFXZBAMLZRNPIWHOZCEYFYZBOBRIYYYKYWROXQEEOMEVJNPUILVTATRYPMQTRAJTZHGESPJXQJSBNTNAIJPOWCVCZZGEUVVYZXLZVVEWANMDKLSQXMIKPTKIIPTYZQAPRPNLNBUOCNHZDCOJLRYRFZHOIFCPIFTEDCCVYGCDHFZWAHJNMNJFMVQCOQAXMFPVKGLXAKTGEQTZKNKZBHSVIGIZGAOHZTBW | 12:45 |
| Frogzoo | !ops | 12:45 |
| ubotu | Help! lilo, fabbione, lamont, Keybuk, jdub, mdz, Amaranth, tritium, ajmitch, crimsun, ogra, CarlK, Seveas, Burgundavia, apokryphos, thoreauputic, nalioth, Madpilot, ompaul, rob or Hobbsee | 12:45 |
| EEYRJAVAH | SMAZPFNKCYTHXHUKPKRDEMMSMSAJJHUIYNRKJWTJDZJZLNJKEWLSJYKPWSWYHJCIIJWPHTBZMJCKJJOOUXXYYIXFNDWUBKGGCLOOJVFLGETLNAPELYZVIHRUAGUNTTQATBWFOMVGXVLLVJMUEMIUWFXHTOMFYEMWWQGMXJWKIPOVMRZHAJEZIEIZHVVKRNBYGZAXHQVJYHSHEINLALHNBOVATWKNXXDDDZUJDVOBZGBGPRLDXVTEGSGYRFKQYRMDBDSQRBBGPEKOXMLURTNRFUROOYXCWIRUREOWRBAVRRMHF | 12:45 |
| EEYRJAVAH | DQRGGIJBJKUJUTMAGBCAAXGXFFJRRVKHFNVIDEBUCLSWJTVLAWBXLSFQERTRPCOVOJGMAKCJGVKICEAAILVZKMUMXGUDDLJDLVWHKUEIWOTJGKNFYYOTQLXLGVXKWSHKVNGFRAZEQXTNNZJXKNOYCZZQVAFLHDMEFTZPFFHOACRROQSKHGCFDYXDQIESPXORGLZJWFFLYRWWTDMPJFLSHHLNLJRWWKWIBWXYVUEGJMGDWTZFKNVMSUOALOLECMSLMCQJFKPBSZOXKZMHRKPDMBRPHBABMVWNVKELKTGINYLSL | 12:45 |
| GOSXRABKX | EUGWHPCUYFOURHWBEVTUPJOLUUHZUKKJGUPDOLZJXSRVXUWBWMCPVOQESXSBAYWALWWIHSNXXTBBXCEGJDNYTEWOIVWKDULYOHYWESZZIGSZAFCPCUNCGHIPWWAEOIITYNWMQVYAKFPETQDQDJJJUNBWIMIQVYBHAMERQZIZJORXYFGCCVVABPFLJXTKEYZVJZGQMPUBGVGNZCPXWPQLQHWHHNUFZIEAMMBIQTXBXHITVTFYYBXWVQWPONLVZSLGEIYRGDRFWIHACGOHUGYJRKAKHNFRMYNNVKFSPULKCVKNQ | 12:45 |
| CRLHZGFJD | WPGILHMPTFUYTRYJXGOEFRBDQAJDYASNCXZBODTOSWWMNQEBHVODAFYPNZINIZMVCBZMGHQMKPNMNKFXLORKMUSTAHHHCXZEIRNTFDSHWHTBOVTJOPLOOSCKJIBPMFWLZTMDDSGWGYVGXIPAYSNTPXISNXSAYFMHNVMGNYKGLJCGYZUVPHUNDQEUAGVWPYDSONMGRFXVDCMYLBVVASOPIZHHAVDKAONJJHBAPRFZSXSXPTSTDSUZNYKUMCWJPTUAOKVPSADPJYLUUVRKGVLKUDDAMNNMKZCXUWNHQICNSHZJQ | 12:45 |
| TTUDPDNJY | KVORQCAWIIGKZPNUZSIATAHFXPTDTAAQDHSJOKZIYRFHZNWTEVGTJOJUVSKKVOCERJJLYMNXPWSCMZRGUWHIEZOUJPCJKQNMRGPUMMUMXHOYGZIZZXUAMSIKEATRIETLMNXZWHPNLGIOJVENMTTTBJDRUKAQYEJLQEAZYRBZLBMNKLWDJAZMFZTORJEPCEFTZNULQLQKXIRABCLUWVLGVKTXNKNQFSBOWLIMPKNQOHSAZGPVWAPMYYPRZHCGBBNOBTDEQMMXIVXXUUICEIMRLBJERTLJOHUTSLJIPVUDKRLQA | 12:45 |
| KDAMZUBJO | LIBKVHVLENYZUCZFIZFRXNOHASITZEJETFKFNGPNDPMIDRZUVKUCYPOQGVZWGSIEBEXYRKCLALWSFDKCIFGCPDKRZHVMNKGWVPJNJHDKYEBLVAIBUUQCOYAJZYWPRICRRWAZYZQHXUJKXDIQTWZIXPMQXCTPENAVOASAUBEVLBNTLGCWJBZDUQBLDVWORPILPPSXADZABQDJUKZMZQAYNOEXLBDTOQHNIGFSGISFWUINOSAZRGXPSLBBBNAHHTESBQMSMRGGWNRGHKVMHBHVZBNMYQEGTSOCEVJEBUFQJSIXA | 12:45 |
| MWYAZTIOW | EVRXMMUZELAYECIECBRUOXFOWXJVRZLQSYMCTDKSGHFCFBEFWBKVLBHKLNXAFNIJRFLKSTNENDXWGBLXAMIIFRNQMWYZVEAWXCZODVKGVSZEFUSRKWKBFWTETZLRQMJVWORKYMXHYOGADNKMAPEFPIJNCOHJJEXWWCZIDSBYYZGPOWDOXDAIWVKASFVLFHFZXEWLEHHRKDNKAABGHEVICZQYBYPOVZMJUGLNEWRDHQJLOXVGIKYDPENUVRRPXNZEADARMISGUWEOGQYKDDIGGZEFPZYZHPXEJKUVUJCYETIQP | 12:45 |
| FRCJXSNCW | AFFVGGGHHPQSUHTLYYOGDVUEFYMGIHQWNJMFZAZTOJYAMIYLHSSDHQZWXTIQGZHRJBEJVZTOROMOBPKDTZBMDDLOJLGNASXTGRHFOPNXRUVBBUIKAYJCPWLOQMONAQQRBWIEMUNNYEPOKTLFRDACSVTXVACZXPABSSGZWIVJATTFVCXXCADUSWCZEESXPJRIXEGVQUSZJJOLMSXNGJTHTWXFZIKNQDXWJNQNMKFZFBIWFJXWTQISXHWUPEKWTVUMCPGLVJYCVNKJRPEBTFHQVHVXYKNXSGUJQROKIASSWJBAR | 12:45 |
| UISCSMMOC | HJSLTDXETHTQUDMSXIHLGMRGWGBOSNFYLMZJPLEJZWWUUOPMDWTKKPEABULUDCYMTAAIWPVHWUEBKHTJIZPEQGKREWGXCUKHNSPFGPEJJDQACOHKDUJZWVAOBRNSFNLNVEGRRZDLMCKSMPCMYZBCLUXVRFNDHEOFKDEIPJGIZDEUDOWKVXOOOVZNLPIZYNOZYLWXEXXZSTNTEPQVRRFCLYHWNJRGASXWASEMBMAAHGCTVEITELFFCMSEDHMQINVPVUTPXMNLASMXIZBDQHHAORYIHEYXHJVJOFIJGAMJFLSFT | 12:45 |
| AUDGNPJJD | HGZBFXLOAFURGUQKSWQLFKPZULVDPAEDYXREFTJMSNIHRKRJOEWIVGVAUDOXYYNXMTFHZIKNQZHIYIPCHEXUUVAEGMCPXJXNYBJFEXFWEEWOBSHBSMTNFZMRGVXWJLFRYMJTAUJWMMETCKXBTADGMQPESNMBMUMCYEADRPMMDKHIXUKJSARMDOBKNKYPXMHOMKPWEHPDNJMMSQPPRSMLLRSSVULXSTIMDAXRPPYZSJMCVYMBLPVPWRCZKDVXBIVLTEMVUFITXENNODOMRLWBTBVSNBZKDHZIIJONIWYCUTTBY | 12:45 |
| EEYRJAVAH | XIARZDNZORQPILOGZEKMRLWUQNJPEUGZXPDGZOKCUTSVXXOUZWQMKNOLSTXIPXAQEQTZCPFSAILCLQPIQRKIZIZXYENWJVCEOICOQZXQHMUZFQZBJJOCVFECFTYDVTBCDMDVFQXVXMGDGRLKIDOJOOWMAGAUZEPMZSJRRFFWTWMYNBQIDXZICQUIHYPGRQKVRTCCUTIFJVITZUOKAMYBOZZPRDXOTOFHVLHRWSEVTIVSNDXRHFRSBXNHJJSPEJRHXUVNRSAXIBLSMIUMZSJOHEMCXYIWBVPBQGTRANLWIYRHJ | 12:45 |
| === mode/#ubuntu [+o Hobbsee] by ChanServ | ||
| === mode/#ubuntu [+o Seveas] by ChanServ | ||
| === ORLJJINDJ [n=ORLJJIND@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| === ORLJJINDJ is now known as MFLUJYXPF | ||
| === MFLUJYXPF is now known as WYIAEFPLU | ||
| kbrooks | !ops | 12:45 |
| === NFNQQUHMR [n=NFNQQUHM@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| NFNQQUHMR | HELP | 12:45 |
| === NFNQQUHMR is now known as NGYINABDK | ||
| NGYINABDK | HELP | 12:45 |
| === NGYINABDK is now known as YYABDITEI | ||
| === HYXZHJCCL [n=HYXZHJCC@81-203-84-14.user.ono.com] has joined #ubuntu | ||
| === HYXZHJCCL is now known as XWAFHBDSG | ||
| === mode/#ubuntu [+Rr] by Seveas | ||
| Hobbsee | argh! | 12:45 |
| Frogzoo | yay!! | 12:45 |
| === XWAFHBDSG was kicked off #ubuntu by Seveas (Seveas) | ||
| === gnomefreak [n=gnomefre@unaffiliated/gnomefreak] has joined #ubuntu | ||
| === mode/#ubuntu [+o ompaul] by ChanServ | ||
| Frogzoo | nice work Seveas | 12:46 |
| === mode/#ubuntu [+b %*!*@@81-203-84-14.user.ono.com] by ompaul | ||
| === mode/#ubuntu [-o ompaul] by ChanServ | ||
| Seveas | *!*@81-203-84-14.user.ono.com | 12:46 |
| === mode/#ubuntu [+b *!*@81-203-84-14.user.ono.com] by Seveas | ||
| kbrooks | Seveas, i have determined that those are clonebots :P | 12:46 |
| Hobbsee | hehe | 12:46 |
| === mode/#ubuntu [-b %*!*@@81-203-84-14.user.ono.com] by Seveas | ||
| Frogzoo | kbrooks: you'r sh**ting me... | 12:46 |
| ompaul | yeap | 12:46 |
| vicks | whohaa whats happening | 12:46 |
| === mode/#ubuntu [-rR] by Seveas | ||
| kbrooks | Frogzoo, language | 12:47 |
| TheFuzzball | that came as the first thing I'd do when I update | 12:47 |
| sfaris | not bots.. he was really fast on the keyboard | 12:47 |
| Hobbsee | what's -r and -R do? | 12:47 |
| Frogzoo | kbrooks: socking? souping? ...etc | 12:47 |
| gnomefreak | register users only i think | 12:47 |
| === metalskull [n=metalsku@203.81.236.96] has joined #ubuntu | ||
| Seveas | Hobbsee, only registered users can join (+r) or speak 9+R) | 12:47 |
| Hobbsee | ah ok | 12:47 |
| xstation | Frogzoo : I think viper gave a good intro before and still I have that vm ware I purchased but not sure about kemu | 12:47 |
| SKoRM | regged user i thinks | 12:47 |
| SKoRM | sif, lag | 12:47 |
| === ramvi [n=ramvi@113.80-202-106.nextgentel.com] has joined #ubuntu | ||
| kbrooks | xstation, kqemu is proprietary | 12:48 |
| Frogzoo | xstation: kqemu's pretty quick - obviously still not as quick as native, but it meets my needs | 12:48 |
| === bimberi [n=bimberi@pdpc/supporter/active/bimberi] has joined #ubuntu | ||
| === matt_ [n=matt@d47-69-73-189.nap.wideopenwest.com] has joined #ubuntu | ||
| Frogzoo | kbrooks: proprietary but free to use, unlike vmware | 12:48 |
| === sH4 [n=foo@220.91.193.198] has joined #ubuntu | ||
| Hobbsee | well, that's certainly one way you *cant* get help! | 12:48 |
| kbrooks | Frogzoo, um | 12:49 |
| === tortho [n=tortho@104.84-49-107.nextgentel.com] has joined #ubuntu | ||
| ompaul | Hobbsee, you don't say | 12:49 |
| kbrooks | Frogzoo, vmware server/vmware player are free | 12:49 |
| xstation | frogzoo he idea of source packages whATS this hands on method | 12:49 |
| Hobbsee | hehe | 12:49 |
| === roy [n=roy@d83-184-167-100.cust.tele2.it] has joined #ubuntu | ||
| Frogzoo | xstation: just a sec - I'll find a linkie: yes, kbrooks re: free player, point taken | 12:49 |
| kbrooks | Frogzoo, vmware server is just a copy of vmware worstation as the client | 12:49 |
| tortho | anyone here today, who likes to try to help me with a installed, not working wifi card? :-) | 12:49 |
| === matt_ [n=matt@d47-69-73-189.nap.wideopenwest.com] has left #ubuntu ["Leaving"] | ||
| === bouvittel [n=bouvitte@dslb-084-056-141-038.pools.arcor-ip.net] has joined #ubuntu | ||
| kbrooks | Frogzoo, you can run the server and client on the same PC | 12:50 |
| === pjv [n=pjv@cor8-ppp54.bur.dialup.connect.net.au] has left #ubuntu [] | ||
| xstation | Frogzoo: the one I have at the moment is http://www.codepoets.co.uk/docs/qemu_windows2000_on_ubuntu_linux_howto | 12:50 |
| === Bog_ [n=me@CPE000d889a2f0d-CM00080d7be684.cpe.net.cable.rogers.com] has joined #ubuntu | ||
| Bog_ | I need some help trying to determine how permissions should be set on a shared webserver | 12:51 |
| === bouvittel [n=bouvitte@dslb-084-056-141-038.pools.arcor-ip.net] has left #ubuntu ["Verlassend"] | ||
| === dinamizador [n=dinamiza@83.230.235.25] has joined #ubuntu | ||
| Bog_ | when I log on to my shared web account I can see other peoples virtual directories | 12:51 |
| JLiquorish | does anyone know of a good kvm that works with windows and linux, and does not depends on software to switch? | 12:51 |
| === Tomcat_ [n=Tomcat@p54A18B7C.dip0.t-ipconnect.de] has joined #ubuntu | ||
| neomancer911 | i have 15.4MB left in my ubuntu partition, is that critical? thx. | 12:52 |
| metalskull | im using an iogear kvm at my work, it works with both linux and windows | 12:52 |
| maskd | JLiquorish: Belkein make good KVM's | 12:52 |
| JLiquorish | ive been lookin at belkins but they seem to vary alot on experiences with linux | 12:53 |
| === thoreauputic [n=prospero@ubuntu/member/thoreauputic] has joined #ubuntu | ||
| maskd | sorry, belkin* | 12:53 |
| JLiquorish | i knew what you ment ;) | 12:53 |
| bimberi | thoreauputic: evening! :) | 12:54 |
| thoreauputic | hi bimberi :) | 12:54 |
| neomancer911 | what's an ideal hard disk free space for ubuntu? thx | 12:54 |
| Frogzoo | xstation: http://oui.com.br/n/content.php?article.23 | 12:54 |
| bimberi | thoreauputic: pm? (will be brief) | 12:54 |
| === AshenSugar [i=godfight@c-67-164-101-249.hsd1.or.comcast.net] has joined #ubuntu | ||
| thoreauputic | neomancer911: depends what you want to do with it - about 4 gig minimum I'd say | 12:54 |
| AshenSugar | found the page for this pitb lappy :P | 12:54 |
| AshenSugar | http://support.gateway.com/s/Mobile/Solo_Series/P9100_14/P91_14nv.shtml | 12:55 |
| thoreauputic | bimberi: sure | 12:55 |
| SKoRM | 1.8 is required | 12:55 |
| tortho | neomancer911: As much as possible :-) It goes totally insane if you run out of it!! | 12:55 |
| SKoRM | *1.8gb | 12:55 |
| === ChaKy [n=chaky@lns02-0687.dsl.iskon.hr] has joined #ubuntu | ||
| neomancer911 | no, im saying after all ubuntu and all other apps one needs have been installed | 12:55 |
| thoreauputic | neomancer911: !.8 or 2 gig won't give you any room though | 12:55 |
| === bob_4_a_day [n=root@0-1pool91-220.nas23.houston4.tx.us.da.qwest.net] has joined #ubuntu | ||
| neomancer911 | i've allocated 4Gig partition for ubuntu and now only 15.4MB is left... will i have problem running my apps? | 12:56 |
| === Ethyl [n=jkoeune@di-pc22.ulb.ac.be] has joined #ubuntu | ||
| Frogzoo | neomancer911: I very much doubt it - but pron can be pretty disk intensive :D | 12:56 |
| === Ethyl [n=jkoeune@di-pc22.ulb.ac.be] has left #ubuntu ["Ex-Chat"] | ||
| xstation | Frogzoo:thanks I will take a look --shame you cannot on convrt exe to linux money down the drain | 12:56 |
| === sphinx [n=sphinx@83.229.111.115] has joined #ubuntu | ||
| === xcorpio [n=xcorpio@eu107-211.clientes.euskaltel.es] has joined #ubuntu | ||
| === MacSlow [n=mirco@dslb-084-063-004-204.pools.arcor-ip.net] has joined #ubuntu | ||
| bob_4_a_day | what package contains update-alternatives and sensible-* ? | 12:57 |
| === sphinx is now known as J_element | ||
| === atoponce [n=aaron@c-24-2-85-66.hsd1.ut.comcast.net] has joined #ubuntu | ||
| xcorpio | Hola | 12:57 |
| xcorpio | Help!!! | 12:57 |
| xcorpio | alguien puede ayudarme ? | 12:57 |
| JLiquorish | can ubuntu, kubuntu and xubuntu share a partition with home on it? | 12:57 |
| === mumbles [n=john@cpc1-bror1-6-0-cust67.bmly.cable.ntl.com] has joined #ubuntu | ||
| neomancer911 | Frogzoo, im planning to do a lot of programming in this partition... | 12:57 |
| === joe_alf [n=joey@n219077165116.netvigator.com] has joined #ubuntu | ||
| === J_element [n=sphinx@83.229.111.115] has left #ubuntu ["Leaving"] | ||
| === Vic_Astro [n=vic@85.186.238.232] has joined #ubuntu | ||
| === cantona [i=proxy@unaffiliated/cantona] has joined #ubuntu | ||
| Frogzoo | JLiquorish: probly shouldn't have any problems except for the common apps, which might stample each others settings | 12:58 |
| bob_4_a_day | JLiquorish yes but users must have same uid | 12:58 |
| JLiquorish | ok | 12:58 |
| JLiquorish | i have limited space but want to try all three | 12:58 |
| === pengo [n=xtofu@60-240-51-77.tpgi.com.au] has joined #ubuntu | ||
| Frogzoo | neomancer911: if you can use 15gig with just source code, I take my hat off to you | 12:58 |
| JLiquorish | might install xubuntu on my older pc though, and (K)Ubuntu on my newer one, then decide which i like more and delete the other | 12:59 |
| pengo | eog is shit. what's a good image viewer? | 12:59 |
| === Nolt is now known as Nolt-aWay | ||
| === helge [n=helge@d83-181-122-232.cust.tele2.ch] has joined #ubuntu | ||
| === Nolt-aWay is Away, Reason: ( learn :/ ) | Since: ( Thursday, March 30, 2006. 12:39:25 ) Xlack v2.1 | ||
| thoreauputic | pengo: depends on preference - I like gqview personally | 12:59 |
| bob_4_a_day | what package contains update-alternatives and sensible-* ? any body know ? | 12:59 |
| xstation | Frogzoo: is this url you gave up to date can I use it now | 12:59 |
| thoreauputic | pengo: or see if you like gthumb | 12:59 |
| neomancer911 | Frogzoo, what do you mean? | 12:59 |
| pengo | thoreauputic, just want something that doesn't crash, and will precache the next image | 01:00 |
| Frogzoo | neomancer911: oh did you really mean 15 _MEG_ ... ugh ... | 01:00 |
| brenner | bob_4_a_day: pacakges.ubuntu.com may be useful | 01:00 |
| === geargolem [n=geargole@pool-72-72-128-72.hrbgpa.dsl-w.verizon.net] has joined #ubuntu | ||
| thoreauputic | pengo: I've never seen gqview crash | 01:00 |
| Rdde | i use a really simple samba conf now it it works exept it displays all shared folders for all users that loggs in to the samba.. they will get accress denyed but they still see all shared folders in there "share root" | 01:00 |
| pengo | thoreauputic, i'll give it a go. thanks. | 01:00 |
| thoreauputic | pengo: don't know about the precaching... | 01:00 |
| geargolem | my screensaver flickers | 01:00 |
| geargolem | and blender won't load | 01:01 |
| Frogzoo | neomancer911: a 15meg home is incredibly restrictive - just mail alone could easy fill that | 01:01 |
| pengo | thoreauputic, does "next" work quickly? | 01:01 |
| === gotaq [n=icebreak@l85-130-132-165.broadband.actcom.net.il] has joined #ubuntu | ||
| === gotaq [n=icebreak@l85-130-132-165.broadband.actcom.net.il] has left #ubuntu ["Leaving"] | ||
| neomancer911 | Frogzoo, i had a 4GB partition, after installing Ubuntu and a lot of apps i.e. KDevelop etc., i mean a lot of apps, i am only left with 15.4MB will that cause problems? | 01:01 |
| === xdarCx [n=darc@c-71-196-229-240.hsd1.co.comcast.net] has joined #ubuntu | ||
| === xdarCx [n=darc@c-71-196-229-240.hsd1.co.comcast.net] has left #ubuntu ["Leaving"] | ||
| thoreauputic | pengo: seems fine here - you can scroll through imgages with the mouse scroll wheel too | 01:01 |
| xcorpio | donde puedo conseguir ayuda | 01:02 |
| xcorpio | sobre como configurar un modem? | 01:02 |
| thoreauputic | *images | 01:02 |
| xcorpio | help | 01:02 |
| pengo | thoreauputic, cool. i'm downloading. | 01:02 |
| osfameron | is http://linux.ncl.ac.uk/encrypt/ a good, clear, safe method of using an encrypted filesystem ? | 01:02 |
| === AshenSugar [i=godfight@c-67-164-101-249.hsd1.or.comcast.net] has left #ubuntu [] | ||
| === m0r0n [n=moron@q1gw.q1ag.de] has joined #ubuntu | ||
| thoreauputic | pengo: if you like small and fast, feh is nice - but it is a CLI app | 01:02 |
| Frogzoo | neomancer911: I really think you ought to find some more space from somewhere, or just leave it, but you'll probly be forced to sooner or later | 01:02 |
| osfameron | (It's the first googlehit for me, so I'm guessing it might be) | 01:03 |
| bob_4_a_day | brenner or it may not. all i see is FRAME: home.php | 01:03 |
| pengo | thoreauputic, nah, i prefer bloated, functional, and usable :) | 01:03 |
| === Bakgat [n=user@myw-stp-196-37-192-140.sentechsa.net] has joined #ubuntu | ||
| xstation | Frogzoo: just a little problem thats needs attention knotify will not save configuration not writAble --any ideas how to amend | 01:03 |
| geargolem | what would cause my screensaver to flicker? | 01:03 |
| neomancer911 | k thx | 01:03 |
| Bakgat | morning boys & gals! | 01:03 |
| thoreauputic | pengo: feh is *very* functional and usable, and powerful too | 01:03 |
| === cerebrix [n=christia@cpe-66-27-155-245.socal.res.rr.com] has joined #ubuntu | ||
| Frogzoo | xstation: nope, don't use knotify | 01:04 |
| Bakgat | hope u al doin ok! | 01:04 |
| Frogzoo | xstation: or kde for that matter | 01:04 |
| bob_4_a_day | what package contains *-alternatives and sensible-* ? does any body kave a clue ? | 01:04 |
| xstation | Frogzoo: iok THANKS but is this url you sent me ok to follow?/ | 01:04 |
| pengo | thoreauputic, ok i'll check it out too :) | 01:04 |
| === sylvain [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has joined #ubuntu | ||
| thoreauputic | pengo: for instance feh -ZFrD 1 . will give a screenshow of the current dir with a 1 second interval, fullscreen and recursive | 01:04 |
| Bakgat | i have a networking issue. can anyone here assist me plz? | 01:04 |
| ompaul | thoreauputic, morning | 01:04 |
| Frogzoo | xstation: it's the same link it turns out as ubotu has already | 01:04 |
| JLiquorish | what does video bandwidth mean in terms of a kvm switch? | 01:05 |
| pengo | thoreauputic, nice | 01:05 |
| thoreauputic | ompaul: evening :) | 01:05 |
| Frogzoo | !tell xstation about kqemu | 01:05 |
| JLiquorish | i think i found a switch that works with linux =D | 01:05 |
| thoreauputic | pengo: the man page is actually quite informative :) | 01:05 |
| === painkiler [n=levi@203-206-113-4.dyn.iinet.net.au] has joined #ubuntu | ||
| === nubbe [n=carl@c83-248-50-65.bredband.comhem.se] has joined #ubuntu | ||
| painkiler | hey guys | 01:05 |
| painkiler | how do i install the ms fonts? | 01:05 |
| painkiler | i know automatix does it for me | 01:05 |
| painkiler | but i am running dapper... | 01:05 |
| Bakgat | brb. need 2 eat. c u soon | 01:05 |
| thoreauputic | painkiler: install msttcorefonts | 01:05 |
| painkiler | that it? | 01:05 |
| Frogzoo | painkiler: your nic is hurting my eyes *painkiller* | 01:06 |
| === _Rappy_ [n=hunt-pre@80-89-35-2.network.itconnect.no] has joined #ubuntu | ||
| pengo | thoreauputic, an informative man page! heavens no! ... gqview does precaching. wonderful :) | 01:06 |
| === MacSlow [n=mirco@dslb-084-063-004-204.pools.arcor-ip.net] has joined #ubuntu | ||
| === ramvi [n=ramvi@113.80-202-106.nextgentel.com] has joined #ubuntu | ||
| thoreauputic | painkiler: pretty much | 01:06 |
| === christmas [n=christma@86.104.196.200] has joined #ubuntu | ||
| buffarama | xcorpio: try #ubuntu-es por espanol | 01:06 |
| painkiler | thanx | 01:06 |
| christmas | hy all | 01:06 |
| thoreauputic | painkiler: you'll need multiverse of courase | 01:06 |
| === christmas is now known as Christmas | ||
| painkiler | Frogzoo: one l thanks | 01:06 |
| xstation | ubotu: thanks is this a automated responce? | 01:06 |
| ubotu | sure thing, xstation | 01:06 |
| painkiler | yeah, already do | 01:06 |
| thoreauputic | pengo: ;-) | 01:06 |
| === SuperSam [i=SuperSam@85-210-12-52.dsl.pipex.com] has joined #ubuntu | ||
| xstation | ubotu: you should be on the payroll | 01:07 |
| ubotu | xstation: I don't know, try searching at http://ubuntu.cc.com.au/ | 01:07 |
| pengo | "[X] preload next image" | 01:07 |
| ramvi | Heya. An installer (wined) tells me: To run a network admin installaion please run setup.exe from the root folder. Any idea what it could mean? | 01:07 |
| Frogzoo | !tell xstation about ubotu | 01:07 |
| xstation | here we go | 01:07 |
| osfameron | OK, following the isntructions for creating an encrypted filesystem, I get an error on: mount -t ext2 /dev/loop0 /mnt/loop | 01:07 |
| Frogzoo | xstation: ubotu IS on the payroll | 01:07 |
| === trueno [n=trueno@170.Red-83-35-40.dynamicIP.rima-tde.net] has joined #ubuntu | ||
| osfameron | saying that /mnt/loop doesn't exist | 01:07 |
| === [A] ndy80 [n=wettreyw@host22-140.pool8251.interbusiness.it] has joined #ubuntu | ||
| === Guestakkio [n=roro@host247-215.pool874.interbusiness.it] has joined #ubuntu | ||
| thoreauputic | osfameron: sudo mkdir /mnt/loop :) | 01:08 |
| xstation | my goodness think I will give up the day job | 01:08 |
| Guestakkio | hi folks! please help me for the following problem.... | 01:08 |
| ompaul | !anyone | 01:08 |
| ubotu | probably 90% of the first questions asked in this channel start with "Does anyone/anybody..." Why not ask your next question (the real one) and find out? <hint> | 01:08 |
| === Tomcat_ [n=Tomcat@p54A18B7C.dip0.t-ipconnect.de] has joined #ubuntu | ||
| === TiTaS [n=TiTaS@213.226.165.195] has joined #ubuntu | ||
| osfameron | thoreauputic: ah, ok. I didn't realize a mount was a real directory. I don't know what I'm doing, I'm in cookbook mode :-) thanks | 01:08 |
| gnomefreak | !helpme | 01:09 |
| ubotu | If you do not actually ask a question, we can not actually help you. | 01:09 |
| Yoric | New question: I'm now running btlaunchmany as a daemon. | 01:09 |
| SuperSam | Hello everyone, I wonder if anybody could help me. I am trying to delete an old username, but I cannot as it says "userdel: error deleting password entry | 01:09 |
| SuperSam | userdel: error deleting shadow password entry | 01:09 |
| SuperSam | userdel: /home/.sites/143/site2/.users/78/samj not owned by samj, not removing | 01:09 |
| SuperSam | " But I need to delete it, I know where the files are that this user owns, I just need to know how I can change the user from "samj" to "supersam". Could anybody help me? | 01:09 |
| bob_4_a_day | what package contains *-alternatives and sensible-* ? does any body kave a clue ? | 01:09 |
| Yoric | My problem is now to redirect the standard output to some log file. | 01:09 |
| thoreauputic | osfameron: yeah, it isn't magic 8grin* | 01:09 |
| ompaul | SuperSam, please not paste in here thanks | 01:09 |
| bob_4_a_day | wrong it was flood | 01:09 |
| === christmas [n=christma@86.104.196.200] has joined #ubuntu | ||
| RMeist | 10:45 < rainman> vertel dat mn school even :-) | 01:09 |
| Yoric | How could I do that ? | 01:09 |
| Frogzoo | SuperSam: please use pastebin | 01:09 |
| === xuecan [n=xuecan@222.94.2.74] has joined #ubuntu | ||
| Frogzoo | !tell SuperSam about pastebin | 01:09 |
| SuperSam | ... | 01:09 |
| SKoRM | time to install winblows 98 | 01:09 |
| bob_4_a_day | command > file | 01:10 |
| === xuecan [n=xuecan@222.94.2.74] has left #ubuntu [] | ||
| === LinuxNoob [n=LinuxNoo@136.80-202-238.nextgentel.com] has joined #ubuntu | ||
| ramvi | Heya. An installer (wined) tells me: To run a network admin installaion please run setup.exe from the root folder. Any idea what it could mean? Is there a channel for wine-help? | 01:10 |
| Guestakkio | i installed ubuntu on my laptop asus a6va-q058h and i am having probem with the installation of the audio card.. when i do "sudo apt-get install alsa-source" the system says: "impossible to find alsa-source" | 01:10 |
| Guestakkio | an idea? | 01:10 |
| Frogzoo | SuperSam: sudo chown supersam file | 01:10 |
| tortho | I have a FAT partition... and when I try to copy files to it, it complain that it cant find the file.. :-) I guess it should be that it cant write.. and i think it is because it has norwegian characters in the filename... Is there any way to mount it to be able to write thse files? | 01:10 |
| painkiler | hey, whats that cool search bar feature in 2.14? | 01:10 |
| thoreauputic | bob_4_a_day: try dpkg -S update-alternatives | 01:10 |
| painkiler | is it sorta like spotlite in os x? | 01:10 |
| painkiler | *spotlight | 01:10 |
| xstation | Frogzoo: heres abig one, if I purchased avm ware workstation 10 months ago is it unless with linux no alien for exe files? | 01:10 |
| kbrooks | painkiler, deskbar, and whats spotlight? | 01:10 |
| geargolem | I get a 'failure to allocate back buffer[sis_alloc.c:210:] when I try to run blender and my screensavers flicker | 01:10 |
| Yoric | bob_4_a_day, fails. | 01:10 |
| painkiler | osx | 01:10 |
| Yoric | bob_4_a_day, the file is empty. | 01:10 |
| Yoric | I believe it's related to start-stop-daemon. | 01:11 |
| Frogzoo | xstation: dunno | 01:11 |
| painkiler | if you would ever use it. there is a search bar on the top | 01:11 |
| === mustard5 [n=mustard5@160.a.001.sop.iprimus.net.au] has joined #ubuntu | ||
| xstation | Frogzoo: thanks for url | 01:11 |
| thoreauputic | bob_4_a_day: update-alternatives is part of dpkg | 01:11 |
| bob_4_a_day | Yoric is it stdout or stderr try command 2> file | 01:11 |
| === cassidy [n=cassidy@f1-pc174.ulb.ac.be] has joined #ubuntu | ||
| pengo | thoreauputic, gqview lets you rename a file (ctrl-r). and will autorotate with EXIF info. i'm happy now. | 01:11 |
| Frogzoo | xstation: yw | 01:11 |
| painkiler | how do i enable deskbar? | 01:11 |
| Yoric | bob_4_a_day, it's definitely stdout. | 01:11 |
| thoreauputic | pengo: glad to hear it :) | 01:11 |
| Guestakkio | i installed ubuntu on my laptop asus a6va-q058h and i am having probem with the installation of the audio card.. when i do "sudo apt-get install alsa-source" the system says: "impossible to find alsa-source" | 01:11 |
| LinuxNoob | How do u enable java in firefox 1.5? I've copied the libjavaplugin_oji.so to the firefox plugins but nothing happens | 01:12 |
| thoreauputic | !java | 01:12 |
| ubotu | To install Java/Sun Java see Java on https://wiki.ubuntu.com/RestrictedFormats and also see !javadebs | 01:12 |
| bob_4_a_day | Yoric then command > file will definitely work | 01:12 |
| Yoric | No, it doesn't. | 01:12 |
| Yoric | I believe that start-stop-daemon intercepts stdout before I have a chance to redirect it. | 01:12 |
| christmas | does anybody know: if i want to install the nvidia driver from nvidia should i uninstall the current driver installed with "sudo apt-get nvidia-glx"? | 01:12 |
| === sclark [n=sclark@HSE-London-ppp3510403.sympatico.ca] has joined #ubuntu | ||
| bob_4_a_day | thoreauputic then only way to remove alternatives is to remove dpkg or hack things ehh | 01:12 |
| === bob_4_a_day go to hack. | ||
| === TiTaS [n=TiTaS@213.226.165.195] has left #ubuntu [] | ||
| === tvv [n=tvv@intellect2-gw.ci.ukrpack.net] has joined #ubuntu | ||
| thoreauputic | bob_4_a_day: why on earth would you remove it? | 01:13 |
| JLiquorish | does anywhere actually sell a normal wired keyboard and scroll mouse (ergonomic would be a plus, no media keys and ps/2) | 01:13 |
| Yoric | christmas, you souldn't need to do that. | 01:13 |
| === Dewio [n=dewi@203-206-5-40.dyn.iinet.net.au] has joined #ubuntu | ||
| SKoRM | gonna be another late night for me :(, damn laptop :@ | 01:13 |
| gnomefreak | bob_4_a_day: why would you want to remove it? | 01:13 |
| bob_4_a_day | Yoric wrong. it's not stdout if > blah doexn't catch it. it's stderr use 2> blah | 01:14 |
| Yoric | I've tried. | 01:14 |
| Yoric | It's not it. | 01:14 |
| Yoric | I've tried 2> and &> | 01:14 |
| === marcin` [n=user@194.114.146.58] has joined #ubuntu | ||
| bob_4_a_day | gnomefreak just never did like "alternatives" and if i want it gone, it's leaving. | 01:14 |
| Frogzoo | Yoric: what's your problem? | 01:14 |
| thoreauputic | bob_4_a_day: sensibl-* appears to be part of debianutils | 01:15 |
| Yoric | Frogzoo, I'm running a daemon through start-stop-daemon (actually, it's btlaunchmany). | 01:15 |
| === Ubunti_Ki [n=Ubuntu_L@2-1-2-48a.spa.sth.bostream.se] has joined #ubuntu | ||
| bob_4_a_day | k thanks thoreauputic | 01:15 |
| christmas | im a complete noob in linux... i have a nvidia graphics card geforce fx5900xt from pny and in 3d applications it blocks once in 10 seconds for about 2 seconds and i am using the nvidia driver provided by that apt-get command, how can i make it work properly? | 01:15 |
| === babo [n=babo@220.94.104.5] has joined #ubuntu | ||
| gnomefreak | bob_4_a_day: ok thats up to you i just have this strange feeling its not gonna go without a fight | 01:15 |
| LinuxNoob | I've done that java java in RestrictedFormats, but file exists and nothing happens | 01:15 |
| Yoric | Frogzoo, stdout seems to be completely swallowed by start-stop-daemon, no matter how I try to redirect it. | 01:15 |
| babo | My browser is running strangely. When I switch between pages, the browser can use 90% of the cpu for 4 or 5 seconds ... any ideas ? Is this a sign of the infamous firefox memory managent in action ? | 01:15 |
| thoreauputic | bob_4_a_day: sounds like a great way to break your system... | 01:15 |
| === trueno [n=trueno@170.Red-83-35-40.dynamicIP.rima-tde.net] has left #ubuntu [] | ||
| bob_4_a_day | k thanks guys. | 01:16 |
| gnomefreak | LinuxNoob: i have never had to cp any java to firefox | 01:16 |
| LinuxNoob | strange | 01:16 |
| thoreauputic | bob_4_a_day: you realise dpkg and debianutils are pretty fundamental, right? | 01:16 |
| === Fergy [n=Fergy@a82-92-232-156.adsl.xs4all.nl] has joined #ubuntu | ||
| Yoric | Frogzoo, while I assume I could write a custom wrapper script to perform the indirection even earlier, I'm looking for a better manner. | 01:16 |
| === buffarama [n=buffaram@adsl-69-155-217-173.dsl.rcsntx.swbell.net] has left #ubuntu [] | ||
| gnomefreak | ubotu tell LinuxNoob about javadebs | 01:16 |
| painkiler | how do i install deskbar on gnome? | 01:16 |
| painkiler | ubotu: deskbar | 01:17 |
| ubotu | painkiler: My cat's name is Mittens! Try searching at http://ubuntu.cc.com.au/ | 01:17 |
| gnomefreak | painkiler: are you on dapper? | 01:17 |
| painkiler | yeah | 01:17 |
| christmas | so anyone can help me please with my graphics card? | 01:17 |
| gnomefreak | than right click the panel and add it | 01:17 |
| Ubunti_Ki | I want to browse trough pictures in gallery here in linux, but I dont know any suitable program? | 01:17 |
| painkiler | hmm | 01:17 |
| painkiler | sound simple | 01:17 |
| gnomefreak | painkiler: please bring all dapper talk to #ubuntu+1 | 01:17 |
| painkiler | ok | 01:17 |
| Ubunti_Ki | what software is suitable for picture browsing? | 01:18 |
| === Dewio_ [n=dewi@203-206-11-92.dyn.iinet.net.au] has joined #ubuntu | ||
| LinuxNoob | gnomefreak, : That didnt help much | 01:19 |
| gnomefreak | Ubunti_Ki: on a website or in a folder? | 01:19 |
| LinuxNoob | gnomefreak, : but thanks anyway :D | 01:19 |
| Ubunti_Ki | folder gnomefreak | 01:19 |
| thoreauputic | Ubunti_Ki: lots gqview, gthumb, eog, etc etc | 01:19 |
| gnomefreak | LinuxNoob: once you have java installed restart ff | 01:19 |
| gnomefreak | Ubunti_Ki: use one of the viewer in gnome menu | 01:19 |
| gnomefreak | LinuxNoob: you also have to change the version ubuntu uses | 01:20 |
| JLiquorish | is dapper worth trying,or should i just wait till the proper release? id like to help the community in someway but not sure how, im pretty advance at pcs and can learn fastish | 01:20 |
| gnomefreak | LinuxNoob: sudo update-alternatives --config java and choose the one you just installed | 01:20 |
| === insidious|zzz is now known as insidious | ||
| thoreauputic | JLiquorish: dapper is fairly stable by now | 01:20 |
| kuja | Where do I configure the GNOME splash? | 01:20 |
| bimberi | !splash | 01:21 |
| ubotu | To change the Gnome splash screen, open the gconf-editor and change the key /apps/gnome-session/options/splash-image | 01:21 |
| bimberi | !contribute | 01:21 |
| ubotu | contribute is probably at http://www.ubuntu.com/community/participate | 01:21 |
| kuja | Ah, thanks. | 01:21 |
| gnomefreak | JLiquorish: the learning curve is no different than breezys | 01:21 |
| === lloydinho [n=andreas@rosinante.egmont-kol.dk] has joined #ubuntu | ||
| JLiquorish | ok, so i wont be able to help in any major way by testing | 01:21 |
| === dominus [n=dominus@84-120-23-202.onocable.ono.com] has joined #ubuntu | ||
| _Rappy_ | Any Evolution-users here? | 01:21 |
| === Hoxzer [n=niko@a80-186-169-248.elisa-laajakaista.fi] has joined #ubuntu | ||
| === Hoxzer_ [n=niko@a80-186-169-248.elisa-laajakaista.fi] has joined #ubuntu | ||
| nubbe | christmas, Have u tried this? http://easylinux.info/wiki/Ubuntu#How_to_install_Graphics_Driver_.28NVIDIA.29 | 01:21 |
| thoreauputic | JLiquorish: sure - you can report bugs etc | 01:21 |
| === n00b [i=ircce@82-42-236-237.stb.ubr01.sout.blueyonder.co.uk] has joined #ubuntu | ||
| LinuxNoob | gnomefreak, : sudo update-alternatives --config java I've done thats | 01:22 |
| JLiquorish | i just want to give back to the community in some way, but im not sure how to | 01:22 |
| LinuxNoob | set ut to the 1.5 | 01:22 |
| === ubuntu [n=ubuntu@luokka12.teleware.fi] has joined #ubuntu | ||
| === sad [n=sqilzim@h201n10-m-rg-gr100.ias.bredband.telia.com] has joined #ubuntu | ||
| n00b | hi | 01:22 |
| thoreauputic | JLiquorish: reporting bugs helps - or answering questions here or on the mailing lists | 01:22 |
| bimberi | JLiquorish: have a look at that 'participate' page (above) | 01:22 |
| sad | how do i install tar-gz files? | 01:22 |
| gnomefreak | LinuxNoob: in the address bar in ff type about:plugins and java should be there and enabled | 01:22 |
| JLiquorish | is it easy to make ubuntu versions of software?? | 01:22 |
| JLiquorish | bimberi, looking =) | 01:23 |
| === Rdde [n=Rdde_@c-efa8e455.53-0004-74657210.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| ubuntu | I have low (vga) resol. only in live CD? The system/settings/resolution will not give more? What to do with dpkg-reconfigure xserver-xorg or...? | 01:23 |
| n00b | is it posible to set my display res to the same as a pal tv? | 01:23 |
| Frogzoo | Yoric: suggest take a look around /etc/init.d - redirection in the rc scripts is commonly used | 01:23 |
| sad | how do i install tar.gz files? | 01:23 |
| LinuxNoob | gnomefreak, : it's not there :( | 01:23 |
| Yoric | Frogzoo, ok. | 01:23 |
| thoreauputic | sad: it depends on what kind of file | 01:24 |
| thoreauputic | sad: is it source code? | 01:24 |
| === pitti [n=pitti@ubuntu/member/pitti] has joined #ubuntu | ||
| sad | divx-player-installer.tar.gz | 01:24 |
| sad | installer | 01:24 |
| christmas | nubbe, thanks, i'll try it know; i installed the driver but i didn't make the last part, editing the NVIDIA-settings.desktop file | 01:24 |
| gnomefreak | !divx | 01:24 |
| ubotu | rumour has it, restricted is https://wiki.ubuntu.com/RestrictedFormats Most of the formats listed here can be replaced by !FreeFormats | 01:24 |
| thoreauputic | sad: erm - what are you wanting to do? there are divx players in ubuntu | 01:24 |
| sad | where? | 01:25 |
| sad | i cant play my videos | 01:25 |
| thoreauputic | sad: read theurl gnomefreak gave you above | 01:25 |
| _Rappy_ | vlc, good player | 01:25 |
| thoreauputic | sad: https://wiki.ubuntu.com/RestrictedFormats | 01:25 |
| pengo | hmm.. now i want an image viewer that will preload _two_ images in advance | 01:25 |
| nubbe | christmas, I hope it helps, actually think the config enable thing is the important thing, but I hope it works for u | 01:25 |
| === laffer-pt [n=laffer@82.155.193.216] has joined #ubuntu | ||
| kleinlappies_ | hi | 01:26 |
| JLiquorish | i might convert my music to freeformats, ill just have to find an "mp3 player" that supports it, ipods dont | 01:26 |
| babo | what's the easiest way to see how much memory an app is taking up on my box ?... 'top' gives me mem in % , but that's not what I want ... maybe somewhere in proc ? | 01:26 |
| kleinlappies_ | whats the best way to install vlc? | 01:26 |
| _Rappy_ | apt-get install | 01:26 |
| Frogzoo | !tell JLiquorish about packagemanagement | 01:26 |
| ompaul | _Rappy_, if your going to say that "sudo apt-get install" is much more useful for new users | 01:27 |
| JLiquorish | cheers =D | 01:27 |
| _Rappy_ | ompaul: erm, yes. My bad | 01:27 |
| ompaul | :) | 01:27 |
| JLiquorish | oo, it says the page doesnt exist yet | 01:27 |
| kbrooks | Why wouldn't stdin be a tty? | 01:27 |
| thoreauputic | babo: try the bottom line of the output of pmap -d `$(pidof app) | 01:27 |
| gnomefreak | !vlc | 01:27 |
| ubotu | I guess vlc is a video/audio player that supports almost everything - See http://www.videolan.org/ for more information (VLC is in the repos) | 01:28 |
| Frogzoo | JLiquorish: yes, wierd | 01:28 |
| gnomefreak | sudo apt-get install vlc kleinlappies_ | 01:28 |
| === malv [n=arthur@pool-71-103-34-110.lsanca.dsl-w.verizon.net] has joined #ubuntu | ||
| sclark | !FreeFormats | 01:28 |
| ubotu | There are a large number of Free Formats which are preferred over patent and copyright encumbered formats. They are listed here: https://wiki.ubuntu.com/FreeFormats | 01:28 |
| === mendred [n=mendred@59.92.38.12] has joined #ubuntu | ||
| thoreauputic | babo: sorry extra backtick typo in that - try for instance pmap -d $(pidof xchat) | 01:29 |
| JLiquorish | ok, well ill look into package management =) and im going to look into turning as completely opensource as possible, including on windows, which i have to use unfrtunetly =( | 01:29 |
| === Dewi [n=dewi@203-206-11-92.dyn.iinet.net.au] has joined #ubuntu | ||
| thoreauputic | babo: wrieable/private is the relevant figure | 01:30 |
| === xstation [n=bliss1@4096.net] has joined #ubuntu | ||
| babo | thoreauputic: thanks ... my firefox takes up 320388K of memory. Is that a bit much do you reckon ? | 01:30 |
| xstation | frogzoo: script still running | 01:30 |
| === geargolem [n=geargole@pool-72-72-128-72.hrbgpa.dsl-w.verizon.net] has joined #ubuntu | ||
| Frogzoo | xstation: don't follow you | 01:31 |
| xstation | frogzoo just want to put this by yoiu see what you thoink | 01:31 |
| thoreauputic | babo: not really - FF uses a fair bit - it also tends to leak a lot unfortunately | 01:31 |
| xstation | Frogzoo: the url you sent me has a script | 01:31 |
| Frogzoo | babo: what are you running there? I'm @ 100meg virt, 50meg res | 01:31 |
| thoreauputic | babo: oh sorry - over 300MB ? that is lot | 01:31 |
| Frogzoo | xstation: it d/ls stuff from the net & that takes time | 01:31 |
| === LegionSvK [n=Legion@158.195.62.70] has joined #ubuntu | ||
| Karlprof | Hello, quick question - why doesn't the command 'gets' work with my install of Ruby? | 01:32 |
| === pitti [n=pitti@ubuntu/member/pitti] has joined #ubuntu | ||
| Guestakkio | what is the command to know the version of the kernel? | 01:32 |
| Frogzoo | babo: is this ff 1.0.7 ? | 01:32 |
| thoreauputic | babo: here firefox-bin uses 89700K currently | 01:32 |
| neomancer911 | uname | 01:32 |
| kleinlappies_ | gnomefreak thanks, gonna try it again i don't have it in my repo list | 01:32 |
| Karlprof | Irb says 'STDIN.tty?' is 'true', my code says 'STDIN.tty?' is false. | 01:33 |
| neomancer911 | Guestakkio, uname | 01:33 |
| === ChristmasCpp [n=christma@86.104.196.200] has joined #ubuntu | ||
| Guestakkio | only uname? | 01:33 |
| geargolem | how can I discover if Xubuntu is best for my system? | 01:33 |
| neomancer911 | Guestakkio, uname -a | 01:33 |
| Guestakkio | ok tnx | 01:33 |
| kleinlappies_ | gnomefreak sorry wait did a apt-get update and vola it going ;) | 01:33 |
| thoreauputic | geargolem: install it and try it? | 01:33 |
| Frogzoo | Guestakkio: uname -a but also /proc/version | 01:33 |
| kbrooks | Karlprof, ummm | 01:34 |
| babo | Frogzoo: it's ff 1.5 ... I've heard that FF have some serious memory management issues ... I haven't reloaded it in a couple of days so I guess that's my problem. | 01:34 |
| Karlprof | Hey, kbrooks. | 01:34 |
| geargolem | thoreauputic, I had a feeling someone would say that. I mean is there a basis for users of Xubuntu? How much older systems are better with Xcfe | 01:34 |
| Frogzoo | babo: could be | 01:34 |
| thoreauputic | babo: yes, it leaks | 01:34 |
| ChristmasCpp | nubbe, i did all that was written in the wiki page you sent me, now when i try to access NVIDIA Settings it gives me an error: "Cannot launch entry; Details: Failed to execute child process "nvidia-settings" (No such file or directory) | 01:34 |
| kbrooks | Karlprof, think. if you were helping someone with the EXACT SAME problem as yours and with the EXACT SAME information given, how could you help? | 01:34 |
| geargolem | *xfce | 01:35 |
| thoreauputic | geargolem: well, I've had it running acceptably on a P200 mmx 64MB RAM | 01:35 |
| geargolem | thoreauputic, I ask because I'm having display problems with dapper | 01:35 |
| === Tomcat_ [n=Tomcat@p54A18B7C.dip0.t-ipconnect.de] has joined #ubuntu | ||
| xstation | Frogzoo; something viper said see if you follow : qemu-img create os.img 8G then qemu -hda os.img -cdrom /dev/cdrom -boot d -win2k-hack -m 256 | 01:35 |
| thoreauputic | geargolem: I guess if you only have say 128 MB RAM Xubuntu is going to be good | 01:35 |
| Karlprof | I guess I'd have to ask for more information. | 01:35 |
| geargolem | thoreauputic, ok, thankyou | 01:36 |
| kbrooks | Karlprof, Correct. | 01:36 |
| === ubushine [n=johnnyb@d154-20-135-62.bchsia.telus.net] has joined #ubuntu | ||
| Karlprof | Like, error messages and stuff? | 01:36 |
| mahangu | !w32codecs | 01:36 |
| ubotu | well, w32codecs is a compilation of binary win32 A/V codecs for many popular proprietary formats not currently supported by free implementations under linux. See http://tinyurl.com/e4a5s to install | 01:36 |
| thoreauputic | geargolem: display problems are X issues - not WM issues usually | 01:36 |
| kbrooks | Karlprof, So give the information missing (ruby version, tracebacks, etc) | 01:36 |
| babo | Frogzoo | 01:36 |
| babo | thoreauputic : thanks guys | 01:36 |
| === brenner [n=brenner@144.134.159.192] has joined #ubuntu | ||
| nubbe | ChristmasCpp, I have no idea, but have u checked ur /etc/X11/xorg.conf and made sure u have "nvidia" instead of "nv" there? | 01:37 |
| Frogzoo | xstation: there's docs for qemu http://fabrice.bellard.free.fr/qemu/user-doc.html | 01:37 |
| geargolem | thoreauputic, i get a 'failure to allocate back buffer' when trying to run blender | 01:37 |
| === xvlun [n=jan@wll192-68.wlan.hu-berlin.de] has joined #ubuntu | ||
| === alapzaj [n=tomek@dsl51B6B91F.pool.t-online.hu] has joined #ubuntu | ||
| === DigitalGheko [n=DigitalG@dsl-145-255-30.telkomadsl.co.za] has joined #ubuntu | ||
| === Xenguy wndrs hw hrd he cn mk it to rd his wrds... | ||
| xstation | Frogzoo; just been running the script but its stoppedat this point QEMU is now installed. | 01:38 |
| xstation | Loading the KQEMU kernel module... | 01:38 |
| xstation | cp: cannot stat `kqemu/kqemu.ko': No such file or directory | 01:38 |
| xstation | FATAL: Module kqemu not found. | 01:38 |
| geargolem | gnomefreak, I got dapper installed finally. | 01:38 |
| Bakgat | sweet.im back. to reiterate. can anyone ere pls help me with networking, pls | 01:39 |
| === bintut [n=bintut@203.131.183.252] has joined #ubuntu | ||
| === tortho [n=tortho@104.84-49-107.nextgentel.com] has left #ubuntu ["Ex-Chat"] | ||
| Xenguy | xstation: did you use that script to get and compile kqemu? | 01:39 |
| kbrooks | Bakgat, Information, please. | 01:39 |
| Xenguy | !tell xstation about paste | 01:39 |
| pierre__ | !multiverse | 01:39 |
| ubotu | To enable Universe and Multiverse see http://wiki.ubuntu.com/AddingRepositoriesHowto - Official sources.lists here: http://paste.ubuntu-nl.org/6047 (Breezy) or http://paste.ubuntu-nl.org/6666 (Dapper) see also !easysource | 01:39 |
| Bakgat | iv'e just finished setting up a postfix mail sever with shorewall protection, but i cant seento get the interfaces up | 01:39 |
| thoreauputic | Xenguy: dropping vowels doesn't really make it harder :) | 01:39 |
| pierre__ | !easysource | 01:40 |
| ubotu | For an easy to use custom sources.list creator, visit http://ubuntulinux.nl/source-o-matic | 01:40 |
| kbrooks | Xenguy, your words still are readable | 01:40 |
| === Manny [n=chris@p54969407.dip0.t-ipconnect.de] has joined #ubuntu | ||
| Xenguy | thoreauputic: I find it less readable actually | 01:40 |
| Karlprof | OK, I'm running ruby 1.8.3 [i486 linux] on Ubuntu Breezy Badger. When I IRB "filename = gets", type 'hello world', then IRB "print filename", it works, but when I try to run the same code in the actual Ruby interpreter thingy, I get the error test.rb:1:in `gets': Bad file descriptor (Errno::EBADF). I was advised to test in #ruby-lang for STDIN.tty - IRB says I have it, Ruby says I don't. Can anyone help? | 01:40 |
| Frogzoo | xstation: is this breezy or dapper? | 01:40 |
| Xenguy | kbrooks: yes, but not as readable me thinks :-) | 01:40 |
| === Abner [n=abner@adsl-69-209-198-214.dsl.chcgil.ameritech.net] has joined #ubuntu | ||
| xstation | Xenguy: I followed the url to the letter http://oui.com.br/n/content.php?article.23 | 01:40 |
| === mahangu_ [n=mahangu@220.247.248.149] has joined #ubuntu | ||
| Bakgat | i've set it up with only a single NIC, but I've tried enabling the second, but no luck | 01:41 |
| Xenguy | xstation: right, OK here's what I did... | 01:41 |
| xstation | Frogzoo: its brezzy 5.10 | 01:41 |
| kbrooks | Karlprof, what is the FULL command line for the script? | 01:41 |
| === mahangu_ is now known as mahangu | ||
| Frogzoo | xstation: try 'sudo insmod kqemu' - what happens? | 01:41 |
| Bakgat | the instructions i've followed @ http://flurdy.com/docs/postfix/#install_pack . very detailed | 01:41 |
| Xenguy | xstation: the script is compiling everything against kernel headers that don't match you current kernel, so... | 01:42 |
| Karlprof | I don't understand what you mean. In IRB, I typed 'filename = gets', pressed enter, typed 'hello world', pressed enter, and got: | 01:42 |
| Karlprof | hello world | 01:42 |
| Karlprof | => nil | 01:42 |
| ompaul | Bakgat, have a look at system administration networking | 01:42 |
| === TANATHOS [n=pionner@88.158.130.2] has joined #ubuntu | ||
| Xenguy | xstation: look for a point in the script where it does a 'uname', and then try to hard-code the proper value if you can... | 01:43 |
| Bakgat | if fillded with the /etc/network/interfaces & /etc/shorewall/* files . no luck | 01:43 |
| ompaul | Bakgat, it is how stuff gets done in that part of ubuntu - if you have wireless and it is not there then >/msg ubotu ndiswraper < | 01:43 |
| xstation | Frogzoo insmod: can't read 'kqemu': No such file or directory | 01:43 |
| Bakgat | switched from dhcp to static back 2 dhcp | 01:43 |
| === apokryphos [i=[U2FsdGV@server2.polaristar.com] has joined #ubuntu | ||
| Xenguy | xstation: basically the script is probably fetching '686' headers when you are running '386' or something like that | 01:43 |
| geargolem | How can I get my X display to not flicker on screen savers? | 01:44 |
| Karlprof | ... OK, actually, I just discovered something. I was using SciTE's Run window, as I assumed it was the same as the terminal window, but trying "ruby /home/karl/Desktop/test.rb" in the terminal worked. Which is odd. | 01:44 |
| Bakgat | ompaul, pls elaborate | 01:44 |
| gnomefreak | geargolem: what video card? | 01:44 |
| Karlprof | Why would SciTE's little thingy break when the actual terminal window works? | 01:44 |
| xstation | Xengay: yes thats pretty much the case I think but do not know how to hard-code | 01:44 |
| ompaul | geargolem, mostly give it more video ram and ram | 01:44 |
| ompaul | Bakgat, thats how you set up networking in Ubuntu | 01:44 |
| Bakgat | cmd again pls | 01:45 |
| ompaul | Bakgat, menu: system -> administration -> networking | 01:45 |
| geargolem | gnomefreak, standard with the box, intel | 01:45 |
| Xenguy | xstation: you can play on the command-line with the commands 'uname -r', and 'uname -m', to see the differences. Anyway if you get the script to fetch the correct kernel headers, it will work fine | 01:45 |
| Bakgat | sorry, ompaul, runnin nin-guy sys | 01:45 |
| SoapBath | Log: Day 1; I love Ubuntu! I really do. So fast, and so smooth running | 01:45 |
| Bakgat | *non-GUI* | 01:45 |
| === pvanhoof [n=pvanhoof@mailhost.newtec.be] has joined #ubuntu | ||
| painkiler | oh yeah... how do i edit the graphic on my gnome menu bar button? From the ubuntu one to my own? | 01:46 |
| ompaul | Bakgat, I was almost there as you hit enter | 01:46 |
| xstation | Xenguy: so what to do next? | 01:46 |
| gnomefreak | geargolem: im not real sure it sounds like a driver issue | 01:46 |
| === Hoxzer [n=niko@a80-186-169-248.elisa-laajakaista.fi] has joined #ubuntu | ||
| Xenguy | xstation: OK, let me see if I can find my revised script, sec... | 01:46 |
| xstation | Frogzoo: any ideas please | 01:46 |
| === hatake_k1kashi [n=meh@60-240-149-176.tpgi.com.au] has joined #ubuntu | ||
| === shedi [n=siggi@dsl-220-183.hive.is] has joined #ubuntu | ||
| geargolem | can I slow the display to fit my system capabilities, gnomefreak ? | 01:46 |
| xstation | Xenguy; thanks | 01:46 |
| gnomefreak | geargolem: are you using xscreensaver? and is that the only time it flickers? | 01:47 |
| === walkingice [n=walkingi@220-132-63-117.HINET-IP.hinet.net] has joined #ubuntu | ||
| === btsai_ [n=VRWarper@cpe-24-90-212-152.nyc.res.rr.com] has joined #ubuntu | ||
| Bakgat | guys, brb. gotta go check on something | 01:47 |
| geargolem | gnomefreak, yes, xscreensaver and yes, thats the only time | 01:48 |
| ompaul | Bakgat, have a look at this page and its links https://wiki.ubuntu.com/NetworkManager | 01:48 |
| gnomefreak | geargolem: have you tried the reg screensavers to see if they flicker? | 01:48 |
| === martink [n=martin@p54B393D6.dip0.t-ipconnect.de] has joined #ubuntu | ||
| kbrooks | Karlprof, no one knows. heh. | 01:50 |
| gnomefreak | geargolem: btw we help with dapper in #ubuntu+1 now | 01:50 |
| geargolem | gnomefreak, ok @ dapper. I set display to 0:0, and now I get a 'failure to allocate z buffer' error. | 01:51 |
| davidmcq | hi guys... can anyone suggest why NO linux will install on my newly aquired IBM r32? | 01:51 |
| Karlprof | Heh, ah well. It doesn't really matter now I suppose, using the terminal isn't that big of a chore. | 01:51 |
| === ChristmasCpp [n=christma@86.104.196.200] has joined #ubuntu | ||
| Xenguy | xstation: Got it; do you know how to read a 'diff' ? | 01:52 |
| xstation | Xenguy : noT sure but the scrpit file has this entry sh ./configure --prefix=/usr --cc=gcc-3.4 --host-cc=gcc-3.4 --kernel-path=/usr/src/linux-headers-$(uname -r)/ || exit 13 | 01:53 |
| === liveloulouri [n=liveloul@124.Red-83-37-241.dynamicIP.rima-tde.net] has joined #ubuntu | ||
| === Fergy [n=Fergy@a82-92-232-156.adsl.xs4all.nl] has joined #ubuntu | ||
| liveloulouri | holaa | 01:54 |
| Xenguy | xstation: I pastebin'd the diff: http://paste.ubuntu-nl.org/11088 | 01:54 |
| xstation | Xenguy: iok thanks | 01:54 |
| === s1 [n=magnus@c-61ed70d5.042-203-6c756e10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| === ubuntu_ [n=ubuntu@203-217-51-252.dyn.iinet.net.au] has joined #ubuntu | ||
| === subir [n=subir@202.79.37.177] has joined #ubuntu | ||
| === liveloulouri [n=liveloul@124.Red-83-37-241.dynamicIP.rima-tde.net] has left #ubuntu ["Abandonando"] | ||
| Xenguy | xstation: the '-' lines are the original/old file... | 01:54 |
| === chris [n=flamin87@c220-237-79-141.kelvn1.qld.optusnet.com.au] has joined #ubuntu | ||
| === ubuntu_ is now known as rkinder | ||
| chris | hey all, anyone there? | 01:55 |
| Xenguy | xstation: the '+' lines are the new file... | 01:55 |
| === jellyware [n=jellywar@ppp46-44.lns2.syd6.internode.on.net] has joined #ubuntu | ||
| chris | i got a quick question, i hear i can see windows shears on ubuntu (with out synergy - is that correct)... | 01:55 |
| gnomefreak | chris: please feel free to ask your question | 01:55 |
| xstation | Xengay: so what do | 01:56 |
| chris | err not sysnergy i ment... | 01:56 |
| chris | samba | 01:56 |
| === Abner is now known as Abnix | ||
| Xenguy | xstation: I have 'commented out' (i.e. deactivated) a few lines in the script with '#TEST#'. Then I told the script to just go get '386' kernel headers, instead of trying to decide on either '686' or '386' (which it got wrong anyway). | 01:56 |
| Xenguy | xstation: does that make enough sense now? | 01:56 |
| rkinder | So where do I report a bug for breezy now? Malone? | 01:57 |
| === sexcopter8000m [n=james@dslb-082-083-214-140.pools.arcor-ip.net] has joined #ubuntu | ||
| xstation | Xenguy: so do I run the script you sent me | 01:57 |
| === kuja [n=kuja@unaffiliated/kuja] has joined #ubuntu | ||
| apokryphos | rkinder: yes | 01:57 |
| === ChristmasCpp [n=christma@86.104.196.200] has joined #ubuntu | ||
| === sudomania4_ [n=c@65.212.111.164] has joined #ubuntu | ||
| Xenguy | xstation: you look at the pastebin, and you make the changes to your copy of the script that I did (make a backup first if you like). | 01:58 |
| Xenguy | xstation: then you run the revised script again | 01:58 |
| === Floppy` [n=floppy@194.126.178.66] has joined #ubuntu | ||
| === Floppy` [n=floppy@194.126.178.66] has left #ubuntu ["Leaving"] | ||
| === CoOlGhOsT [n=coolghos@port534.ds1-ba.adsl.cybercity.dk] has joined #ubuntu | ||
| chris | when i go to places>network>windows network - the folder is empty (although i have sheared directories on my xP comp) | 01:59 |
| xstation | Xenguy: where in the script that I have do the lines which you placed in the paste bin go | 01:59 |
| rkinder | apokryphos: for all components? I'm trying to do a gedit bug and I get a message:gedit does not use Malone as its bug tracker | 02:00 |
| === engla [n=ulrik@kr-lun-116-144-233-83.3.cust.bredband2.com] has joined #ubuntu | ||
| Xenguy | xstation: do you have a text editor you like (gedit? nano?) ? | 02:00 |
| rkinder | ... please use its official bug tracker | 02:00 |
| apokryphos | rkinder: you must be doing something wrong... | 02:01 |
| xstation | Xenguy: yes I have gedit | 02:01 |
| === linuxboyfriend [n=linuxboy@202.134.132.126] has joined #ubuntu | ||
| === atoponce [n=aaron@c-24-2-85-66.hsd1.ut.comcast.net] has joined #ubuntu | ||
| apokryphos | rkinder: are you on https://launchpad.net/distros/ubuntu/+filebug ? | 02:01 |
| linuxboyfriend | hi all | 02:01 |
| === redir [n=Reed@208-58-195-117.c3-0.grg-ubr2.lnh-grg.md.cable.rcn.com] has joined #ubuntu | ||
| chris | hi | 02:01 |
| Xenguy | xstation: if so, fire it up, do a keyword search on, say, 'uname -m', and that should locate the section where you need to make my changes to the script | 02:01 |
| linuxboyfriend | can i install gnome-2.14 in ubuntu breezy? | 02:01 |
| rkinder | apokryphos: no, https://launchpad.net/products/gedit/+bugs then click 'Report a bug' | 02:02 |
| painkiler | crap. how do i reset my gnome panels to default? | 02:02 |
| Xenguy | xstation: last thing before I head to work: line '026' in the pastebin is where I said to the script, "just go get 386 headers". | 02:02 |
| apokryphos | rkinder: wrong page, then. | 02:02 |
| === lkd [n=chatzill@cpc3-blfs6-0-0-cust45.belf.cable.ntl.com] has joined #ubuntu | ||
| Nolt-aWay | hey i need good utility for burning cd's for ubuntu (no Graveman) | 02:03 |
| gnomefreak | which mplayer is gui is it mplayer-arch or mozilla-mplayer? | 02:03 |
| painkiler | ah | 02:03 |
| === G0SUB [n=ghoseb@ubuntu/member/g0sub] has joined #ubuntu | ||
| painkiler | Nolt-aWay: Gnomebaker | 02:03 |
| === roylez [n=roy@147.8.245.23] has joined #ubuntu | ||
| === lkd is now known as lkd-efs | ||
| rkinder | Malone is rather confusing... thanks for the help apokryphos :) | 02:03 |
| === Nolt-aWay is back ( Away 1 hour 4 mins 28 secs ) | ||
| === Nolt-aWay is now known as Nolt | ||
| Nolt | painkiler: thanks | 02:03 |
| Xenguy | xstation: pay attention to detail (line by line), make the changes, save the revised script, and run it. Then it will either work nicely (as it did in my case) or it will bomb again ;-) | 02:03 |
| === sad [n=sqilzim@h201n10-m-rg-gr100.ias.bredband.telia.com] has joined #ubuntu | ||
| sad | how do i install .deb files? | 02:04 |
| painkiler | how can i reset my gnome panels to default? | 02:04 |
| xstation | Xenguy: thanks -$(uname -r)/ || exit 13 | 02:04 |
| xstation | echo is the only line | 02:04 |
| === thoreauputic_ [n=prospero@ubuntu/member/thoreauputic] has joined #ubuntu | ||
| gnomefreak | sad: sudo dpkg -i file.deb | 02:04 |
| Rdde | whats the best way to mount a samba sever in windows? | 02:04 |
| sad | it dont work | 02:04 |
| linuxboyfriend | can anyone tell me that gnome answer? | 02:05 |
| chris | cant seem to see my xp computer from ubuntu | 02:05 |
| xstation | Xenguy thanks for your help but where do I place your diff file | 02:05 |
| === Lasse_ [n=lasse@dsl-aur-fe80dd00-87.dhcp.inet.fi] has joined #ubuntu | ||
| === Floppy` [n=floppy@194.126.178.66] has joined #ubuntu | ||
| Nolt | gnome rulez !!!!!!!!!!!! :P | 02:05 |
| pusling | Nolt: nope. it is ugly and gtk-based ;) | 02:05 |
| === thoreauputic_ is now known as thoreauputic | ||
| === LinuxJones [n=willy@hlfxns01bbh-142177199243.ns.aliant.net] has joined #ubuntu | ||
| Nolt | pusling: ohh why ugly :P little gnome-look.org and u can have nice gnome :D | 02:06 |
| === DrPepperKid [n=mirco@dslb-084-063-004-204.pools.arcor-ip.net] has joined #ubuntu | ||
| === gnomefreak has a nice dark gnome ;) | ||
| chris | is it possible to have file transfer or network on LAN *without* samba? | 02:07 |
| === sorush21 [n=sorush20@82-43-184-143.cable.ubr07.newm.blueyonder.co.uk] has joined #ubuntu | ||
| Xenguy | xstation: you don't. The diff file shows the changes I made (- to +), so you identify the changes, and then apply them manually to your own copy of the script | 02:07 |
| Xenguy | xstation: make sense? | 02:07 |
| sorush21 | guys what other pim programs are there? | 02:07 |
| linuxboyfriend | gnomefreak, hi | 02:07 |
| === Zdra [n=zdra@143-244.242.81.adsl.skynet.be] has joined #ubuntu | ||
| gnomefreak | hi | 02:07 |
| === pusling has a nice kde ;) | ||
| === grajkoo [n=grajkoo@87.207.227.167] has joined #ubuntu | ||
| linuxboyfriend | hows life going on | 02:08 |
| === Dewio [n=dewi@203-206-21-47.dyn.iinet.net.au] has joined #ubuntu | ||
| xstation | Xenguy; I am very sorrey for being a little not with it but unless I know what goes where its a little difficult | 02:08 |
| Xenguy | xstation: my changes start on line 52 of the script I have here, which is the same script I assume that you have | 02:08 |
| linuxboyfriend | gnomefreak, hows life going on (previously i forgot to mention your nick)? | 02:08 |
| === munzir [n=munzir@85.129.244.126] has joined #ubuntu | ||
| xstation | Xenguy; line 52 ok | 02:09 |
| Nolt | pusling: kde is lazy :P | 02:09 |
| Xenguy | xstation: good luck I have to run; I'll check in again at work (no worries, you are on a wee learning curve I see, but this is quite do-able) | 02:09 |
| === Nolt have cute gnome :D | ||
| Nolt | ( Operating System ) Linux Ubuntu 5.10 - breezy Kernel: 2.6.12-10-386, GNU/Linux | Xorg: 6.8.2 | IRC CLient: X-Chat v.2.4.4 | 02:10 |
| xstation | Xenguy: perhaps | 02:10 |
| linuxboyfriend | gnomefreak, can you tell me one thing about gnome? | 02:10 |
| pierre__ | #ubuntu+1 | 02:10 |
| === MacSlow [n=mirco@dslb-084-063-004-204.pools.arcor-ip.net] has joined #ubuntu | ||
| Nolt | linuxboyfriend: what u need about gnome ? | 02:10 |
| gnomefreak | linuxboyfriend: ill try | 02:11 |
| gnomefreak | sorry im here trying to break something so if i dont answer right away thats why | 02:11 |
| chris | so does ubuntu have any ability to see my xp sheared files??? | 02:11 |
| linuxboyfriend | Nolt, gnomefreak: can i install (apt-get) gnome 2.14 in breezy? | 02:11 |
| gnomefreak | ntfs or fat? | 02:11 |
| xstation | Xenguy there must bre a few who have had this problem so the - is what is taken out and+ is what is put in | 02:11 |
| chris | ntfs | 02:11 |
| gnomefreak | linuxboyfriend: i wouldnt | 02:11 |
| === guest [n=guest@pool-71-114-18-154.washdc.dsl-w.verizon.net] has joined #ubuntu | ||
| kbrooks | linuxboyfriend, no. | 02:12 |
| gnomefreak | ubotu tell chris about ntfs | 02:12 |
| kbrooks | linuxboyfriend, you cannot. | 02:12 |
| Nolt | linuxboyfriend:nop | 02:12 |
| gnomefreak | chris: you pm | 02:12 |
| guest | when I start Ubuntu I have not window system. How can I enter GNome? | 02:12 |
| linuxboyfriend | kbrooks, gnomefreak Nolt: and by source packages? | 02:12 |
| kbrooks | linuxboy, still cant. | 02:12 |
| gnomefreak | you can but it can and more than likely will bork breezy fast | 02:12 |
| Nolt | linuxboyfriend: yea its the way but i think it will be hard | 02:12 |
| Nolt | kbrooks: he can do this if he know how :) | 02:12 |
| chris | yup thanks | 02:12 |
| kbrooks | Nolt, and i'm assuming by deduction he doesnt | 02:13 |
| guest | How do I enter GNome from the command prompt? | 02:13 |
| gnomefreak | linuxboyfriend: gnome 2.14 has depends that breezy dont have | 02:13 |
| thenuke | guest: startx | 02:13 |
| Nolt | btw u see this $hit ?? http://www.xpde.com/ | 02:13 |
| linuxboyfriend | gnomefreak, Nolt, i think i can manage, but before installation, i wanna know some facts | 02:13 |
| Nolt | almost windows ^^ | 02:13 |
| linuxboyfriend | gnomefreak, Nolt : can you check this link http://ftp.gnome.org/pub/GNOME/desktop/2.14/2.14.0/sources/ | 02:14 |
| guest | thenuke: Sir, I did so. It did work. However, I have limited authority. | 02:14 |
| kbrooks | Nolt, and its not illegal. | 02:14 |
| === sorush21 [n=sorush20@82-43-184-143.cable.ubr07.newm.blueyonder.co.uk] has left #ubuntu [] | ||
| pusling | Nolt: I have a cute kde ;) it can be seen on pusling.com/screendump ;) | 02:14 |
| linuxboyfriend | gnomefreak, Nolt: how can i download all of these files with one command? | 02:14 |
| === jerry [n=jerry@218.78.238.6] has joined #ubuntu | ||
| gnomefreak | linuxboyfriend: if you install it your looking at problems | 02:14 |
| guest | thenuke: I can not run all my administartive programs. As I was able to when I first installed. | 02:14 |
| xstation | Xenguy: well where to start looks like another 2 hour lunch gone down the learning curve | 02:14 |
| linuxboyfriend | gnomefreak, sorry (cant understand, what do you mean?) | 02:15 |
| Nolt | linuxboyfriend: i think better stay with this gnome :) | 02:15 |
| gnomefreak | linuxboyfriend: you will lose gnome | 02:15 |
| === monger [n=peter@cc613448-a.groni1.gr.home.nl] has joined #ubuntu | ||
| === nadjyla [n=nadjyla@ALyon-209-1-4-56.w80-14.abo.wanadoo.fr] has joined #ubuntu | ||
| gnomefreak | linuxboyfriend: gnome 2.14 has things it depends on that breezy just doesnt have | 02:15 |
| linuxboyfriend | gnomefreak, Nolt: OK, i will (as you wish) :) | 02:15 |
| === bintut [n=bintut@203.131.183.252] has joined #ubuntu | ||
| === peibol [n=peibol@23.Red-81-36-135.dynamicIP.rima-tde.net] has joined #ubuntu | ||
| Nolt | hehe | 02:15 |
| thenuke | guest: sudo -s -H gives you root-access | 02:15 |
| linuxboyfriend | Nolt, yes you have the right to laugh :) | 02:16 |
| guest | thenuke: Yes. Let me try this... | 02:16 |
| === nadjyla [n=nadjyla@ALyon-209-1-4-56.w80-14.abo.wanadoo.fr] has left #ubuntu ["tcho] | ||
| linuxboyfriend | Nolt, :) | 02:16 |
| === ara [n=ara@c-360de353.01-94-7673741.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| bintut | where can i find again the website where i can add repositories for ubuntu? | 02:16 |
| === beyond [n=beyond@200-171-140-32.dsl.telesp.net.br] has joined #ubuntu | ||
| xstation | any one know about diff files I am trying not to give up | 02:16 |
| bimberi | !repos | 02:16 |
| ubotu | To enable Universe and Multiverse see http://wiki.ubuntu.com/AddingRepositoriesHowto - Official sources.lists here: http://paste.ubuntu-nl.org/6047 (Breezy) or http://paste.ubuntu-nl.org/6666 (Dapper) see also !easysource | 02:16 |
| guest | thenuke: sudo -s worked. However sudo -H did not... | 02:17 |
| === peibol [n=peibol@23.Red-81-36-135.dynamicIP.rima-tde.net] has left #ubuntu ["Abandonando"] | ||
| jerry | I can't input word in emacs21 | 02:17 |
| linuxboyfriend | gnomefreak, Nolt, is ubuntu immediately start to ship after its release (online)? | 02:17 |
| === erez [n=erez@85-250-9-41.bb.netvision.net.il] has joined #ubuntu | ||
| thenuke | guest: " thenuke@Hero:/$ sudo -s -H " | 02:17 |
| guest | thenuke: When I try to enter networking, Ubuntu returns: Details: Failed to execute child process "gksudo" (No such file or directory) | 02:17 |
| gnomefreak | linuxboyfriend: they will start shipping the first week in june | 02:17 |
| munzir | Hi, I am missing some crucial software ;) should I report them as bugs? e.g. xvidcap to capture screen video/audio | 02:17 |
| Nolt | linuxboyfriend: u get anserw :P | 02:17 |
| === imc_ [n=nselby@pool-70-19-73-158.ny325.east.verizon.net] has joined #ubuntu | ||
| jerry | who can help me solve this problem? thanks | 02:18 |
| === jerry [n=jerry@218.78.238.6] has left #ubuntu [""] | ||
| linuxboyfriend | Nolt, gnomefreak, hmm, can we put orders before its release? | 02:18 |
| thenuke | guest: it looks like there is something wrong with your install | 02:18 |
| Nolt | linuxboyfriend: but u can download before u will ship | 02:18 |
| imc_ | Hey, who was here yesterday looking for transparent terminal stuff? | 02:18 |
| bintut | what repository shall i add in order to install acroread and macromedia flash? | 02:18 |
| thenuke | guest: if it is really missing files :-/ | 02:18 |
| guest | thenuke: However, I used this before... | 02:18 |
| === imc_ is now known as ifr | ||
| gnomefreak | linuxboyfriend: not now but i would check the ship it site mid may | 02:18 |
| linuxboyfriend | Nolt, i have dialup :( | 02:18 |
| ifr | Hey, who was here yesterday looking for transparent terminal stuff? | 02:18 |
| Nolt | linuxboyfriend: oh i c :/ | 02:19 |
| === bingogu [n=bingogu@211.161.61.224] has joined #ubuntu | ||
| linuxboyfriend | gnomefreak, me too :) | 02:19 |
| guest | thenuke: I used Ubuntu. Then restarted to enter XP. When I restarted Ubuntu, this occured. Hmmm... | 02:19 |
| thenuke | guest: :-\ | 02:19 |
| === mahangu_ [n=mahangu@unaffiliated/mahangu] has joined #ubuntu | ||
| thenuke | guest: perhaps you could try safemode | 02:19 |
| bingogu | i delete my system tray carelessly, how can i find it | 02:19 |
| guest | thenuke: how do I? | 02:20 |
| === loading [n=Loading@218.78.238.6] has joined #ubuntu | ||
| thenuke | hmm, or did safemode have x started.. hmm | 02:20 |
| linuxboyfriend | Nolt, i tried to upgrade to dapper but there was problems with my modem, wvdial immediately disconnects after connectiong to internet :/ | 02:20 |
| thenuke | well blah, I guess I dont know how to figure this out :-) | 02:20 |
| guest | thenuke: You think I am in safe mode? | 02:20 |
| === gnomefreak been using dapper for a while now so ship it isnt really all that important for me atm | ||
| guest | thenuke: Understood. ;) | 02:20 |
| bingogu | help i want to get my system tray, i delete it by mistake | 02:20 |
| thenuke | guest: no I did not think that, I would not believe that you could enter safemode by accident | 02:21 |
| nubbe | I have looked around for a good while now; Is there any way to create a menu with choosen apps at the top-level and bind it a kb short-cut? I can't believe that I am the only one who would find that useful? | 02:21 |
| === AskHL [n=ask@82.211.196.49] has joined #ubuntu | ||
| guest | thenuke: I see. | 02:21 |
| davidmcq | my apologies to those who have seem me ask this before today.. but has anyone had any problems with an IBM thinkpad r32 hanging while installing? | 02:21 |
| === Pratico [n=csvteles@200.141.116.120] has joined #ubuntu | ||
| === Tomcat_ [n=Tomcat@p54A18B7C.dip0.t-ipconnect.de] has joined #ubuntu | ||
| linuxboyfriend | gnomefreak, Nolt, OK, i am going... thanks a lot buddies :) | 02:21 |
| bimberi | bingogu: add a 'Notification Area' applet to your panel | 02:22 |
| Nolt | linuxboyfriend:the upgradeing the unstable ver isnt good idea :P better install clean copy if u have flight5 if not breezy isnt so bad :P | 02:22 |
| Nolt | linuxboyfriend: no problem mate | 02:22 |
| === triki [n=triki@136.Red-80-32-206.staticIP.rima-tde.net] has joined #ubuntu | ||
| bingogu | thks bimberi | 02:22 |
| loading | help | 02:22 |
| linuxboyfriend | Nolt, bye | 02:22 |
| gnomefreak | !helpme | 02:22 |
| ubotu | If you do not actually ask a question, we can not actually help you. | 02:22 |
| Nolt | cya | 02:22 |
| linuxboyfriend | exit | 02:22 |
| bimberi | bingogu: np :) | 02:22 |
| === linuxboyfriend [n=linuxboy@202.134.132.126] has left #ubuntu ["Leaving"] | ||
| gnomefreak | linuxboyfriend: try /quit | 02:23 |
| gnomefreak | oh well | 02:23 |
| guest | Does anyone know why Ubuntu is reterning: Details: Failed to execute child process "gksudo" (No such file or directory) | 02:23 |
| Nolt | :P | 02:23 |
| davidmcq | /exit works too :) | 02:23 |
| === Khisanth [n=Khisanth@pool-71-247-58-45.nycmny.east.verizon.net] has joined #ubuntu | ||
| chris | do i have to set anything up to get my XP computers to automaticaly show up in the 'network servers' folder? | 02:23 |
| === gnomefreak uses the lil x in the right hand corner or /wc to close a window ;) | ||
| === Seatux [n=Seatux@219.95.202.74] has joined #ubuntu | ||
| kbrooks | heh gnomefreak | 02:24 |
| noaXess | hi all | 02:24 |
| caglar__ | can I change the sound channel the volume manager change the volume of? | 02:24 |
| === Martolod [n=jeremy@ARennes-257-1-73-64.w81-53.abo.wanadoo.fr] has joined #ubuntu | ||
| caglar__ | my sound comes from PCM and the volume manager changes the master channels volume | 02:24 |
| caglar__ | I mean my keyboard shortcuts do | 02:25 |
| === Seatux [n=Seatux@219.95.202.74] has joined #ubuntu | ||
| === void^ [n=void@p549E07E9.dip0.t-ipconnect.de] has joined #ubuntu | ||
| === raja [n=raja@60.51.43.99] has joined #ubuntu | ||
| kleinlappies_ | hi there | 02:25 |
| === stardust [n=john@D40A9FE4.rev.stofanet.dk] has joined #ubuntu | ||
| === ptlo [n=senko@83-131-10-216.adsl.net.t-com.hr] has joined #ubuntu | ||
| kleinlappies_ | silly question, kde samba how to | 02:25 |
| === GGS [n=gunne@h203n1fls31o834.telia.com] has joined #ubuntu | ||
| === loading [n=Loading@218.78.238.6] has joined #ubuntu | ||
| _jason | guest: did your install complete successfully? | 02:26 |
| === eeaaxx [n=eeaaxx3@61.9.109.17] has joined #ubuntu | ||
| gnomefreak | !samba | 02:26 |
| ubotu | samba is probably https://wiki.ubuntu.com/SettingUpSamba or https://wiki.ubuntu.com/MountWindowsSharesPermanently | 02:26 |
| loading | !emacs | 02:26 |
| ubotu | What? Try searching at http://ubuntu.cc.com.au/, loading | 02:26 |
| xstation | Xenguy; give me a call when you get back I will just hang | 02:26 |
| loading | I can't input word into emacs | 02:27 |
| kleinlappies_ | thanks ;) | 02:27 |
| === freakyferret [n=robert@AC9E4ACA.ipt.aol.com] has joined #ubuntu | ||
| gnomefreak | brb | 02:27 |
| === Akonkwa [n=ubuntu@user-85-201-1-249.tvcablenet.be] has joined #ubuntu | ||
| stardust | Hey i have bought a Wireless adapter and lsusb finds it OK.. BUT the howto- http://www.ubuntuforums.org/archive/index.php/t-92327.html - did not work for me.. Ubuntu 6.04 with all updates so far. | 02:27 |
| xstation | Xenguy: o where is vmWare all is forgiven | 02:28 |
| === danf_1979 [n=dan@pc-158-78-104-200.cm.vtr.net] has joined #ubuntu | ||
| === SilverSpace_ [n=SilverSp@83-131-66-54.adsl.net.t-com.hr] has joined #ubuntu | ||
| stardust | It did not make the file while i wrote: sudo make | 02:29 |
| === Lorvy [n=lorvija@dsl-lprgw5-fecdf900-132.dhcp.inet.fi] has joined #ubuntu | ||
| === theD3viL [n=geel@BSN-77-90-27.dsl.siol.net] has joined #ubuntu | ||
| _jason | stardust: #ubuntu+1 for dapper please | 02:30 |
| theD3viL | can please anyone paste his mplayer plugin conf ? | 02:30 |
| theD3viL | for dsl | 02:30 |
| stardust | I did not get that.. ubuntu+1 is what?? | 02:31 |
| === Soder [i=Soder@c-6e0a72d5.07-396-76786a1.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| LadyNikon | theD3viL: search the forums.. you may find some there | 02:31 |
| danf_1979 | Is mysql 5 in dapper repos? | 02:31 |
| theD3viL | LadyNikon, okey,.. | 02:31 |
| _jason | stardust: 6.04 (actually 6-06 now) is the development version of ubuntu. Its name is dapper. The room for dapper discussion is #ubuntu+1, just type: /join #ubuntu+1 | 02:32 |
| Yoric | stardash_, it means "go to channel #ubuntu+1 to discuss version 6.04" | 02:32 |
| Yoric | drat | 02:32 |
| Yoric | s/stardash_/stardust/ | 02:32 |
| guest | Does anyone know why Ubuntu is reterning: Details: Failed to execute child process "gksudo" (No such file or directory) | 02:32 |
| _jason | guest: did your install complete successfully? | 02:32 |
| === sfaris_ [n=email@36.varbergkabel-net01c.varberg.net] has joined #ubuntu | ||
| guest | Yes. | 02:32 |
| stardust | sorry how to i do that? | 02:33 |
| sfaris_ | Where can i download firefox 2 ? | 02:33 |
| guest | _jason...then I left Ubuntu. When I reenturned this problem began. | 02:33 |
| === eXistenZ [n=ex3mr@bzq-88-155-216-109.red.bezeqint.net] has joined #ubuntu | ||
| _jason | guest: 'apt-cache policy gksu' on pastebin please | 02:33 |
| === chefff [n=chefff@port-83-236-185-134.static.qsc.de] has joined #ubuntu | ||
| kbrooks | does #ubuntu support warty? | 02:33 |
| kbrooks | just curious | 02:34 |
| gnomefreak | ff2? | 02:34 |
| _jason | guest: did gksudo ever work? (it's the thing that prompts you for passwords when you start admin things like synaptic) | 02:34 |
| guest | _jason: did so. | 02:34 |
| === scav [n=larsj@198.36.eidsiva.net] has joined #Ubuntu | ||
| Kamping_Kaiser | Guest, what context does it fail in? | 02:34 |
| guest | _jason: Yes... | 02:34 |
| kbrooks | does #ubuntu support warty? | 02:34 |
| guest | K_Kaiser: when starting Networking... | 02:34 |
| _jason | guest: link? | 02:34 |
| gnomefreak | sfaris_: firefox 1.5 is the stable version and 1.6 is the alpha version | 02:34 |
| === makol [n=makol@201.214.199.161] has joined #ubuntu | ||
| === NCLife [i=sinclair@201.160.5.51.cableonline.com.mx] has joined #ubuntu | ||
| sfaris_ | gnomefreak: aight, must have read wrong | 02:35 |
| === gnomefreak hasnt heard of firefox 2 | ||
| Kamping_Kaiser | Guest sure your using the correct password, no capslock etc? | 02:35 |
| gnomefreak | !ff1.5 | 02:35 |
| ubotu | You can use firefox 1.5 by following this wiki page https://wiki.ubuntu.com/FirefoxNewVersion | 02:35 |
| kbrooks | gnomefreak, there is a firefox 2 | 02:35 |
| guest | k_Kaiser: Yes, Sir. I'm certain... | 02:35 |
| gnomefreak | kbrooks: where? | 02:35 |
| === sfaris_ wanna know also | ||
| Nolt | kbrooks: i think support but no one use warty :) | 02:35 |
| guest | k_kaiser: I even had to login first on the prompt. | 02:35 |
| gnomefreak | 1.6 hasnt even come out yet :( | 02:35 |
| Yoric | No, there is a Firefox 2 *alpha* version. | 02:35 |
| kbrooks | gnomefreak, http://www.mozilla.org/projects/bonecho/releases/2.0a1.html | 02:35 |
| === mumbles is now known as mumbles-out | ||
| === bintut^o^ [n=bintut@203.131.183.252] has joined #ubuntu | ||
| Kamping_Kaiser | Guest, if you opehn a terminal and tyupe 'sudo network-admin' does it launch? | 02:36 |
| _jason | guest: I don't what pastebin you used, so I need a link :) | 02:36 |
| kbrooks | gnomefreak, that is alpha | 02:36 |
| Nolt | gnomefreak: there no will be 1.6,0 u can found firefox 2.0 alpha | 02:36 |
| === WolfLaptop [n=wolf@213.196.14.254] has joined #ubuntu | ||
| === TankEnMate [n=matt@host86-144-36-134.range86-144.btcentralplus.com] has joined #ubuntu | ||
| guest | k_kaiser: let me try... | 02:36 |
| guest | _jason: what is "pastebin"...?? | 02:36 |
| gnomefreak | they have alot on thier plate :( | 02:37 |
| TankEnMate | anyone have any ideas why a USB mouse device wouldn't be populated by udev? | 02:37 |
| sfaris_ | kbrooks: do you know what firefox "deerpark" is? | 02:37 |
| === mrios [n=mrios@c-24-61-12-141.hsd1.ma.comcast.net] has joined #ubuntu | ||
| gnomefreak | Nolt: i have 1.6 | 02:37 |
| caglar__ | can I configure alsa, like the standard bitrate or such things? | 02:37 |
| caglar__ | or buffer sizes? | 02:37 |
| guest | k_kaiser: Yes, Sir. It launched. | 02:37 |
| kbrooks | sfaris_, 1.5 | 02:37 |
| _jason | guest: never mind, try what Kamping_Kaiser says first | 02:37 |
| sfaris_ | okay :) | 02:37 |
| TankEnMate | caglar: look for the manpages / google for .asound | 02:37 |
| guest | -jason: yes... | 02:37 |
| === avauntage [n=avauntag@219.142.137.178] has joined #ubuntu | ||
| gnomefreak | deerpark is the alpha name | 02:37 |
| Nolt | gnomefreak:hmm strange :P i didnt heard about 1.6 only 1.5.0.1 | 02:38 |
| === LathropWells [n=bill@cpe-72-134-66-177.socal.res.rr.com] has joined #ubuntu | ||
| _jason | guest: so what causes the error? what are you doing when it happens? | 02:38 |
| === truz24 [n=truz24@12-203-70-118.client.insightBB.com] has joined #ubuntu | ||
| guest | -jason: I'm trying to enter "networking" ... | 02:39 |
| === Seatux [n=Seatux@219.95.202.74] has joined #ubuntu | ||
| guest | _jason: from the "system->administration" menu... | 02:39 |
| _jason | guest: ok type 'apt-cache policy gksu' in a terminal, copy the output and then put it on http://paste.ubuntu-nl.org/ and give us a link please | 02:39 |
| === kuja [n=kuja@unaffiliated/kuja] has joined #ubuntu | ||
| === useruser [n=guest@rupert.tor.istop.com] has joined #ubuntu | ||
| chris | my XP comp dosnt show up in network/windows network/... i can ping my XP machine | 02:42 |
| useruser | how easy would it be to master my own livecd? I basically want an ubuntu desktop with nonfree goodies | 02:42 |
| === isilzha [n=isilzha@155.69.163.149] has joined #ubuntu | ||
| guest | _jason: I hope I did this correctly: http://paste.ubuntu-nl.org/11092 | 02:42 |
| guest | _jason: did it work?!! | 02:43 |
| === stardust [n=john@D40A9FE4.rev.stofanet.dk] has joined #ubuntu | ||
| === rikai [i=rikai@pool-72-65-96-238.ptldme.east.verizon.net] has joined #ubuntu | ||
| === Blue-Omega [i=Blue@about/cooking/nakedchef/omelette/Blue-Omega] has joined #ubuntu | ||
| bimberi | !tell useruser about livecd | 02:43 |
| eXistenZ | gnomefreak, do you have the kde libs installed? | 02:44 |
| _jason | guest: yes, good job. Whenever you see that ``couldn't stat'' stuff it means you should run 'sudo apt-get update' (if it still happens after that then it probably can't reach the server). So go ahead and run 'sudo apt-get update' now | 02:44 |
| === allison_1984 [n=allison_@220.247.231.240] has joined #ubuntu | ||
| === CrocoJet [n=CrocoJet@cm-virtua-poa-C8B0EB96.dynamic.brdterra.com.br] has joined #ubuntu | ||
| useruser | bimberi: thanks, i'll check out that url | 02:44 |
| CrocoJet | good morning everyone ! | 02:44 |
| gnomefreak | eXistenZ: nope | 02:44 |
| === griz [n=griz@koffer.ram.RWTH-Aachen.DE] has joined #ubuntu | ||
| gnomefreak | ff1.6 is here http://ftp.mozilla.org/pub/mozilla.org/firefox/nightly/latest-trunk/ | 02:44 |
| === kbrooks thinks eXistenZ doesnt exist | ||
| kbrooks | gnomefreak, bullshit | 02:45 |
| CrocoJet | does anyone knows how to setup GDM to inicialize in 1024x768 ? Because it is 1600x1200 | 02:45 |
| === Mixx [i=mixx@d60-65-201-134.col.wideopenwest.com] has joined #ubuntu | ||
| === eXistenZ pokes kbrooks | ||
| kbrooks | gnomefreak, er | 02:45 |
| kbrooks | gnomefreak, srry | 02:45 |
| guest | _jason: I ran it. It is complete... | 02:45 |
| bimberi | useruser: np :) | 02:45 |
| === NCLife is now known as NCLife_ | ||
| TankEnMate | Croco: dpkg-reconfigure xserver-xorg | 02:45 |
| guest | _jason: should it work now? | 02:45 |
| gnomefreak | kbrooks: what is? | 02:45 |
| chris | should ubuntu automaticaly beable to detect my XP system? | 02:45 |
| _jason | guest: and no ``couldn't stat'' errors right? | 02:45 |
| gnomefreak | i only have xfce and gnome | 02:45 |
| CrocoJet | new release firefox ? | 02:45 |
| _jason | or warnings as they may be... | 02:46 |
| guest | _jason: let me check... | 02:46 |
| === Soder [i=Soder@c-6e0a72d5.07-396-76786a1.cust.bredbandsbolaget.se] has left #ubuntu [] | ||
| chris | 2.0? | 02:46 |
| gnomefreak | CrocoJet: 1.6 adn 2.0 neither have been released they are both alpha | 02:46 |
| CrocoJet | oh ok, thanks | 02:46 |
| Arrick | Morning everybody | 02:46 |
| === M|xx [i=mixx@d60-65-201-134.col.wideopenwest.com] has joined #ubuntu | ||
| CrocoJet | gnomefreak, do you have idea how to setup GDM resolution ? | 02:46 |
| chris | its 10:47pm... | 02:46 |
| Nolt | who of u was compiling the firefox2alpha ? | 02:46 |
| TankEnMate | Croco: gdm doesnt set up the resolution, the Xserver does | 02:47 |
| Arrick | chris, its 7:46 where I am | 02:47 |
| TankEnMate | Croco: hence why you need to reconfigure your Xserver | 02:47 |
| chris | you probably arn't in australia then... | 02:47 |
| Arrick | am | 02:47 |
| gnomefreak | ubotu tell CrocoJet about fixres | 02:47 |
| useruser | bimberi: wow, not so easy | 02:47 |
| === vitriol [n=vitriol@pool-71-124-124-25.chi01.dsl-w.verizon.net] has joined #ubuntu | ||
| CrocoJet | ah .. because it is starting with 1600x1200 ... after login .. change to gnome resolution, in my case, 1024x768 | 02:47 |
| guest | _jason: Sir. None... | 02:47 |
| CrocoJet | thanks .. | 02:48 |
| TankEnMate | Croco: set your default resoluiotn for X to be the one you want for GDM, then change the resolution for your user login via the System -> Preferences -> Screen Resolution | 02:48 |
| === Lorvija [n=lorvija@dsl-lprgw5-fecdf900-132.dhcp.inet.fi] has joined #ubuntu | ||
| === LeeJunFan_ is now known as LeeJunFan | ||
| bimberi | useruser: no? i haven't actually read it myself. I did look at the howto's on remastering knoppix once though and that looked like heavy going | 02:48 |
| chris | can wine play windows games faster then windows can? (ie - hl2, oblivion) | 02:48 |
| === vitriol [n=vitriol@pool-71-124-124-25.chi01.dsl-w.verizon.net] has left #ubuntu ["Leaving"] | ||
| === Mixx [i=mixx@d60-65-201-134.col.wideopenwest.com] has joined #ubuntu | ||
| TankEnMate | anyone know how to debug udev? | 02:48 |
| === TuxAtWork [n=alvaro@r201-217-183-33.dialup.adsl.anteldata.net.uy] has joined #ubuntu | ||
| _jason | guest: great. Now that thing you pasted tells me that the package called gksu somehow is not installed. I don't know how that happened, but you can install it again. You could use synaptic, but we are just going to use the command line. The command 'sudo aptitude install gksu' should install it | 02:48 |
| gnomefreak | is mplayer-386 the gui version of mplayer? | 02:48 |
| === gomez_ [n=gomez@host156-214.pool876.interbusiness.it] has joined #ubuntu | ||
| === MenZa [i=MenZa@0x50a1601e.kd4nxx12.adsl-dhcp.tele.dk] has joined #ubuntu | ||
| === gomez_ [n=gomez@host156-214.pool876.interbusiness.it] has left #ubuntu ["Sto] | ||
| _jason | gnomefreak: one of them | 02:49 |
| kleinlappies | hi there | 02:49 |
| gnomefreak | ok | 02:49 |
| === tRSS [n=asiddiqu@202.174.142.2] has joined #ubuntu | ||
| === Pratico [n=csvteles@200.141.116.120] has left #ubuntu ["Fui] | ||
| === Hawk|- [n=Hawk@p549C87F4.dip0.t-ipconnect.de] has joined #ubuntu | ||
| === Nookie^ [n=mensur@h12n1fls32o1010.telia.com] has joined #ubuntu | ||
| === Nolt slucha - AudioTrack 13 (05:34) | ||
| guest | _jason: it is asking for a cd. | 02:49 |
| _jason | gnomefreak: mplayer-nogui is the only one without a gui I think | 02:49 |
| guest | _jason: do I enter the installation CD?? | 02:49 |
| chris | ubuntu wont automaticaly see my windows shears, any help/tips/ideas? | 02:50 |
| _jason | guest: well we can tell it not to use the cd if you prefer and then it will never bother you for the cd again when you install. Want to do that? | 02:50 |
| === milan [n=milan@82-171-215-108.dsl.ip.tiscali.nl] has joined #ubuntu | ||
| gnomefreak | _jason: i was thinking either mplayer-arch or mozilla-mplayer was text based | 02:50 |
| guest | _jason: let's do that. | 02:50 |
| === [SEAWOLF] [n=seawolf@host166-57.pool8261.interbusiness.it] has joined #ubuntu | ||
| chris | can i put ubuntu into memory and run it from there? | 02:50 |
| === hatake_kakashi [n=meh@60-241-3-116.tpgi.com.au] has joined #ubuntu | ||
| Arrick | chris, do you mean run it from ram? | 02:51 |
| === zenmac [n=zenwhen@h153.202.28.71.ip.alltel.net] has joined #ubuntu | ||
| chris | thats what i mean | 02:51 |
| Arrick | ok | 02:51 |
| guest | -jason: Sir, how do I tell it not to use the cd? | 02:52 |
| === Fergy [n=Fergy@a82-92-232-156.adsl.xs4all.nl] has joined #ubuntu | ||
| tRSS | Hey guys, I have quick question. I am installing Mac OS X and Ubuntu 5.10 on the same HDD. My partitions are: hda1-OSX, hda2-Ubuntu, hda5-Swap. I installed OS X first and then Ubuntu. I thought grub would be able to boot OS X | 02:52 |
| chris | but my question was basicaly if it was possible | 02:52 |
| === sylvain__ [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has joined #ubuntu | ||
| tRSS | Hey guys, I have quick question. I am installing Mac OS X and Ubuntu 5.10 on the same HDD. My partitions are hda1-OSX, hda2-Ubuntu, hda5-Swap. I installed OS X first and then Ubuntu. I thought grub would be able to boot OS X | 02:52 |
| Arrick | just wanted to clarify,, some people mean hard drive when yo say memory, becuase they r uneducted | 02:52 |
| _jason | guest: ok I'll try to guide you through the gui. My instructions may be wrong... so if something doesn't make sense just tell me, system > administration > synaptic. Settings > Repositories. Disable the cdrom repository. (You may need to click on settings and check on ``show diabled software sources'') | 02:52 |
| === p01n7 [n=p01n7@mctnnbsa31w-156034251238.nb.aliant.net] has joined #ubuntu | ||
| Arrick | Im nt sure | 02:52 |
| Arrick | trss | 02:52 |
| chris | oh, i should of said RAM. | 02:53 |
| tRSS | Arrick: Yes sir? | 02:53 |
| === jeddy3 [n=mattias@81-234-85-40-o1122.telia.com] has joined #ubuntu | ||
| guest | _jason: Actually, Sir, the CD seems to be working fine. ;) | 02:53 |
| Arrick | tRSS, it should be able to | 02:53 |
| _jason | guest: well yes, it would. But it may be hassle to use everytime you need to install things :) | 02:53 |
| === mrtwister|mobile [n=andrius@cable-10-68.cgates.lt] has joined #ubuntu | ||
| guest | _jason: IT WORKED!!! YOU ARE A GENIUS!!! THANK YOU!! | 02:53 |
| tRSS | Arrick: At boot time, Grub just gives 3 options , 2 of which are for Ubuntu and one for memtest | 02:53 |
| _jason | guest: great | 02:53 |
| guest | _jason: one last queston... | 02:54 |
| === randym [n=RandyMet@oucs-randy.oucs.ox.ac.uk] has joined #ubuntu | ||
| guest | _jason: sorry for the bother.... | 02:54 |
| Arrick | ouch | 02:54 |
| _jason | guest: no bother, just go ahead and ask | 02:54 |
| guest | _jason: how do I configure Ubuntu to start with the GUI by default?? | 02:54 |
| Arrick | tRSS, ask _jason your question, he's pretty good | 02:54 |
| chris | opposed to the console? | 02:54 |
| Seveas | guest, that IS the default... what did you change? | 02:55 |
| === Plitskin[2] [n=Plitskin@203.87.203.214] has joined #ubuntu | ||
| guest | Seveas: Ha! I have no idea.... | 02:55 |
| === mode/#ubuntu [-o Seveas] by Seveas | ||
| === sylvain__ [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has left #ubuntu ["Quitte"] | ||
| tRSS | _jason: Hi. My grub doesn't recognize OS X. I installed OSX first and then Ubuntu, thinking that grub would be able to recognize OS X | 02:55 |
| === babo [n=babo@220.94.104.5] has left #ubuntu ["Leaving"] | ||
| === joonas [n=jonpe@a81-197-157-145.elisa-laajakaista.fi] has joined #ubuntu | ||
| Seveas | tRSS, on mac systems yaboot is installed instead of grub iirc | 02:56 |
| _jason | tRSS: no need to address me. I don't use macs so I don't know | 02:56 |
| === jhaa [n=juha@dsl-aur-fe92dd00-143.dhcp.inet.fi] has joined #ubuntu | ||
| Arrick | guest you must have removed the gdm line somewhere, thats how I turned it off so the gui didnt boot on default | 02:56 |
| tRSS | Seveas: it is not a mac system. It is an OSX installation on intel hardware | 02:56 |
| Seveas | ah right | 02:56 |
| chris | can somone direct me to where I can find information reguarding connecting ubuntu to XP (with out the use of samba)? | 02:56 |
| guest | Arrick: how do I fix this, Sir? | 02:56 |
| Arrick | _jason OSX is a XP changover that allows your xp machine to look like a mac | 02:57 |
| Seveas | I think the installer needs to be patched for that | 02:57 |
| Arrick | !samba | 02:57 |
| ubotu | somebody said samba was https://wiki.ubuntu.com/SettingUpSamba or https://wiki.ubuntu.com/MountWindowsSharesPermanently | 02:57 |
| _jason | guest: sudo dpkg-reconfigure gdm, I believe will get gdm to start again | 02:57 |
| Arrick | chris, the samba link was for you | 02:57 |
| Arrick | _jason, thanks | 02:58 |
| === nsmith [n=nsmith@195.8.2.236] has joined #ubuntu | ||
| tRSS | Is there a way to modify grub to point it to OS X partition? Something similar to boot.ini in windows? | 02:58 |
| chris | yeah, is it possible to network *without* samba? | 02:58 |
| === sHaDe [n=sHaDe@host117-235.pool875.interbusiness.it] has joined #ubuntu | ||
| IdleOne | chris, you could use ssh | 02:58 |
| Arrick | I know you or brenner helped me with that one | 02:58 |
| Plitskin[2] | Uhmm... Is there any issue with Linux regarding LAN support as much as MODEMs do? | 02:58 |
| === brenner [n=brenner@144.134.159.192] has joined #ubuntu | ||
| guest | _jason: oh no....it returned: sudo dpkg-reconfigure gdm | 02:58 |
| Seveas | tRSS, if you know how to boot osX with it, you can simply edit /boot/grub/menu.lst | 02:58 |
| === Plitskin[2] is now known as Plitskin | ||
| chris | awesome, ssh it is. (runs to google, cya in a bit) | 02:58 |
| === abarbaccia [n=andrew@c-24-91-115-239.hsd1.ma.comcast.net] has joined #ubuntu | ||
| guest | _jason: no, it returned: gdm is broken or not fully installed | 02:58 |
| Arrick | morning brenner | 02:58 |
| nsmith | I have installed W32 codecs but when I play mpeg files on Totem player the quality is poor. Any suggestions? | 02:58 |
| === Seatux [n=Seatux@219.95.202.74] has joined #ubuntu | ||
| === Exposure [n=Exposure@a196215.upc-a.chello.nl] has joined #ubuntu | ||
| brenner | Arrick: one minute too soon...only 23:59 here :) | 02:59 |
| Arrick | hah | 02:59 |
| brenner | nsmith: what do you mean by poor? | 02:59 |
| gnomefreak | nsmith: totem-xine but not sure if it will fix your issue i know totem-xine works better here than totem though | 02:59 |
| === griz [n=griz@koffer.ram.RWTH-Aachen.DE] has joined #ubuntu | ||
| nsmith | it seems to be really brite | 03:00 |
| === pierre- [n=pierre@ip73.168.adsl.wplus.ru] has joined #ubuntu | ||
| brenner | nsmith: and what app is this? | 03:00 |
| nsmith | and very pixalated at times | 03:00 |
| _jason | guest: sudo aptitude reinstall gdm | 03:00 |
| Arrick | heh, _jason is helping chris out with a problem, you or him helped me fix it the other day, he is defaulting into terminal and wants gnome gui to be default | 03:00 |
| === saloxin_ [i=helvete@83.84-48-74.nextgentel.com] has joined #ubuntu | ||
| Arrick | ouch | 03:00 |
| nsmith | brenner: Totem for playing videos | 03:00 |
| === Mortuis [n=jmort@bi-02pt1.bluebird.ibm.com] has joined #ubuntu | ||
| === hyphenated [n=cgilmour@222-152-208-118.jetstream.xtra.co.nz] has joined #ubuntu | ||
| === traveller2k is now known as traveller | ||
| guest | _jason: this was the output: * Reloading GNOME Display Manager configuration... * Changes will take effect when all current X sessions have ended. | 03:02 |
| guest | invoke-rc.d: initscript gdm, action "reload" failed. | 03:02 |
| nsmith | gnomefreak: where would i find totem-xine | 03:02 |
| === enkrav [n=enkrav@d213-102-119-97.cust.tele2.at] has joined #ubuntu | ||
| gnomefreak | nsmith: i think its in universe repo but you can sudo apt-get install totem-xine | 03:03 |
| guest | _jason: that was the ouput for: dpkg-reconfigure gdm | 03:03 |
| brenner | Arrick: was your last post dorected to me? | 03:03 |
| gnomefreak | !info totem-xine | 03:03 |
| ubotu | totem-xine: (A simple media player for the Gnome desktop based on xine), section universe/gnome, is optional. Version: 1.2.0-0ubuntu3 (breezy), Packaged size: 776 kB, Installed size: 4492 kB | 03:03 |
| brenner | directed even | 03:03 |
| nsmith | gnomefreak: thanks | 03:03 |
| gnomefreak | nsmith: yeah its in the universe repo | 03:03 |
| _jason | guest: did the reinstall proceed without incident? | 03:03 |
| Arrick | yeah sorry | 03:04 |
| guest | _jason: Yes, Sir. | 03:04 |
| Arrick | brenner, yeah | 03:04 |
| === randym [n=RandyMet@oucs-randy.oucs.ox.ac.uk] has left #ubuntu ["Leaving"] | ||
| === highvolt1ge [n=Jono@196.36.161.235] has joined #ubuntu | ||
| brenner | Arrick: no worries. anyway, _jason is a lot more capable than me. i'll leave it to him :P | 03:04 |
| Arrick | ok | 03:04 |
| Arrick | thanks | 03:04 |
| chris | quick q. does WINE run (windows) games faster in ubuntu then windows. | 03:05 |
| Arrick | brenner, you get my pm? | 03:05 |
| void^ | chris: no. | 03:05 |
| chris | okay, thanks | 03:05 |
| _jason | guest: ok I think dpkg failed because you didn't use sudo? No matter, you shouldn't need to run it. The reinstall should set it up. Try rebooting | 03:05 |
| === thefish [n=thefish@unaffiliated/thefish] has joined #ubuntu | ||
| brenner | Arrick: apparently not | 03:05 |
| guest | _jason: yes, sir. Again. Thank you. ;) | 03:05 |
| === M|xx [i=mixx@d60-65-201-134.col.wideopenwest.com] has joined #ubuntu | ||
| Arrick | brenner, i resent, hopefully winxchat sends it through | 03:06 |
| === nickrud [n=aias@ppp-70-250-225-194.dsl.hstntx.swbell.net] has joined #ubuntu | ||
| === pitti [n=pitti@ubuntu/member/pitti] has joined #ubuntu | ||
| brenner | Arrick: nope, nothing. are you registered? | 03:06 |
| Arrick | I thought so, I've sent pms before in here | 03:07 |
| Arrick | how do I check | 03:07 |
| Arrick | !register | 03:07 |
| ubotu | Information about registering your Freenode nick is at http://freenode.net/faq.shtml#contents-userregistration | 03:07 |
| === MetaMorfoziS [n=sajt@dsl54009EBE.pool.t-online.hu] has joined #ubuntu | ||
| brenner | Arrick: you can always just use /notice | 03:08 |
| === Profichilla [n=jakob@p548DAB91.dip0.t-ipconnect.de] has joined #ubuntu | ||
| Arrick | to send you a pm? | 03:08 |
| _jason | Arrick: you aren't identified. You could /msg me because I disabled blocking of unregistered users | 03:09 |
| Arrick | ok | 03:09 |
| === isilzha is now known as Isil`Zha | ||
| phreak97 | where do i go to set up keyboard shortcuts in kde? | 03:09 |
| Arrick | I would like to register though | 03:09 |
| brenner | Arrick: why are you using windows anyway? | 03:09 |
| === |mp| [n=mp@200.124.226.251] has joined #ubuntu | ||
| === syndicate [n=syndicat@dsl-145-196-122.telkomadsl.co.za] has joined #ubuntu | ||
| Arrick | I have a dual boot, adn windows xp is what I work with everyday | 03:10 |
| brenner | ah | 03:11 |
| void^ | ... | 03:11 |
| === joonas [n=jonpe@a81-197-157-145.elisa-laajakaista.fi] has left #ubuntu [] | ||
| udk | chris: we're not a warez channel | 03:11 |
| udk | err | 03:12 |
| === tRSS [n=asiddiqu@202.174.142.2] has joined #ubuntu | ||
| udk | ChristmasCpp: | 03:12 |
| === nalioth_zZz is now known as nalioth | ||
| thoreauputic | erm ChristmasCpp watch your step here... | 03:12 |
| Arrick | brenner, man I just tried the /msg NickServ register <password> and it said I am already registered, so I dont know what is up. | 03:12 |
| brenner | Arrick: like _jason said, you need to identify | 03:12 |
| brenner | Arrick: /msg nickserv identify <pswd> | 03:12 |
| === highvolt1ge is now known as highvoltage | ||
| Arrick | ok | 03:13 |
| ompaul | ChristmasCpp, we have great software sitting on web servers for free everywhere | 03:13 |
| Arrick | ok | 03:13 |
| brenner | phreak97: might want to try #kubuntu or #kde | 03:13 |
| thoreauputic | ChristmasCpp: CTCP ing the whole channel like that isn't acceptable, sorry | 03:13 |
| === bender888 [n=bender_8@CPE-58-168-229-24.vic.bigpond.net.au] has joined #ubuntu | ||
| Arrick | brenner, i though i was, i set it to do that by default, but i forgot i exited last night, and didnt do that this morning | 03:14 |
| Arrick | ha | 03:14 |
| pierre- | how can i import all my Firefox extensions, prefs and so on from windows? | 03:14 |
| LeeJunFan | sometime around 9pm est last night us.archive... doesn't have Packages files for dapper any more? | 03:14 |
| === rikai_ [i=rikai@pool-72-65-105-242.ptldme.east.verizon.net] has joined #ubuntu | ||
| === mode/#ubuntu [+o Seveas] by ChanServ | ||
| === mode/#ubuntu [+b ChristmasCpp!*@*] by Seveas | ||
| === RomanK [n=roman@p54A27455.dip.t-dialin.net] has joined #ubuntu | ||
| erikl | how to I get h.264? | 03:16 |
| === rob_p [n=rob@pdpc/supporter/active/rob-p] has joined #ubuntu | ||
| erikl | do* | 03:18 |
| === dosser [n=virus@nc-71-54-45-50.dhcp.sprint-hsd.net] has joined #ubuntu | ||
| pierre- | !firefox | 03:18 |
| IdleOne | !ff1.5 | 03:18 |
| ubotu | You can use firefox 1.5 by following this wiki page https://wiki.ubuntu.com/FirefoxNewVersion | 03:18 |
| === Shadowpillar [n=Shadow@global-66-81-104-21.dialup.o1.com] has joined #ubuntu | ||
| TankEnMate | so i take it there are no udev hackers about? | 03:19 |
| === jinxi [n=jinxi@c3eea3080.cable.wanadoo.nl] has joined #ubuntu | ||
| === jeddy3 [n=mattias@81-234-85-40-o1122.telia.com] has joined #ubuntu | ||
| === peibol [n=peibol@23.Red-81-36-135.dynamicIP.rima-tde.net] has joined #ubuntu | ||
| abarbaccia | hey all - if you put your computer to sleep and you have a cron job scheduled, will it wake up and preform the task | 03:21 |
| === jinxi is now known as ubuntuuser | ||
| ubuntuuser | I have osme kernel modules laoded here by default | 03:22 |
| ubuntuuser | how do I remove them?? | 03:22 |
| ubuntuuser | I don't want them to load when the pc start | 03:22 |
| === Tidus [n=tidus@unaffiliated/tidus] has joined #ubuntu | ||
| === ana [n=ana@80-41-85-0.dynamic.dsl.as9105.com] has joined #ubuntu | ||
| === Nookie^ [n=mensur@h12n1fls32o1010.telia.com] has joined #ubuntu | ||
| === rikai_ is now known as rikai | ||
| theD3viL | when i wanna stream with mozilla-plugin (mplayer-plguin) mplayer opens twice! Why? | 03:24 |
| LeeJunFan | abarbaccia: no. | 03:25 |
| chris | so you can watch the movie twice | 03:25 |
| === Versed [n=Versed@static-68-236-210-77.nwrk.east.verizon.net] has joined #ubuntu | ||
| === Jemt [n=Jimmy@nat.kollegienet.dk] has joined #ubuntu | ||
| Jemt | Greetz. How do I disable auto completion of words in Open Office? It is really annoying | 03:25 |
| === Tidus [n=tidus@unaffiliated/tidus] has joined #ubuntu | ||
| theD3viL | chris, no, it covers, so it lagging | 03:26 |
| === G0SUB [n=ghoseb@ubuntu/member/g0sub] has joined #ubuntu | ||
| === chmod775 [n=chmod775@59.92.137.67] has joined #ubuntu | ||
| chmod775 | is their any cisco vpn client for ubuntu linux ? | 03:28 |
| === WolfLaptop [n=wolf@213.196.14.254] has joined #ubuntu | ||
| === sexcopter8000m [n=NNSCRIPT@dslb-082-083-214-140.pools.arcor-ip.net] has joined #ubuntu | ||
| Arrick | what is a good html editor for ubuntu? | 03:29 |
| === KenSentMe [n=root@a82-92-80-8.adsl.xs4all.nl] has joined #ubuntu | ||
| m0r0n | Is it possible to reconfigure the alsa mixer. I only can hear the right channel of stereo files | 03:29 |
| === MenZa`FarCry [i=MenZa@0x50a1601e.kd4nxx12.adsl-dhcp.tele.dk] has joined #ubuntu | ||
| thoreauputic | Arrick: wysiwyg? | 03:30 |
| === ompaul thinks about posting vim but instead does this | ||
| ompaul | Arrick there are many, bluefish is not bad | 03:30 |
| thoreauputic | Arrick: nvu or mozilla-composer for wysiwyg | 03:30 |
| Arrick | yeah, or even the text version thoreauputic | 03:31 |
| === MenZa`FarCry is now known as MenZa | ||
| m0r0n | Volume Control: SBLive! [CT4620] (Alsa Mixer) | 03:31 |
| thoreauputic | ed! ed is the editor! man ed! | 03:31 |
| thoreauputic | *grin* | 03:31 |
| Jemt | I found the answer here : http://nowacki.org/blog/2004/05/disable_autocomplete_in_openoffice.html | 03:31 |
| === Jemt [n=Jimmy@nat.kollegienet.dk] has left #ubuntu ["Leaving"] | ||
| Bakgat | hi. i'm back. can anyon pls help me with my server's setup. I'm having trouble with networking & need to trace source of issue | 03:31 |
| chris | where can i find putty so i can use ssh for windows? | 03:31 |
| chmod775 | cisco vpn client? | 03:31 |
| === sexcopter8001m [n=NNSCRIPT@dslb-082-083-214-140.pools.arcor-ip.net] has joined #ubuntu | ||
| Arrick | duh I think im stupid, man I didnt think til now of text editor, duh thoreauputic | 03:32 |
| Bakgat | pls pick up in private conversation | 03:32 |
| ompaul | Arrick, nano is not bad as a text edtor | 03:32 |
| chmod775 | chris, google for putty | 03:32 |
| === carbo [n=justin@cm148.gamma237.maxonline.com.sg] has joined #ubuntu | ||
| thoreauputic | Arrick: heh - well text editor wars are always fun.... | 03:32 |
| chris | ok | 03:32 |
| ompaul | yes but | 03:32 |
| ompaul | !offtopic | 03:32 |
| ubotu | Non Ubuntu support related discussions may be carried out in the channel #ubuntu-offtopic. Editor/Language wars are welcome there! | 03:32 |
| thoreauputic | ompaul: ah, ubotu is no fun any more :( | 03:33 |
| chmod775 | ompaul, hi remember | 03:33 |
| chmod775 | me | 03:33 |
| === jinxi_ [n=jinxi@h8441153081.dsl.speedlinq.nl] has joined #ubuntu | ||
| chmod775 | ompaul, is there any vpn client which supports cisco | 03:33 |
| chmod775 | ? | 03:33 |
| TuxAtWork | I had to kill the apt process and now the db is blocked | 03:33 |
| Bakgat | ompaul; been out 4 while. can we pick up sideboard discussion if u don't mind | 03:33 |
| TuxAtWork | how can I force it to unlock it? | 03:34 |
| thoreauputic | TuxAtWork: try sudo dpkg --configure -a | 03:34 |
| ompaul | chmod775, no idea | 03:34 |
| gnomefreak | TuxAtWork: i fixed it by rebooting | 03:34 |
| chmod775 | ok | 03:34 |
| === tswiah [n=yaroslav@213.186.206.55] has joined #ubuntu | ||
| ompaul | Bakgat, side chats in #ubuntu-offtopic | 03:34 |
| gnomefreak | thoreauputic: that didnt work for me :( | 03:34 |
| TuxAtWork | it says it is still blocked by another process | 03:34 |
| === we2by_ [n=we2by@h8441153081.dsl.speedlinq.nl] has joined #ubuntu | ||
| === gnomefreak fought with that for 3 hours | ||
| Bakgat | no, i mean still system related | 03:34 |
| Arrick | how about pm ompaul? for side chats | 03:34 |
| gnomefreak | TuxAtWork: you trying to get updates? | 03:35 |
| we2by_ | my gnome starts very slow here | 03:35 |
| ompaul | Arrick, quick way not to have a conversation | 03:35 |
| thoreauputic | Arrick: only if the person agrees to pm | 03:35 |
| TuxAtWork | gnomefreak, I was trying to remove a package | 03:35 |
| we2by_ | where can I read the gnome error messages?? | 03:35 |
| thoreauputic | !msg | 03:35 |
| ubotu | please don't /msg people or start a personal message/ dcc chat without asking first in channel. People might be busy, and you have a better chance of an answer in the channel. Don't assume a particular user will be able to help you. | 03:35 |
| === Brendon [n=Brendon@c-66-176-244-24.hsd1.fl.comcast.net] has joined #ubuntu | ||
| TuxAtWork | gnomefreak, it kind of frozen (was like doing nothing for several minutes) so I killed it | 03:35 |
| === bender888 [n=bender_8@CPE-58-168-229-24.vic.bigpond.net.au] has left #ubuntu ["Leaving"] | ||
| we2by_ | gnomefreak, u ogtta help me ;) | 03:35 |
| gnomefreak | TuxAtWork: ok reboot and when you log back in go directly to term and remove the package that should help you | 03:35 |
| Arrick | ok | 03:36 |
| ifr | Anyone using EVDO under Breezy? | 03:36 |
| === x86-64 [n=me@cpe-24-27-59-232.austin.res.rr.com] has joined #ubuntu | ||
| === _isilzha [n=isilzha@155.69.163.149] has joined #ubuntu | ||
| TuxAtWork | gnomefreak, rebooting is suppossed to be not necessary | 03:36 |
| === prada [n=pradosh@220.225.32.98] has joined #ubuntu | ||
| gnomefreak | we2by_: i can try to help you but without knowing the issue i would say i cant really help | 03:36 |
| ifr | I mean, besides me? I have tCP window sizing problems and wonder if anyone else has tackled these | 03:36 |
| === Aidamina [n=aa@cc247812-a.roden1.dr.home.nl] has joined #ubuntu | ||
| gnomefreak | TuxAtWork: i know that im telling you how i fixed it you have 2 x's running | 03:36 |
| === theine [n=theine@fw2.nbi.dk] has joined #ubuntu | ||
| === PSIplus [n=psiplus@chello062178223058.13.15.vie.surfer.at] has joined #ubuntu | ||
| PSIplus | hi | 03:37 |
| gnomefreak | atleast i did | 03:37 |
| we2by_ | where does gnome put its log files? | 03:37 |
| TuxAtWork | gnomefreak, I know it'd work, but I can't reboot now, so that's why I'm asking for another solution | 03:37 |
| gnomefreak | we2by_: /var/log/something | 03:37 |
| TuxAtWork | but thanks anyway, gnomefreak | 03:37 |
| === phreak97 [n=phreak97@ppp223-64.lns2.adl4.internode.on.net] has joined #ubuntu | ||
| gnomefreak | TuxAtWork: there isnt one that i know of | 03:37 |
| brenner | we2by_: what are your system specs? | 03:37 |
| PSIplus | i have kubuntu breezy amd64 and created a chroot-environment with kubuntu breezy i386 for firefox (flash ;-) ) ... It works pretty well, but I got one problem: | 03:37 |
| PSIplus | flash doesn't render text... | 03:38 |
| theine | Hi, how come I'm able to launch a nested Xgl session but not a stand-alone one? In the latter case, the X server crashes before I reach the login screen | 03:38 |
| Arrick | log out to terminal TuxAtWork | 03:38 |
| we2by_ | Brendon, amd 64 3700+ | 03:38 |
| x86-64 | rats... person helping me last night isn't here, was gonna tell them thanks... had a fresh install of ubuntu 5.10 on my powerbook, logged into gnome from gdm, got just a brown background and a mouse cursor... found out that xorg.conf was using /dev/psaux instead of /dev/input/mice for the synaptic touchepad device | 03:38 |
| gnomefreak | theine: please join #ubuntu-xgl for xgl issues | 03:38 |
| PSIplus | flash works as usual but no text... what package/library could be missing? | 03:38 |
| x86-64 | the person told me to check the logs and that's how I found out about the mouse | 03:38 |
| theine | gnomefreak: alright, will do | 03:38 |
| Arrick | x86-64, whats the guys name? | 03:39 |
| _jason | PSIplus: gsfonts, gsfonts-x11 possibly | 03:39 |
| PSIplus | aaaah | 03:40 |
| === brenner [n=brenner@144.134.159.192] has left #ubuntu ["Leaving"] | ||
| PSIplus | _jason, I'll try | 03:40 |
| === anchacon [n=anchacon@83.230.235.164] has joined #ubuntu | ||
| anchacon | hola | 03:41 |
| x86-64 | Arrick: cariki or something like that | 03:41 |
| Arrick | he'll be on in about 2 hours | 03:41 |
| x86-64 | ah ok, well I have to go to work soon, so maybe I can tell him another time | 03:42 |
| x86-64 | thanks for the info though | 03:42 |
| Arrick | ok later | 03:42 |
| anchacon | hola | 03:42 |
| Arrick | !es | 03:42 |
| ubotu | Hispanohablantes: Por favor usen #ubuntu-es, #kubuntu-es o #edubuntu-es, alli obtendran mas ayuda. | 03:42 |
| chmod775 | !india | 03:42 |
| ubotu | chmod775: Do they come in packets of five. Try searching at http://ubuntu.cc.com.au/ | 03:42 |
| anchacon | hola | 03:42 |
| chmod775 | !drapper | 03:42 |
| ubotu | I don't know, try searching at http://ubuntu.cc.com.au/, chmod775 | 03:42 |
| === EasilyOdd [n=EO@167.7.130.21] has joined #ubuntu | ||
| anchacon | hola | 03:43 |
| Arrick | !es | 03:43 |
| ubotu | Hispanohablantes: Por favor usen #ubuntu-es, #kubuntu-es o #edubuntu-es, alli obtendran mas ayuda. | 03:43 |
| xstation | Xenguy: are you here | 03:43 |
| Arrick | hi anchacon whats your question? | 03:43 |
| we2by_ | is the latest gnome stanle available for ubuntu 5.10 ? | 03:43 |
| we2by_ | stable | 03:43 |
| anchacon | are you here you | 03:44 |
| Arrick | yes | 03:44 |
| Arrick | we2by_,yes | 03:44 |
| === shaa-gi [n=shaggy@cpe-66-68-32-156.austin.res.rr.com] has joined #ubuntu | ||
| anchacon | my lengich is espanis | 03:44 |
| we2by_ | Arrick, also for amd 64? | 03:44 |
| kleinlappies_ | bluetooth remote? pls | 03:44 |
| Arrick | !es | 03:44 |
| ubotu | Hispanohablantes: Por favor usen #ubuntu-es, #kubuntu-es o #edubuntu-es, alli obtendran mas ayuda. | 03:44 |
| PSIplus | !austria | 03:44 |
| ubotu | parse error: Try searching at http://ubuntu.cc.com.au/, PSIplus | 03:44 |
| PSIplus | !at | 03:44 |
| ubotu | PSIplus: My cat's name is Mittens! Try searching at http://ubuntu.cc.com.au/ | 03:44 |
| === possie_ [n=Possie@cp19535-a.dbsch1.nb.home.nl] has joined #ubuntu | ||
| PSIplus | !de | 03:45 |
| ubotu | Deutschsprachige Hilfe fuer Probleme mit Ubuntu und Kubuntu finden Sie in den Kanaelen #ubuntu-de resp. #kubuntu-de | 03:45 |
| PSIplus | lol | 03:45 |
| === prabu [n=prabu@219.95.161.32] has joined #ubuntu | ||
| Arrick | anchacon, check into the other page | 03:45 |
| === prabu [n=prabu@219.95.161.32] has left #ubuntu ["Leaving"] | ||
| === Nookie^ [n=mensur@h12n1fls32o1010.telia.com] has joined #ubuntu | ||
| === bobd [n=bdgoodso@dhcp1-66-244-84-223.stfd.smithvilledsl.net] has left #ubuntu [] | ||
| kleinlappies_ | any info on kde and bluetooth remote | 03:45 |
| === lwelyn [n=lwelyn@p549A664F.dip.t-dialin.net] has joined #ubuntu | ||
| Arrick | PSIplus, leave the bot alone, I was trying to get a spanish speaking person to the right page | 03:46 |
| Arrick | !bluetooth | 03:46 |
| ubotu | [bluetooth] https://wiki.ubuntu.com/BluetoothSetup and https://wiki.ubuntu.com/BluetoothRemote | 03:46 |
| we2by_ | how do I upgrade gnome to the latest stable? | 03:46 |
| gnomefreak | we2by_: you cant have 2.14 on breezy | 03:46 |
| PSIplus | Arrick, sorry, just didn't realize that the bot could do this | 03:46 |
| kleinlappies_ | thanks Arrick | 03:46 |
| we2by_ | why not? | 03:47 |
| gnomefreak | we2by_: it depends on things breezy doesnt have | 03:47 |
| Arrick | we2by_, make sure the guys know your on 64, so the right ones answer that can help | 03:47 |
| === jeddy3 [n=mattias@81-234-85-40-o1122.telia.com] has joined #ubuntu | ||
| gnomefreak | Arrick: with gnome 2.14 on 32 or 64 dont matter you can install it but its very likely it will bork your system | 03:47 |
| Arrick | gnomefreak, I was just trying to get him specific help, cause he asked me about 64, I don;t know much myself | 03:48 |
| gnomefreak | oh ok | 03:48 |
| Arrick | but thanks for the info | 03:49 |
| === tengus [n=tengus@host81-158-162-223.range81-158.btcentralplus.com] has joined #ubuntu | ||
| tengus | hi | 03:49 |
| anchacon | you spikin spanis | 03:49 |
| we2by_ | I dunno why gnome takes so much time to start | 03:50 |
| we2by_ | :( | 03:50 |
| tengus | When I try to install flashplayer-mozilla, it tells me that it cannot find the package. I have asked around for a solution and looked on several forums, but cannot find a working solution. | 03:50 |
| LadyNikon | we2by_: its laggy | 03:50 |
| we2by_ | where can I find gnome's log files? | 03:50 |
| Arrick | ubotu tell anchacon about !es | 03:50 |
| LadyNikon | we2by_: its gui intensive | 03:50 |
| LadyNikon | is what i mean | 03:50 |
| === mfuentes [n=mario@200.54.6.151] has joined #ubuntu | ||
| LadyNikon | i didnt even know that was spanish | 03:50 |
| LadyNikon | heh | 03:50 |
| we2by_ | LadyNikon, nope, I think there is something wrong with gnome | 03:50 |
| LadyNikon | we2by_: ah | 03:51 |
| Arrick | somebody send anchacon to the spanish page please, cause he/she doesnt see the ubotu poste when I send it | 03:51 |
| we2by_ | I have the same version on my other workstation running pentium 4 3.2 ghz and start pretty fast | 03:51 |
| we2by_ | and now, I have the same gnome verion on amd 64 3700+, it starts slow | 03:51 |
| === tane| [n=acid9871@hoas-fe2fdd00-242.dhcp.inet.fi] has joined #UBUNTU | ||
| tengus | does anyone here have any idea as to how I can sort it? | 03:51 |
| === tyler_ [i=1001@cm199.omega22.maxonline.com.sg] has joined #ubuntu | ||
| gnomefreak | anchacon: type /join #ubuntu-es | 03:52 |
| laffer-pt | I've got 2 pcs connected to a modem-router.. how do I access one another? | 03:52 |
| Arrick | laffer-pt, are they both running ubuntu? | 03:53 |
| laffer-pt | yeah | 03:53 |
| anchacon | no se lo que dices | 03:53 |
| Arrick | ask _jasin | 03:53 |
| Arrick | anchacon, you must not be speaking spanish very well | 03:54 |
| gnomefreak | anchacon: this is an english speaking channel please join #ubuntu-es | 03:54 |
| Shadowpillar | I hate you all who have faster computers than me :( | 03:54 |
| Shadowpillar | oh wait wrong chat | 03:54 |
| Shadowpillar | still | 03:54 |
| Shadowpillar | :( | 03:54 |
| Shadowpillar | if you cannot read this sentence, get out. | 03:54 |
| tengus | k | 03:54 |
| === tengus [n=tengus@host81-158-162-223.range81-158.btcentralplus.com] has left #ubuntu ["Leaving"] | ||
| laffer-pt | Arrick ask _jasin or _jason ? | 03:54 |
| === edith [n=edith@200.71.196.234] has joined #ubuntu | ||
| Shadowpillar | haha | 03:55 |
| laffer-pt | there's no _jasin | 03:55 |
| === neo911 [n=neo911@220-245-214-98-act.tpgi.com.au] has joined #ubuntu | ||
| Arrick | _jason | 03:55 |
| ompaul | Shadowpillar, please stop | 03:55 |
| === Vagistico [n=vago@63-135-246-201.adsl.terra.cl] has joined #ubuntu | ||
| === dang`r`us [n=eismann@zwiebel.inf.tu-dresden.de] has joined #ubuntu | ||
| dang`r`us | hi there | 03:55 |
| we2by_ | wth, I'm gonna install xfce | 03:55 |
| dang`r`us | on dapper, I've installed xfonts-artwiz, but these fonts don't show up in gimp's font selector. Why? | 03:55 |
| Shadowpillar | ompaul: it's a joke | 03:55 |
| laffer-pt | _jason how do I access the files on both computers? | 03:55 |
| === tengus [n=tengus@host81-158-162-223.range81-158.btcentralplus.com] has joined #ubuntu | ||
| === Dewi [n=dewi@203-206-119-140.dyn.iinet.net.au] has joined #ubuntu | ||
| dang`r`us | in fact, they're not in any font dialog either, as it seems | 03:56 |
| ompaul | Shadowpillar, reads more like a spam :-) | 03:56 |
| === thoreauputic_ [n=prospero@ubuntu/member/thoreauputic] has joined #ubuntu | ||
| tengus | When I try to install flashplayer-mozilla, it tells me that it cannot find the package. I have asked around for a solution and looked on several forums, but cannot find a working solution. | 03:56 |
| === tRSS [n=asiddiqu@202.174.142.2] has joined #ubuntu | ||
| Shadowpillar | ompaul: see? tengus came back | 03:57 |
| ompaul | Shadowpillar, :-) | 03:57 |
| gnomefreak | tengus: you need to enablke the right repos | 03:57 |
| gnomefreak | enable* | 03:57 |
| tRSS | Hey guys, which repositories should be used other than the default ones in Ubuntu 5.10 (breezy) | 03:57 |
| gnomefreak | !flash | 03:57 |
| ubotu | Installation & troubleshooting for Flash is covered in https://wiki.ubuntu.com/RestrictedFormats | 03:57 |
| gnomefreak | ^^^ | 03:57 |
| dang`r`us | Hm, seems I'm missing some font path entries. | 03:58 |
| === Malin` [n=Malin@cbg33.neoplus.adsl.tpnet.pl] has joined #ubuntu | ||
| dang`r`us | I'll look into this and come back when I can't solve it ... | 03:58 |
| === dang`r`us [n=eismann@zwiebel.inf.tu-dresden.de] has left #ubuntu [] | ||
| Shadowpillar | !ppc | 03:59 |
| Shadowpillar | !ubuntuppc | 03:59 |
| ubotu | it has been said that ppc is PowerPC. Macs, IBMs. Nicer than Intel. | 03:59 |
| ubotu | Shadowpillar: parse error: Try searching at http://ubuntu.cc.com.au/ | 03:59 |
| === pigo [n=pigo@host36-18.pool8259.interbusiness.it] has joined #ubuntu | ||
| pigo | hi | 03:59 |
| Shadowpillar | !quik | 03:59 |
| ubotu | Shadowpillar: No idea, try searching at http://ubuntu.cc.com.au/ | 03:59 |
| Shadowpillar | bah | 03:59 |
| pigo | i have problem | 03:59 |
| pigo | with task manager ubuntu | 03:59 |
| ifr | pigo, if you state the problem you might get help. If youwait for us to draw it out it could be a long wait | 03:59 |
| anchacon | no spikin english | 03:59 |
| ifr | All in one go, pigo, all in one go. | 03:59 |
| ompaul | Shadowpillar, what is the particular question you have? | 04:00 |
| tengus | thanks gnomefreak | 04:00 |
| pigo | i have italian | 04:00 |
| === linas_ [n=linas@adsl-81-7-91-207.takas.lt] has joined #ubuntu | ||
| ompaul | !it | 04:00 |
| ubotu | Vai su #ubuntu-it o su #kubuntu-it se vuoi parlare in italiano, in questo canale usiamo solo l'inglese. Grazie! | 04:00 |
| pigo | i am italian sorry | 04:00 |
| pigo | lo so ma li non sanno nulla | 04:00 |
| pigo | o meglio non rispondono | 04:00 |
| Arrick | pigo read above | 04:00 |
| ompaul | pigo /join #ubuntu-it may help | 04:00 |
| ifr | pigo, that was a robot telling you that, not one of us. Ciao | 04:01 |
| === avauntage [n=avauntag@219.142.137.178] has left #ubuntu [""] | ||
| === echoo [n=mauroue@softbank221045118152.bbtec.net] has joined #ubuntu | ||
| === BodhiBaum [n=Andreas@p50867A25.dip.t-dialin.net] has joined #ubuntu | ||
| === brosioz [n=brosioz@host77-237.pool878.interbusiness.it] has joined #ubuntu | ||
| === tengus [n=tengus@host81-158-162-223.range81-158.btcentralplus.com] has left #ubuntu ["Leaving"] | ||
| brosioz | help, nvtv works only with nv drivers ? or works also with nvidia ? nvtv doesn't recornise my 6600 videocards | 04:04 |
| === rambo3 [n=rambo3@c-bff871d5.027-6-6b73641.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| === fredforfaen [n=Morrari@216-132-165.0502.adsl.tele2.no] has joined #ubuntu | ||
| === beefsprocket [n=beefspro@74.12.74.94] has joined #ubuntu | ||
| === Cobain [n=cobain@ip72-192-74-62.ok.ok.cox.net] has joined #ubuntu | ||
| === beefsprocket [n=beefspro@74.12.74.94] has left #ubuntu ["left] | ||
| === thmas [n=thomas@i577BD0A4.versanet.de] has joined #ubuntu | ||
| LadyNikon | is there a channel for Qaers of ubuntu? | 04:05 |
| === veronique [n=veroniqu@81.241.226.140] has joined #ubuntu | ||
| apokryphos | LadyNikon: do you mean people with questions? | 04:06 |
| LadyNikon | apokryphos: no. | 04:07 |
| LadyNikon | people to qa it. | 04:07 |
| Seveas | LadyNikon, #ubuntu-bugs | 04:07 |
| neo911 | does gethostbyname put AF_INET to h_addrtype by default or does it depend on the parameter passed to it? thx | 04:08 |
| === tane| [n=acid9871@hoas-fe2fdd00-242.dhcp.inet.fi] has joined #UBUNTU | ||
| === possie_ is now known as possie | ||
| LadyNikon | Seveas: thanks | 04:10 |
| rambo3 | does doing you homework deppend on ubuntu | 04:10 |
| === din [n=din@din7.com] has joined #ubuntu | ||
| caglar__ | I want to install opera from the deb package on their site but dpkg sais xlib6g and xlibs is not installed. I cannot find such packages, anyone can help? | 04:11 |
| === greg_ [n=greg@ip-37-234.sn1.eutelia.it] has joined #ubuntu | ||
| === mxpxpod [n=BryanFor@unaffiliated/mxpxpod] has joined #ubuntu | ||
| neo911 | can i specificy a different path for installing pckges using synaptic? i.e. my hdisk is running out of free space | 04:12 |
| === zdra_ [n=zdra@81.247.172.23] has joined #ubuntu | ||
| === HymnToLife [n=fkraiem@dyn-213-36-162-16.ppp.tiscali.fr] has joined #ubuntu | ||
| === sven [n=sven@p508C8BCD.dip0.t-ipconnect.de] has joined #ubuntu | ||
| === rambo3 [n=rambo3@c-bff871d5.027-6-6b73641.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| === gorduxxo [n=pvf@nat2.iscte.pt] has joined #ubuntu | ||
| === Arrick [n=Arrick@pool-71-115-130-42.gdrpmi.dsl-w.verizon.net] has joined #ubuntu | ||
| === jeddy3 [n=mattias@81-234-85-40-o1122.telia.com] has joined #ubuntu | ||
| === m0r0n [n=moron@q1gw.q1ag.de] has joined #ubuntu | ||
| === Fanskapet [n=tommy@81-233-197-124-no88.tbcn.telia.com] has joined #ubuntu | ||
| Storkme | how can i install kernel 2.6.16-1-k7-smp ? | 04:16 |
| === NoOnEx [n=noone@ip68-11-220-123.br.br.cox.net] has joined #ubuntu | ||
| === hollandlucas [n=hollandl@c147194.adsl.hansenet.de] has joined #ubuntu | ||
| === korben [n=korben@rrcs-24-172-228-94.midsouth.biz.rr.com] has joined #ubuntu | ||
| hollandlucas | hiya | 04:16 |
| === kristi [n=userbn@202.150.68.114] has joined #ubuntu | ||
| Arrick | what should the settings be in xchat to automatically identify when I log in? | 04:17 |
| === don_dario [n=dario@85-57-128-119.gij1.adsl.uni2.es] has joined #ubuntu | ||
| === pitti [n=pitti@ubuntu/member/pitti] has joined #ubuntu | ||
| kleinlappies_ | has anyone used a nokia phone and bluetoothed to their pc (as a remote) | 04:17 |
| don_dario | no llego a installar webmin | 04:17 |
| m0r0n | My soundcard doesnt work anymore. I ve reinstalled alsa-base and alsa-utils. I cant hear anything, although I ve set pcm volume control of alsamixer to 100 | 04:17 |
| Storkme | how can i install kernel 2.6.16-1-k7-smp ? | 04:17 |
| apokryphos | Storkme: install linux-k7-smp | 04:18 |
| rambo3 | if i created a script in init.d/ and updated rc. and in script there is echo "text" what log file should i find that output in ? | 04:18 |
| LoCusF | kleinlappies_: yep, I have | 04:18 |
| === kilgost [n=sam@APoitiers-153-1-35-50.w83-203.abo.wanadoo.fr] has joined #ubuntu | ||
| kleinlappies_ | LoCusf may i ask what nodel phone | 04:18 |
| don_dario | no llego a installar webmin y pongo # sudo apt-get install webmin y nada | 04:18 |
| kleinlappies_ | sorry model | 04:19 |
| === hatake_k1kashi [n=meh@60-241-3-116.tpgi.com.au] has joined #ubuntu | ||
| Storkme | apokryphos, it says i already have the latest version | 04:19 |
| === kode4u [n=kode4u@221.196.106.45] has joined #ubuntu | ||
| apokryphos | Storkme: you have it then | 04:19 |
| kleinlappies_ | LoCusf i have a 6680 | 04:19 |
| Storkme | apokryphos, no i don't. i have 2.6.12-10-k7-smp | 04:19 |
| apokryphos | Storkme: oh, yes, that kernel you want isn't in the breezy repositories. | 04:20 |
| === apokryphos has to shoot out for a bit | ||
| Storkme | hm, okay | 04:20 |
| kode4u | how to convert a file's encoding from gb2312 to utf-8? | 04:20 |
| rambo3 | Storkme : sudo update-grub && ls -la /boot/ | 04:20 |
| === ChaKy [n=chaky@lns02-0687.dsl.iskon.hr] has joined #ubuntu | ||
| Storkme | rambo3, there's no 16-k7-smp | 04:21 |
| m0r0n | Do I have to reinstall Ubuntu? | 04:21 |
| === pigo [n=pigo@host36-18.pool8259.interbusiness.it] has left #ubuntu ["Sto] | ||
| === guest [n=guest@pool-71-114-18-154.washdc.dsl-w.verizon.net] has joined #ubuntu | ||
| === weetabix [n=weetabix@88-136-245-227.adslgp.cegetel.net] has joined #ubuntu | ||
| Akonkwa | My ubuntu won't start anymore .. i'm using a live cd now, and I 've just mounted my Linux partition . How can I find out what went wrong? | 04:22 |
| === Arrick [n=Arrick@pool-71-115-130-42.gdrpmi.dsl-w.verizon.net] has joined #ubuntu | ||
| guest | Is it possible to read NTFS from Ubuntu? | 04:22 |
| Storkme | so what respositories do i need to add to be able to get the latest kernel? or do i need to make my own? | 04:22 |
| Arrick | yes | 04:22 |
| Arrick | !partition | 04:22 |
| ubotu | Arrick: Did you get hit by a windmill? Try searching at http://ubuntu.cc.com.au/ | 04:22 |
| Arrick | guest, hang on | 04:22 |
| guest | Arrick: Yes, Sir. Thank you... | 04:22 |
| rambo3 | Storkme: dont do it if you dont know much about linux , aither upgrade to dapper or wait for relese | 04:23 |
| === soup_ [n=soup@84.52.168.253] has joined #ubuntu | ||
| === Aidamina [n=aa@cc247812-a.roden1.dr.home.nl] has joined #ubuntu | ||
| syndicate | i want to get samba to run on boot but i can't find rc.conf. can anyone help? | 04:23 |
| soup_ | how can i upgrade mozilla browser to 1.5.0.1 ? | 04:23 |
| === slack_prad [n=slack_pr@59.92.43.42] has joined #ubuntu | ||
| brosioz | help, nvtv works only with nv drivers ? or works also with nvidia ? nvtv doesn't recornise my 6600 videocards | 04:23 |
| === chmod775 [n=chmod775@59.92.137.67] has left #ubuntu ["Leaving"] | ||
| Storkme | rambo3, i need to, for compatability with my nvidia drivers | 04:23 |
| Akonkwa | My ubuntu won't start anymore .. i'm using a live cd now, and I 've just mounted my Linux partition . How can I find out what went wrong? | 04:23 |
| kleinlappies_ | when i do "sudo hidd --search" i get nothing, my phone's showing to all | 04:23 |
| nickrud | !tell soup_ about ff1.5 | 04:23 |
| Shadowpillar | battery acid, dip your hands in it | 04:24 |
| Shadowpillar | er | 04:24 |
| Shadowpillar | nevermind | 04:24 |
| m0r0n | Akonkwa: You have to reinstall your Ubuntu | 04:24 |
| syndicate | !tell syndicate about ff1.5 | 04:24 |
| Shadowpillar | !ff1.5 | 04:24 |
| ubotu | You can use firefox 1.5 by following this wiki page https://wiki.ubuntu.com/FirefoxNewVersion | 04:24 |
| Shadowpillar | Akonkwa: okay, a little more info | 04:24 |
| kode4u | how to convert a file's encoding from gb2312 to utf-8? | 04:24 |
| Shadowpillar | Akonkwa: what exactly happened? | 04:24 |
| rambo3 | Storkme: if o was you i would probobly add dapper repos and just installed kernel + nvidia modules, and switch back to reezy repos | 04:25 |
| Arrick | !ntfs | 04:25 |
| ubotu | hmm... ntfs is the filesystem used in Windows NT and newer; to automatically mount your NTFS partition: https://wiki.ubuntu.com/AutomaticallyMountMSWindowsPartitions | 04:25 |
| === tiagovaz [n=tiago@London-HSE-ppp3553337.sympatico.ca] has joined #ubuntu | ||
| Arrick | there you go guest, had to remember the link | 04:25 |
| Storkme | rambo3, where can i find out the dapper repo's? | 04:25 |
| guest | Arrick: is that a command? | 04:25 |
| === jbrown101st [n=jake@12-226-82-227.client.mchsi.com] has joined #ubuntu | ||
| === mumbles-out is now known as mumbles | ||
| === antonio_ [n=antonio@host250-233.pool8537.interbusiness.it] has joined #ubuntu | ||
| jbrown101st | hey | 04:25 |
| Arrick | look at the ubotu posting above it | 04:25 |
| Shadowpillar | Akonkwa: what exactly happened? | 04:25 |
| antonio_ | CIAO A TUTTI | 04:25 |
| m0r0n | I will reinstall Ubuntu in a few minutes, because I am tired of searching errors | 04:25 |
| syndicate | i want to get samba to run on boot but i can't find rc.conf. can anyone help? | 04:26 |
| Arrick | go to the wiki it says and follow the directions | 04:26 |
| Arrick | hang on syndicate | 04:26 |
| === venky [n=venky@c-67-173-245-210.hsd1.co.comcast.net] has joined #ubuntu | ||
| === Profichilla [n=Jakob@p548DAB91.dip0.t-ipconnect.de] has joined #ubuntu | ||
| === HaRDaWaY [n=ubuntu@hiscpdprx01.upsa.es] has joined #ubuntu | ||
| HaRDaWaY | hi | 04:26 |
| Akonkwa | Shadowpillar,: Well, I tried to restart my pc, and when I did, linux boots, but just befor starting nautilus, it crashes, and I get a terminal, with a prompt, telling me I'm logged as root :-s | 04:26 |
| guest | Arric: Thank you. I'll read it now. ;) | 04:26 |
| Arrick | hey syndicate I gotta boot into ubuntu to help you , hang on | 04:26 |
| rambo3 | Storkme: do you have muti and univers enabled in breezy? | 04:26 |
| Arrick | brb | 04:27 |
| Storkme | yes rambo3 | 04:27 |
| === farous [n=farous@d141-64-4.home.cgocable.net] has joined #ubuntu | ||
| Shadowpillar | Akonkwa: nautilus or gnome? | 04:27 |
| kleinlappies_ | bluetooth= what is the passcode for connecting my phone to the pc | 04:27 |
| venky | hello iam getting error in "logical block 1" while mounting my internal laptop HDD iam running linux from and external usn HDD | 04:27 |
| farous | anyone have problems with evolution when viewing a message it scrolls down to the end of the message? | 04:27 |
| nickrud | syndicate, !tell syndicate about samba | 04:27 |
| Akonkwa | Shadowpillar: I'm sorry I'm not really sure wich... :s | 04:27 |
| nickrud | syndicate, the ubotu msg you just got tells you how to set up samba | 04:28 |
| LoCusF | kleinlappies_: the default is 1234 | 04:28 |
| === caglar__ is now known as caglar | ||
| LoCusF | and don't use hidd to connect your phone | 04:28 |
| kleinlappies_ | LoCusf sweet thanks | 04:28 |
| Shadowpillar | ....oh...good. | 04:28 |
| nickrud | farous, yes, I had that for a while, a sec | 04:28 |
| venky | anyway to do a checkdisk on windows partition from linux | 04:28 |
| Shadowpillar | I just realised something | 04:28 |
| LoCusF | kleinlappies_: use, sudo hcitool -i hci0 cc [phonesmac] | 04:28 |
| Shadowpillar | I installed ubuntu all fine and nice on my ppc mac | 04:28 |
| rambo3 | sed -ie 's/breezy/dapper/g' /etc/apt/sources.list and after that search your keernel and anvidia stuff and install it . when you are done just do :sed -ie 's/dapper/breezy/g' /etc/apt/sources.list | 04:28 |
| farous | nickrud: ok | 04:29 |
| Shadowpillar | ...just to realise I installed hoary. | 04:29 |
| Shadowpillar | LOVELY. | 04:29 |
| rambo3 | Storkme: sudo sed -ie 's/breezy/dapper/g' /etc/apt/sources.list and after that search your keernel and anvidia stuff and install it . when you are done just do :sed -ie 's/dapper/breezy/g' /etc/apt/sources.list | 04:29 |
| Akonkwa | Shadowpillar: Can't I acess a log file or something to find the errors? | 04:29 |
| === izmaelis [n=izmaelis@85.206.227.243] has joined #ubuntu | ||
| === Shadowpillar wallpunch | ||
| Shadowpillar | Akonkwa: what did you do before that happened? | 04:29 |
| === Deep6 [n=DEEP6@208.38.35.162] has joined #ubuntu | ||
| === TheFuzzball [n=TheFuzzb@212.32.120.168] has joined #ubuntu | ||
| syndicate | thanks nickrud | 04:30 |
| TheFuzzball | who knows how to install an rmp file? | 04:30 |
| === arrick [n=arrick@pool-71-115-130-42.gdrpmi.dsl-w.verizon.net] has joined #ubuntu | ||
| rambo3 | Storkme: dont forget sudo apt-get update | 04:30 |
| nickrud | farous, if I remember it correctly, it's something called caret mode ; hit F7 to toggle it | 04:30 |
| farous | nickrud: thanks a lot | 04:30 |
| Akonkwa | Shadowpillar: I tried to upgrade to dapper... :s | 04:30 |
| arrick | ok im back | 04:31 |
| m0r0n | Akonkwa: Why did you do that. Are you a developer? | 04:31 |
| nickrud | farous, it's been a while, my memory may not be perfect | 04:31 |
| === _zippy_ [n=zippy@201.21.158.82] has joined #ubuntu | ||
| farous | nickrud: trying it now but not working yet you put me on the right track | 04:31 |
| farous | thanx | 04:31 |
| nathanj | is there a way i can make ubuntu think "xlibs" is install so i can install cedega: | 04:32 |
| === nsmith [n=nsmith@195.8.2.194] has joined #ubuntu | ||
| farous | nickrud: working perfectly now thanx man :) | 04:32 |
| arrick | who was i working with that had a question, and I told them i had to boot to ubuntu? | 04:32 |
| === glatzor [n=sebi@ppp-82-135-64-134.mnet-online.de] has joined #ubuntu | ||
| nsmith | When I open the synaptic package manager I get the fallowing error W: Couldn't stat source package list http://cv.archive.ubuntu.com breezy/universe Packages (/var/lib/apt/lists/cv.archive.ubuntu.com_ubuntu_dists_breezy_universe_binary-i386_Packages) - stat (2 No such file or directory) What does this mean and how can I fix it? | 04:32 |
| Akonkwa | Shadowpillar: I changed the repositories address in a text file, then did sudo apt update, it downloaded all the files, but then nothing happened. Except that my computer would crash every time I tried to log out | 04:32 |
| arrick | nsmith, you need to update your sources list | 04:33 |
| Akonkwa | m0r0n : I wanted to try out Xgl | 04:33 |
| nsmith | arrick: how do I do that. I am new to ubuntu and am trying to learn so please be patient. | 04:33 |
| arrick | hang on | 04:33 |
| === jbaloul [n=jacob@mail.rrtechnologies.net] has joined #ubuntu | ||
| === lwelyn [n=lwelyn@p549A664F.dip.t-dialin.net] has joined #ubuntu | ||
| jbaloul | hello all | 04:34 |
| === awelynant [n=awelynan@black.renesys.com] has joined #ubuntu | ||
| === ep [n=mdr@ip68-97-122-135.ok.ok.cox.net] has joined #ubuntu | ||
| jbaloul | i want to copy my customized ubuntu onto a bootcd...can annyone point me in the right direction? | 04:35 |
| === SS2 [n=SS2@dslb-084-057-028-250.pools.arcor-ip.net] has joined #ubuntu | ||
| === Janos [n=cramos@nat1.inalambrica.net] has joined #ubuntu | ||
| _jason | nsmith: click the reload button in synaptic | 04:35 |
| === nick|here [n=boran@unaffiliated/nickhere/x-000000001] has joined #ubuntu | ||
| === carlos [n=carlos@62.87.127.205] has joined #ubuntu | ||
| === mxpxpod_ [n=BryanFor@wuw-ojr3gmca.dybb.com] has joined #ubuntu | ||
| === jeekl [n=jeff@h248n3c1o1104.bredband.skanova.com] has joined #ubuntu | ||
| nick|here | hi, i have just installed ubuntu and /etc/init.d/gdm start fails. but i login into a gui | 04:36 |
| nsmith | _jason: I have done that and it gives me a list of available updates. The problem is I do not know which updates I need and dont need. There are 88 possible updates. | 04:36 |
| kleinlappies_ | bluetooth how do i get my phone mac? when i type "sudo hidd --search" the phone and pc pair themselves | 04:36 |
| === Dr_Willis [n=willis@12-222-81-183.client.insightBB.com] has joined #ubuntu | ||
| _jason | nsmith: are you on broadband? | 04:36 |
| nsmith | _jason: unfortunately no. dialup 64kbps | 04:37 |
| nsmith | or I would download them all | 04:37 |
| _jason | nsmith: does hitting reload get rid of your ``Couldn't stat'' warning though? | 04:37 |
| === [SEAWOLF] [n=seawolf@host166-57.pool8261.interbusiness.it] has joined #ubuntu | ||
| nsmith | _jason no it does not | 04:38 |
| === Prueba [n=abian@232.Red-83-32-135.dynamicIP.rima-tde.net] has joined #ubuntu | ||
| jeekl | Hirvinen, I'm having a problem with a kernel I've compiled. it gives me xsession errors. I describe the problem a little here: http://ubuntuforums.org/showthread.php?t=84174&page=9#357 could someone help me out? | 04:38 |
| Prueba | olaaa | 04:38 |
| arrick | _jason, I had that problem and yu had me remove comments from the universe in the sources.list to fix it | 04:38 |
| nsmith | There is a list of warnings similar to the one that I pasted | 04:38 |
| Prueba | jo putassssssssssssssssss | 04:38 |
| nick|here | i have just installed ubuntu and /etc/init.d/gdm start fails. but i login into a gui | 04:38 |
| nick|here | ?? | 04:38 |
| _jason | nsmith: 'gedit /etc/apt/sources.list' in a accessories > terminal. Copy the contents, paste them at http://paste.ubuntu-nl.org/ and give us a url please | 04:38 |
| === smssms [n=smssms@217.113.5.101] has joined #ubuntu | ||
| === echoo [n=mauroue@softbank221045118152.bbtec.net] has left #ubuntu [] | ||
| === MacSlow [n=mirco@dslb-084-063-004-204.pools.arcor-ip.net] has joined #ubuntu | ||
| arrick | nick|here, what are your system specs | 04:39 |
| Prueba | maricas | 04:39 |
| arrick | nsmith, _jason, you need to put sudo before that command. jason he's a new user | 04:39 |
| === jorni_ [n=jorni@c-6a1170d5.012-2313-6d6c6d10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| smssms | hi all, can someone tell me please how can I manually update repository package list (without doing apt-get update) | 04:39 |
| nick|here | arrick: athlon XP 1700+, 1 gig kingston ram, epox 8k9a | 04:39 |
| _jason | arrick: I just need him to see it, not edit yet :) | 04:39 |
| nsmith | arrick/jason: thanks hold on | 04:39 |
| arrick | oh ok | 04:39 |
| === s0ciopath [n=user@net34-155.netkaster.ca] has joined #ubuntu | ||
| === cr3 [n=marc@pdpc/supporter/bronze/cr3] has joined #ubuntu | ||
| slack_prad | are the wiley tests costly? | 04:40 |
| === jorni [n=jorni@c-6a1170d5.012-2313-6d6c6d10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| smssms | I didn't find any solution inthe forums | 04:40 |
| _zippy_ | how i can create a iso image of my HD? | 04:40 |
| arrick | nick|here, any way to get a screenshot of the error so all can help? | 04:40 |
| nickrud | smssms, you'd need to download the packages lists manually, and put them in the proper spot. Why? | 04:40 |
| === gana-home [n=ganadist@124.61.65.84] has joined #ubuntu | ||
| nick|here | arrick: i can paste the output tu pastebin, hold on | 04:41 |
| === Pegasos989 [n=pekka@cs78165177.pp.htv.fi] has joined #ubuntu | ||
| kleinlappies_ | LoCusf do you maye know the command to get my phone's mac add.? | 04:41 |
| smssms | nickrud, thanks, I've already downloaded the lists and found out that they must be extracted to /var/lib/apt/lists | 04:41 |
| === t-sa [n=moises@84-120-137-202.onocable.ono.com] has joined #ubuntu | ||
| === jorni_ [n=jorni@c-6a1170d5.012-2313-6d6c6d10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| LoCusF | kleinlappies_: sudo hcitool scan | 04:41 |
| === rupipa [n=rupipa@83.230.234.142] has joined #ubuntu | ||
| === Profichilla [n=jakob@p548DAB91.dip0.t-ipconnect.de] has joined #ubuntu | ||
| arrick | nick|here, you can send it to the pastebin ok, put it under everyone, so all can help | 04:41 |
| cr3 | what is the name given by Ubuntu folks for documents describing a process or a project or somesuch? it's like a document that is submitted to other Ubuntu developers for discussion. | 04:41 |
| === rupipa [n=rupipa@83.230.234.142] has joined #ubuntu | ||
| arrick | then put the link in here | 04:41 |
| smssms | nickrud, I need to update the Ubuntu at home, where I don't have internet connection, so I need to get the packages from office and install them at home | 04:42 |
| rupipa | lhjggkhhf | 04:42 |
| arrick | cr3 whitpaper | 04:42 |
| kleinlappies_ | LoCusf man thanks a mill. | 04:42 |
| t-sa | hi | 04:42 |
| === gvveroma [n=gvveroma@83.230.234.84] has joined #ubuntu | ||
| LoCusF | ubotu tell kleinlappies_ about bluetooth | 04:42 |
| smssms | nickrud, now I don't know what name the package list should have | 04:42 |
| nick|here | arrick: http://paste.ubuntu-nl.org/11096 thats the output | 04:42 |
| === Pupeno [n=Pupeno@134.Red-80-38-48.staticIP.rima-tde.net] has joined #ubuntu | ||
| === bobby [n=bobby@210-18-214-226.cust.iexec.net.au] has joined #ubuntu | ||
| cr3 | arrick: hm, that name is not quite what I'm looking for. sorry if I'm so vague, it's hard to find a name that I have forgotten :( | 04:43 |
| Cobain | is anyone else having problems with gdesklets freezing in dapper? | 04:43 |
| nickrud | smssms, I'll paste the contents of my /var/lib/apt/lists directory, maybe you can use that as a template | 04:43 |
| arrick | ok | 04:43 |
| neo911 | how does one join ubuntu developement? | 04:43 |
| t-sa | me parece que me he equivocado de server... | 04:43 |
| Akonkwa | I wanted to upgrade to dapper. I changed the repositories address in a text file, then did sudo apt update, it downloaded all the files, but then nothing happened. Except that my computer would crash every time I tried to log out. Now it won't start. I'm using a Live session, and i've mounted my linux partition. Can anyone help me find what went wrong? | 04:43 |
| arrick | cobain #ubuntu+1 | 04:43 |
| smssms | nickrud, thanks very much! | 04:43 |
| arrick | for dapper support Cobain | 04:43 |
| arrick | !es | 04:44 |
| ubotu | Hispanohablantes: Por favor usen #ubuntu-es, #kubuntu-es o #edubuntu-es, alli obtendran mas ayuda. | 04:44 |
| rambo3 | Akonkwa: apt-get dist-upgrade? | 04:44 |
| === ciboy [n=cisan@202.95.133.10] has joined #ubuntu | ||
| === syndicate [n=syndicat@dsl-145-196-122.telkomadsl.co.za] has joined #ubuntu | ||
| gnomefreak | Akonkwa: sudo apt-get dist-upgrade | 04:44 |
| === guest [n=guest@pool-71-114-18-154.washdc.dsl-w.verizon.net] has joined #ubuntu | ||
| jeekl | I'm having a problem with a kernel I've compiled. it gives me xsession errors. I describe the problem a little here: http://ubuntuforums.org/showthread.php?t=84174&page=9#357 could someone help me out? | 04:44 |
| nsmith | _jason: ok this is it http://paste.ubuntu-nl.org/11097 | 04:44 |
| nickrud | smssms, http://paste.ubuntu-nl.org/11098 | 04:44 |
| arrick | _jason can I pm? | 04:44 |
| kleinlappies_ | LoCusf i have the links, working of them, thanks for the help | 04:44 |
| guest | I mounted an NTFS drive, but I don't have permission to access it. | 04:44 |
| LoCusF | ok, no problem :) | 04:44 |
| _zippy_ | guest, try as root | 04:45 |
| === gimmulf [n=gimmulf@unaffiliated/gimmulf] has joined #ubuntu | ||
| smssms | nickrud, Thanks again ;) | 04:45 |
| LoCusF | guest: add umask=0222,nls=utf8 to your /etc/fstab | 04:45 |
| _jason | arrick: no need to ask | 04:45 |
| arrick | did you follow all of the tutorial I gave you guest | 04:45 |
| guest | _zippy_: how do I??: | 04:45 |
| guest | arrick: Yes, Sir. | 04:45 |
| === mr_lampe [n=tho@dslb-084-056-154-032.pools.arcor-ip.net] has joined #ubuntu | ||
| _zippy_ | how i can create a iso image of my HD? | 04:45 |
| rambo3 | you ll need auto there | 04:45 |
| syndicate | !tell syndicate about samba | 04:45 |
| === ciboy [n=cisan@202.95.133.10] has left #ubuntu ["Leaving"] | ||
| _zippy_ | !tell zippy about java | 04:46 |
| nsmith | _jason: did you get the source list that I pasted? | 04:46 |
| kleinlappies_ | LoCusf got it its paired :) | 04:46 |
| _jason | nsmith: ok you are going to have to edit the file, in a terminal, enter: gksudo 'gedit /etc/apt/sources.list' | 04:46 |
| nickrud | smssms, I'll keep good thoughts :) | 04:46 |
| guest | arrick: it now detects the drive. However, only "root" has access. I am "guest". | 04:46 |
| === kamil [n=kamil@80.51.6.6] has joined #ubuntu | ||
| Akonkwa | rambo3, gnomefreak : I think I did something like that.. Do you know if I can acess a log file to find what went wrong, and do you belive I can fix this problem without reinstalling ubuntu? | 04:46 |
| nsmith | _jason: ok now what? | 04:47 |
| rambo3 | Akonkwa: from live cd what is the name of kernel in /boot/ for crashed verion ? | 04:48 |
| nsmith | _jason: I get the fallowing error (gedit:8269): GnomeUI-WARNING **: While connecting to session manager: | 04:48 |
| nsmith | Authentication Rejected, reason : None of the authentication protocols specified are supported and host-based authentication failed. | 04:48 |
| arrick | guest, can you send a copy of 'gedit /etc/fstab' to pastebin, i'll change you permissions for you | 04:48 |
| Akonkwa | rambo3, : I'll go check | 04:48 |
| _jason | nsmith: did gedit open with the file? | 04:48 |
| === mooey [n=chris@85-210-89-111.dsl.pipex.com] has joined #ubuntu | ||
| guest | arrick: Yes, Sir. I appreciate this... ;) | 04:49 |
| === xstation [n=bliss1@4096.net] has joined #ubuntu | ||
| xstation | hello | 04:49 |
| nsmith | _jason: yes | 04:49 |
| === cdubya [n=chris@207.192.218.163] has joined #ubuntu | ||
| nsmith | _jason: sources list file correct? | 04:49 |
| nathanj | openoffice been updated? | 04:49 |
| === mor [n=mor@lun34-1-82-239-217-13.fbx.proxad.net] has joined #ubuntu | ||
| xstation | where can I find /etc/rc.d/rc.local'. | 04:49 |
| guest | arrick: what is the pastebin URL?? | 04:49 |
| === petry [n=petry@83.230.233.96] has joined #ubuntu | ||
| === victor__ [n=victor@195.177.228.22] has joined #ubuntu | ||
| xstation | its not there | 04:50 |
| _jason | nsmith: ok delete line 41 and to the end of lines 22 and 23 append `` multiverse'' | 04:50 |
| nickrud | xstation, it doesn't exist :) | 04:50 |
| petry | hola | 04:50 |
| nathanj | i just got a update notification to install new openoffice? | 04:50 |
| arrick | nick|here, use this command 'sudo /etc/init.d/gdm start' | 04:50 |
| guest | arrick: I ought to save this to favorites! ha | 04:50 |
| arrick | yeah | 04:50 |
| gnomefreak | nathanj: on breezy? | 04:50 |
| rambo3 | xstation no its not | 04:50 |
| arrick | give me the link after you post it | 04:50 |
| nathanj | gnomefreak: no dapper | 04:50 |
| gnomefreak | nathanj: install it its safe | 04:50 |
| petry | q pasa | 04:50 |
| guest | arrick: what is the pastebin URL, please? | 04:50 |
| gnomefreak | nathanj: also dapper in now supported in #ubuntu+1 | 04:50 |
| === hatake_kakashi [n=meh@60-240-144-156.tpgi.com.au] has joined #ubuntu | ||
| rambo3 | xstation: man update-rc.d | 04:50 |
| _jason | guest: /topic | 04:50 |
| arrick | !pastebin | 04:50 |
| ubotu | well, pastebin is a site where you can post large texts and screenshots so you don't flood the channel. You can find it at http://paste.ubuntu-nl.org - You can install webboard for easy pasting from the gnome taskbar | 04:51 |
| nickrud | xstation, most things you'd put in an rc.local already have provisions in ubuntu, just what is it you want to do? | 04:51 |
| nathanj | gnomefreak: i did just enable a breezy apt so i could get xlibs (for cedeega) but i disabled it and updated resps :o | 04:51 |
| Akonkwa | rambo3, :I have several files in /boot/ some of them carry the name 2.6.10-6-386 and others 2.6.10-5-386 | 04:51 |
| === GNU_Style [n=GNU_Styl@203.177.251.27] has joined #ubuntu | ||
| gnomefreak | somewhat supported | 04:51 |
| nathanj | gnomefreak: sorry i thought i was in there lol :) | 04:51 |
| gnomefreak | nathanj: bad idea | 04:51 |
| nathanj | gnomefreak: there was no other workarond | 04:51 |
| xstation | nickrud/rembo3 i need it for # Load the KQEMU kernel module | 04:51 |
| xstation | /sbin/modprobe kqemu | 04:51 |
| === gen [n=gen@pub1.heig-vd.ch] has joined #ubuntu | ||
| gnomefreak | nathanj: very very bad idea mixing dapper and breezy libs | 04:51 |
| nickrud | xstation, add kqem to /etc/modules | 04:51 |
| nickrud | xstation, add kqemu to /etc/modules | 04:51 |
| nathanj | gnomefreak: any idea how i can make it looks like xlibs is a installed package by cedega.deb? | 04:52 |
| rambo3 | Akonkwa: you didnt upgrade , tyr booting in recovEry version and do siimple: apt-get update and apt-get dist-upgrade | 04:52 |
| nickrud | xstation, any module mentioned there will get loaded on bootup | 04:52 |
| guest | arrick: here is the URL: http://paste.ubuntu-nl.org/11099 | 04:52 |
| nickrud | xstation, I mean, the correct module name, of course | 04:52 |
| guest | arrick: I finally saved pastebin to favorites! Ha | 04:52 |
| arrick | ok | 04:52 |
| gnomefreak | nathanj: please join me in #ubuntu+1 | 04:52 |
| === gana-home [n=ganadist@124.61.65.84] has joined #ubuntu | ||
| xstation | nickrud: what do I put in etc/modules exactly please | 04:53 |
| === gen is now known as chamo | ||
| nsmith | _jason: do I need to delet "universe" on lines 22 and 23 then add multiverse or just add mutliverse? | 04:53 |
| === xiaobai [n=xiaobai@218.78.239.204] has joined #ubuntu | ||
| chamo | hi all | 04:53 |
| neo911 | anyone know FuntKlakow? | 04:53 |
| xstation | is it this line # Load the KQEMU kernel module | 04:53 |
| xstation | /sbin/modprobe kqemu | 04:53 |
| Akonkwa | rambo3,: I'll try that. thanx | 04:53 |
| _jason | nsmith: just add multiverse, do not delete anything on lines 22 and 23 | 04:53 |
| nickrud | simply mention the module name on a line, there's a few already there. | 04:53 |
| === Dewi [n=dewi@203-206-119-140.dyn.iinet.net.au] has joined #ubuntu | ||
| === fredrik [n=fredrik@host-83-166-19-203.hernonet.se] has joined #ubuntu | ||
| _jason | nsmith: make sure you spell it muLTiverse not multiverse :) | 04:54 |
| _jason | argh I messed up | 04:54 |
| _jason | nsmith: make sure you spell it muLTiverse not multiverse :) | 04:54 |
| rambo3 | lia echo "ali5455">> /etc/modulesa | 04:54 |
| === Tomcat_ [n=Tomcat@p54A18B7C.dip0.t-ipconnect.de] has joined #ubuntu | ||
| _jason | nsmith: you get the idea... just spell it right. My auto-replace is not letting me replicate your typo | 04:54 |
| === zim [n=zim@zimonline.demon.co.uk] has joined #ubuntu | ||
| === Rayman_ [n=rikur@cs78181108.pp.htv.fi] has joined #ubuntu | ||
| fredrik | I have h.264 (.mkv) video problem, I can't move forward | 04:55 |
| xiaobai | how add local bn gateway to warcraft in cedege | 04:55 |
| === guii [n=gui@201008175106.user.veloxzone.com.br] has joined #ubuntu | ||
| arrick | guest did you get my pm? | 04:55 |
| Dr_Willis | xiaobai, you mean reroute the game from going to the official BattleNEt to your own? | 04:55 |
| === fredrik is now known as erikl | ||
| zim | hi all what command do u run to reconfig a network interface (server install) | 04:56 |
| === trainer [n=dave@65-117-135-105.dia.static.qwest.net] has joined #ubuntu | ||
| xstation | nickrud: there does not seem to be a etc/modules | 04:56 |
| nsmith | _jason: ok done | 04:56 |
| === Effi [n=atahualp@p54AC1DAB.dip0.t-ipconnect.de] has joined #ubuntu | ||
| === HaRDaWaY [n=ubuntu@hiscpdprx01.upsa.es] has joined #ubuntu | ||
| === clast [n=clast@p54B3DAB8.dip.t-dialin.net] has joined #ubuntu | ||
| HaRDaWaY | hi | 04:56 |
| nsmith | _jason: now what? | 04:56 |
| _jason | nsmith: ok save, and then run 'sudo apt-get update' | 04:56 |
| arrick | guest, yu here? | 04:57 |
| nickrud | xstation, there's been one in debian based systems, for, god knows how long. | 04:57 |
| === Enthusiast78 [n=diogo@200-203-54-19.nhoce7001.e.brasiltelecom.net.br] has joined #ubuntu | ||
| === mikul [n=mikul@81-233-78-174-no73.tbcn.telia.com] has joined #ubuntu | ||
| _jason | nsmith: tell me if you get and ``W: Couldn't stat...'' lines | 04:57 |
| Enthusiast78 | Hi! Anyone using kqemu? | 04:57 |
| zim | someone must know ??? | 04:57 |
| zim | hi all what command do u run to reconfig a network interface (server install) | 04:57 |
| === juana- [n=juana-@83.230.235.138] has joined #ubuntu | ||
| arrick | hold on zim, you gotta have aptience | 04:58 |
| nsmith | _jason: right now it is downloading packages | 04:58 |
| arrick | patience even zim | 04:58 |
| === xjonex [n=jone@dsl-roigw1-fe8ede00-5.dhcp.inet.fi] has joined #ubuntu | ||
| zim | np | 04:58 |
| trainer | Hi, need some help, I'm getting this error while trying to start synergy: synergys: error while loading shared libraries: libstdc++-libc6.2-2.so.3: cannot open shared object file: No such file or directory | 04:58 |
| zim | just running late | 04:58 |
| === Hexidigital [n=Hexidigi@24.115.31.129.res-cmts.wbh.ptd.net] has joined #ubuntu | ||
| arrick | ok | 04:58 |
| === Hexidigital [n=Hexidigi@24.115.31.129.res-cmts.wbh.ptd.net] has left #ubuntu [] | ||
| nickrud | xstation, it's in both breezy & dapper on my machine | 04:58 |
| _jason | trainer: sudo aptitude install libstdc++6 | 04:58 |
| cdubya | could you boot the liveCD to get a system up that the X Server won't start on? (sadly, the gentleman I installed it for requested FC4 instead of Ubuntu :( ) - but I'm wondering if I could boot the 5.10 LiveCD, get it to load up X, then copy over the xorg.conf file and have it work properly. What do you think? | 04:58 |
| === Profichilla [n=Jakob@p548DAB91.dip0.t-ipconnect.de] has joined #ubuntu | ||
| Enthusiast78 | zim, The easy way is to edit '/etc/network/interfaces'. Read 'man interfaces' if you need help. | 04:59 |
| cdubya | err, fc5 | 04:59 |
| zim | ty | 04:59 |
| LinuxJones | zim: do you know what network card your system has in it ? | 04:59 |
| === Rorgo [n=rorgore@anya.digitalspark.net] has joined #ubuntu | ||
| zim | yup | 04:59 |
| LinuxJones | zim: do you know if the module is loaded ? | 04:59 |
| trainer | _jason: according to synaptic, I've already got libstdc++6 | 04:59 |
| zim | but i have used a command that pops up a blue screen before from command line | 04:59 |
| _jason | trainer: how about libstdc++2.10-glibc2.2 | 05:00 |
| zim | but for the life of me i cant remember it | 05:00 |
| === coffee [n=coffee@ACCFC7DA.ipt.aol.com] has joined #ubuntu | ||
| trainer | _jason: nope. I'll try it | 05:00 |
| Enthusiast78 | zim, Doing 'dmesg | grep eth' should show which ethernet adapters are available. | 05:00 |
| _jason | trainer: synergy should have pulled in all the stuff it needed, hrmm | 05:00 |
| === jonatan [n=jonatan@208.Red-80-37-254.staticIP.rima-tde.net] has joined #ubuntu | ||
| === fantito [n=fantito@199.Red-213-97-9.staticIP.rima-tde.net] has joined #ubuntu | ||
| trainer | _jason: I have an incompatible client. 1.2 is the latest I can get from the repository so I had to install the rpm manually | 05:01 |
| === andrunko [n=andrunko@200.249.192.132] has joined #ubuntu | ||
| _jason | trainer: yeah... thay would cause the problem | 05:01 |
| _jason | trainer: s/thay/that | 05:02 |
| === xiaobai_ [n=xiaobai@61.152.128.113] has joined #ubuntu | ||
| === rambo3 [n=rambo3@c-bff871d5.027-6-6b73641.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| === sYs`afk is now known as sYs^ | ||
| Rayman_ | hmh | 05:02 |
| arrick | guest | 05:03 |
| Rayman_ | how much performance gain do I get from using ubuntu x64 on a turon64 system? | 05:03 |
| === andrunko [n=andrunko@200.249.192.132] has left #ubuntu ["Leaving"] | ||
| _jason | trainer: might be best to just look at 'apt-cache depends synergy' and install them all | 05:03 |
| guest | arrick: ?? | 05:03 |
| === Ygdrassil [n=me@bsjrmb01dc1-241-61.dynamic.mts.net] has joined #ubuntu | ||
| === Ygdrassil is now known as Yggdrassil | ||
| xstation | nickrud: found it so just add the line # Load the KQEMU kernel module | 05:03 |
| xstation | /sbin/modprobe kqemu without the comment | 05:03 |
| LinuxJones | zim: do lspci -v and tell me the make/model of your nic card | 05:04 |
| zim | ty | 05:04 |
| arrick | guest, there is a pic on the post at http://paste.ubuntu-nl.org/11101, when you 'sudo gedit /etc/fstab' you will need to changeit to look like the picture | 05:04 |
| rambo3 | can anyone help me with this script >> http://paste.ubuntu-nl.org/11102 | 05:04 |
| zim | think im ok noe | 05:04 |
| nickrud | xstation, no, just kqemu on a line, no need to mention modprobe | 05:04 |
| zim | think im ok now | 05:04 |
| zim | ty all | 05:04 |
| LinuxJones | zim: GL :) | 05:04 |
| guest | arrick: yes... | 05:04 |
| coffee | hi, does someone have a good tuto to use an ATI Remote Wonder 2 with the ati_remote2 module integrated in ubuntu kernel? It doesn't reply in xev for me :( | 05:04 |
| arrick | only one line is changed, and you need to find the put your username here and do so, and it will allow you to view the ntfs partition | 05:05 |
| === cr3 [n=marc@pdpc/supporter/bronze/cr3] has left #ubuntu [] | ||
| trainer | _jason: well I knew it was a dependency I wasn't aware of, but didn't know how to check them via apt. besides you nailed it with libstdc++2.10-glibc2.2. I'm off and running now. Thanks for your help! | 05:05 |
| === Malco [n=malco@pool-70-105-74-54.chi.dsl-w.verizon.net] has joined #ubuntu | ||
| === scandian [n=scandian@ppp-121-99.25-151.libero.it] has joined #ubuntu | ||
| === j_ack [n=nico@p508D8E51.dip0.t-ipconnect.de] has joined #ubuntu | ||
| LinuxJones | Rayman_: you won't notice any difference unless your encoding video or something. Plus, it's a pain because some stuff (like flash plugin support) take a bit to get setup. | 05:06 |
| scandian | hi | 05:06 |
| === arnaud__ [n=arnaud@213.223.36.89] has joined #ubuntu | ||
| guest | arrick: Yes, I see what you are talking about. I'll do that now... | 05:06 |
| arrick | ok | 05:06 |
| arnaud__ | salut | 05:06 |
| arrick | that should fix your problem, it did for me guest | 05:06 |
| scandian | who can say me a beautifull game to download with synaptic? | 05:07 |
| arnaud__ | bonjour | 05:07 |
| xstation | nickrud: many thanks one more question that occured that was in the wikki and thats . Set the full path to the binary in the variable CC: | 05:07 |
| xstation | export CC=/usr/bin/gcc-3.4 is this neccessary | 05:07 |
| arrick | it isnt advisable to write to that partition or make changes while in ubuntu though guest | 05:07 |
| arrick | only view them guest | 05:07 |
| === MacSlow [n=mirco@dslb-084-063-004-204.pools.arcor-ip.net] has joined #ubuntu | ||
| nickrud | xstation, when you are compiling a kernel module, yes. | 05:07 |
| LinuxJones | scandian: frozen-bubble or chromium (need ati or nvidia binary drivers to work) | 05:07 |
| arrick | or use them guest | 05:07 |
| guest | arrick: understood. ;) | 05:07 |
| arrick | ok | 05:08 |
| scandian | thank linuxjones | 05:08 |
| Rorgo | anybody know why I get weird little font errors in man pages with an Ubuntu 5.10 install? | 05:08 |
| arrick | guest, are you trying to play music? | 05:08 |
| nickrud | xstation, just about all of ubuntu is compiled with gcc-4.0 , except for the kernel. For that you need gcc-3.4 | 05:08 |
| Rorgo | such as, | 05:08 |
| === bl4ckb1t [n=bl4ckb1t@168.226.98.38] has joined #ubuntu | ||
| nsmith | _jason: just finished and received the fallowing error at the end Fetched 3649kB in 9m47s (6210B/s) | 05:08 |
| nsmith | E: Could not get lock /var/lib/dpkg/lock - open (11 Resource temporarily unavail able) | 05:08 |
| nsmith | E: Unable to lock the administration directory (/var/lib/dpkg/), is another proc ess using it? | 05:08 |
| === bronson__ [n=bronson@12.168.94.81] has joined #ubuntu | ||
| Yggdrassil | Rorgo, could be your locales | 05:08 |
| === drcode [n=user1@87.69.59.186.cable.012.net.il] has joined #ubuntu | ||
| === bl4ckb1t [n=bl4ckb1t@168.226.98.38] has left #ubuntu ["Abandonando"] | ||
| _jason | nsmith: close synaptic | 05:09 |
| unforcer | Does reiserfs support quotas? | 05:09 |
| === fantito [n=fantito@199.Red-213-97-9.staticIP.rima-tde.net] has left #ubuntu ["Abandonando"] | ||
| nsmith | _jason: do I need to do it all over again? | 05:09 |
| xstation | nickrud: when the script was running to install kqemu I noticed that this may have taken place | 05:09 |
| _jason | nsmith: unfortunately, yes | 05:09 |
| nsmith | _jason: ok | 05:09 |
| === rambo3 [n=rambo3@c-bff871d5.027-6-6b73641.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| nickrud | xstation, if the script compiled that kernel module for you, it probably did :) | 05:10 |
| === gana-home [n=ganadist@124.61.65.84] has joined #ubuntu | ||
| bronson__ | I have a strange issue. I just installed Ubuntu on 2 machines. They are running behind a Linksys router. There are 10 other machines, all Windows. The Ubuntu machines can't download stuff - they timeout after a few seconds, but the windows machines are fine. any ideas? | 05:10 |
| guest | arrick: no, I'm trying to access my WindowsXp FBasic programs. | 05:10 |
| arrick | ok | 05:10 |
| LinuxJones | bronson__: that's the crappy ipv6 module working it's magic | 05:10 |
| guest | arrick: I want to see if they work with Wine. | 05:10 |
| Yggdrassil | bronson, firewall issues? | 05:10 |
| === Dyna-Work [n=dyna@64.185.231.165] has joined #ubuntu | ||
| arrick | guest, I dont know if they will work in here, are they exe? | 05:11 |
| arrick | oh ok | 05:11 |
| LinuxJones | bronson__: open a new tab in firefox ctrl+t | 05:11 |
| guest | arrick: yes | 05:11 |
| === aeolist [n=aeolist@ppp221.dialup.ntua.gr] has joined #ubuntu | ||
| === Kamping_Kaiser is now known as Kaiser_Sleeps | ||
| bronson__ | i don't think so. the firewall is disabled on the router | 05:11 |
| guest | arrick: I still don't have permission. I don't understand... | 05:11 |
| LinuxJones | bronson__: the modules arte loaded in the ubuntu kernel by default | 05:11 |
| cdubya | bronson__, I think they were talking about on the ubuntu boxes... | 05:11 |
| bronson__ | ok | 05:11 |
| === nalioth is now known as noirequus | ||
| guest | arrick: I modified the file verbadum... | 05:11 |
| LinuxJones | bronson__: type about:config | 05:11 |
| bronson__ | ok. how do i disable that? | 05:12 |
| arrick | ok | 05:12 |
| bronson__ | ok | 05:12 |
| LinuxJones | bronson__: follow my instructions | 05:12 |
| bronson__ | ok lol | 05:12 |
| LinuxJones | bronson__: :) | 05:12 |
| cdubya | heh | 05:12 |
| nsmith | _jason: ok done thanks | 05:12 |
| arrick | put your ubuntu username into the 'put your username here' spot next to ntfs guest | 05:12 |
| arrick | his will make you the owner of the partition | 05:13 |
| === irctourist [n=irctouri@cpe-071-065-198-049.nc.res.rr.com] has joined #ubuntu | ||
| arrick | this | 05:13 |
| nsmith | _jason: though, I dont really know what I just downloaded, or the significence of multiverse and universe | 05:13 |
| bronson__ | then? | 05:13 |
| Dyna-Work | Just curious, im going to install ubuntu later today with the hopes of running mythTV and dual outputting to a 1080i tv and a regular monitor, is anybody aware of any inconsistencies? | 05:13 |
| LinuxJones | bronson__: you have the options page open bronson__? | 05:13 |
| bronson__ | yup | 05:13 |
| LinuxJones | bronson__: in search type ipv6 | 05:13 |
| === erez [n=erez@89-138-60-24.bb.netvision.net.il] has joined #ubuntu | ||
| guest | arrick: here is the line: /dev/hda2 /media/hda2 ntfs ro,uid=guest,gid=guest0 0 | 05:13 |
| xstation | nickrud: thanks for your help when you have a minute you make want to look at http://www.ubuntuforums.org/showthread.php?t=151537 | 05:14 |
| guest | arrick: what should be the result? | 05:14 |
| bronson__ | ok | 05:14 |
| === E-bola [i=bola@a80-186-38-125.elisa-laajakaista.fi] has joined #ubuntu | ||
| arrick | your username is guest on your ubuntu system? | 05:14 |
| E-bola | Hello | 05:14 |
| xiaobai_ | the name of the downed files by using gftp is not type right | 05:14 |
| guest | arrick: Ha! Yes! | 05:14 |
| LinuxJones | bronson__: double click to disable ipv6 support | 05:14 |
| E-bola | where can i see what packages are included ont he ubuntu live cd? | 05:14 |
| arrick | oh ok | 05:14 |
| === _eins is now known as Ox0000 | ||
| bronson__ | ok | 05:14 |
| _jason | nsmith: synaptic should not have the stat error now. You had universe and multiverse enabled before, the bot will send you some info | 05:14 |
| LinuxJones | bronson__: so it says true ? | 05:14 |
| _jason | ubotu: tell nsmith about components | 05:14 |
| bronson__ | yes | 05:14 |
| === curlyman [n=jonathan@oh-newphilly-ter1h-228.clvdoh.adelphia.net] has joined #ubuntu | ||
| LinuxJones | bronson__: ok close all firefox windows and restart | 05:15 |
| arrick | _jason after a fstab is changed and saved, you dont have to restart anything do you? | 05:15 |
| LinuxJones | bronson__: by restart i mean launch firefox . Don't reboot your computer :D | 05:15 |
| curlyman | bronson__: hey | 05:15 |
| arrick | I cant remember | 05:15 |
| _jason | arrick: sudo mount -a, to remount everything I believe | 05:15 |
| bronson__ | lol | 05:15 |
| bronson__ | ok | 05:15 |
| guest | arrick: do I use sudo mount -a ? | 05:16 |
| === nto-ubu [n=nto@h52n2fls31o290.telia.com] has joined #ubuntu | ||
| arrick | guest, 'sudo mount -a' yes use it | 05:16 |
| nsmith | _jason: thanks again | 05:16 |
| arrick | after you save the file adn close it | 05:16 |
| bronson__ | hmmm | 05:16 |
| LinuxJones | bronson__: that should speed things up, also you should install the fasterfox plugin, Tools >> Extenstions (it's in the top 10 section) | 05:16 |
| nsmith | _jason: ubotu is a bot? | 05:16 |
| arrick | yeah | 05:16 |
| _jason | arrick: if instead of editing, you edited something that was already mounted, then you may need to umount and mount again | 05:16 |
| arrick | ok | 05:16 |
| bronson__ | i can't even start a download in Firefox now | 05:16 |
| guest | arrick: I did so. And yet...it still doesn't work. | 05:17 |
| _jason | arrick: change the first editing to ``adding'' | 05:17 |
| arrick | I'll tell him how | 05:17 |
| guest | arrick: BRB | 05:17 |
| LinuxJones | bronson__: what ? | 05:17 |
| _jason | ubotu: tell nsmith about yourself | 05:17 |
| arrick | hang on guest | 05:17 |
| === mendred [n=mendred@59.92.33.202] has joined #ubuntu | ||
| LinuxJones | bronson__: that's got nothing to do with what we jsut did | 05:17 |
| === helfrez [n=helfrez@bi01p1.nc.us.ibm.com] has joined #ubuntu | ||
| arrick | _jason how? | 05:17 |
| Yggdrassil | LinuxJones, bronson 's original problem is that he cannot download files with firefox. | 05:17 |
| nsmith | _jason: wow how bizarre | 05:17 |
| bronson__ | lol but now it won't even start. Before it timed out. now i cant get anything to start downloading | 05:17 |
| === rambo3 [n=rambo3@c-bff871d5.027-6-6b73641.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| _jason | arrick, guest: sudo umount /dev/<device> && sudo mount /dev/<device> | 05:18 |
| LinuxJones | Yggdrassil: he has file associations messed up then | 05:18 |
| Rdde | whats the easyest way to connect to the ubuntu "terminal" from windows? | 05:18 |
| arrick | ok | 05:18 |
| arrick | thanks | 05:18 |
| LinuxJones | Yggdrassil: I was helping him with timeouts | 05:18 |
| === ygetartson [n=s307473@p213.54.82.133.tisdip.tiscali.de] has joined #ubuntu | ||
| === funkyHat [n=matt@cpc2-nthc3-0-0-cust152.nrth.cable.ntl.com] has joined #ubuntu | ||
| Yggdrassil | LinuxJones, go ahead... no use 2 trying to solve the same problem, he just will get confused | 05:18 |
| arrick | guest 'sudo umount /media/hda2 && sudo mount /media/hda2' | 05:19 |
| LinuxJones | Yggdrassil: yeah, I have a few things to do atm | 05:19 |
| Rdde | easyest way to connect to ubuntu from windows? telnet? | 05:19 |
| arrick | guest, that should fix it | 05:19 |
| ygetartson | hi guys | 05:19 |
| === xiaobai [n=xiaobai@61.152.128.113] has joined #ubuntu | ||
| ygetartson | i lost my /home partition | 05:19 |
| === rajas [n=rajas@219.95.254.164] has joined #ubuntu | ||
| === coffee [n=coffee@ACCFC7DA.ipt.aol.com] has left #ubuntu ["Ex-Chat"] | ||
| ygetartson | im down and crying | 05:19 |
| arrick | ouch | 05:19 |
| === rajas is now known as dextro_dude | ||
| xiaobai | cft | 05:19 |
| guest | arrick: Yes!! It worked!! | 05:19 |
| budluva | does anyone here use a broadcom wireless card? | 05:20 |
| bronson__ | stuff is still timing out, like ubuntu updats | 05:20 |
| ygetartson | the reiserfs superblock is killed | 05:20 |
| === Bluekuja [n=bluekuja@host235-236.pool8254.interbusiness.it] has joined #ubuntu | ||
| Rdde | plz? how do you connect to an ubuntu comp from a windows comp? | 05:20 |
| Yggdrassil | Rdde, from dos prompt in windows: telnet ubuntu_I.P> | 05:20 |
| === Syntux [n=Jad@86.108.16.70] has joined #ubuntu | ||
| ygetartson | it happened after creating a new partition with partition magic | 05:20 |
| ygetartson | from xp | 05:20 |
| guest | arrick: thank you. Wow! That was important! | 05:20 |
| === leonel [n=leonel@201.123.94.180] has joined #ubuntu | ||
| nickrud | xstation, I'm not sure, sorry. But, I'd boot into ubuntu, run update-grub , grub-install, and see what happens. your mileage may vary :) | 05:20 |
| === greg_ [n=greg@ip-37-234.sn1.eutelia.it] has joined #ubuntu | ||
| dextro_dude | use putty to connect | 05:20 |
| Rdde | Yggdrassil, like telnet ubuntu_192.168.0.111? | 05:20 |
| arrick | yeah | 05:20 |
| arrick | did that help you out? | 05:21 |
| cdubya | yeah, putty | 05:21 |
| LinuxJones | budluva: yeah I have one but no wireless network to connect to | 05:21 |
| Yggdrassil | Rdde, no, just the IP of the ubunto workstation | 05:21 |
| Yggdrassil | u | 05:21 |
| arrick | guest, you got it going? | 05:21 |
| guest | arrick: Oh yes. It works now. Now I can access my FreeBASIC files. | 05:21 |
| Rdde | Yggdrassil, doesn't work.. do i have to activate something? | 05:21 |
| ygetartson | i tried to rebuild the superblock with reiserfsck --rebuild-sb | 05:21 |
| budluva | LinuxJones, whats the device name of your wireless card? my nic is eth0, my wireless card is eth1 | 05:21 |
| ygetartson | but failed | 05:21 |
| budluva | LinuxJones, should it be wlan1? or does the name matter at all? | 05:21 |
| LinuxJones | budluva: your running Breezy ? | 05:21 |
| budluva | dapper | 05:21 |
| Yggdrassil | Rdde, does the ubuntu workstation have the telnet server running and is remote login set to allow? | 05:21 |
| arrick | guest, ok, have fun, at least i was able to contribute to the page instead of drain a little more from it | 05:22 |
| === dpm [n=dpm@p54A12B84.dip0.t-ipconnect.de] has joined #ubuntu | ||
| xstation | nickrud: i can only bot into ubuntu | 05:22 |
| xstation | boot | 05:22 |
| Rdde | Yggdrassil, no, how do i activate it? | 05:22 |
| ygetartson | do you have a hint where to look for help? | 05:22 |
| LinuxJones | budluva: mine comes up as eth0, it uses the bcm43xx module | 05:22 |
| === timon [n=timon@31.varbergkabel-net03b.varberg.net] has joined #ubuntu | ||
| === Jimmey__ [n=james@user-4737.l1.c2.dsl.pol.co.uk] has joined #ubuntu | ||
| guest | arrick: Ha! That's all I do. Bug other people! Ha! Sir, Wine should be able to detect the Windows now. Right? | 05:22 |
| arrick | yeah | 05:22 |
| === treyh0_ is now known as treyh0 | ||
| Yggdrassil | Rdde, lemme see (I'm not an ubuntu specialist) | 05:22 |
| === Martolod [n=jeremy@ARennes-257-1-30-40.w81-53.abo.wanadoo.fr] has joined #ubuntu | ||
| === seth|away is now known as seth | ||
| void^ | ew telnet. use putty on windows for ssh. | 05:23 |
| cdubya | Rdde, you could start ssh, d'load putty, and use it. | 05:23 |
| LinuxJones | budluva: do you know what kind of broadcom card you have ? | 05:23 |
| budluva | LinuxJones, ok, so the name doesnt matter | 05:23 |
| nickrud | xstation, I understood that, and you don't have a debian entry in the ubuntu grub. those two commands should create one and make sure that the ubuntu menu.lst is used. | 05:23 |
| budluva | LinuxJones, broadcom 4318 | 05:23 |
| Yggdrassil | Rdde, system / administration / services (and see if telnet server is running) | 05:23 |
| arrick | guest, after 2 years of school for this stuff I should be able to help somehow | 05:23 |
| ygetartson | :'( | 05:23 |
| Shadowpillar | btw | 05:23 |
| Shadowpillar | for windows support, DO NOT USE THE UBUNTU VERSION OF WINE | 05:24 |
| === iteniel [n=iteniel@dsl51B7BE98.pool.t-online.hu] has joined #ubuntu | ||
| === rocio [n=rocio@83.230.233.88] has joined #ubuntu | ||
| LinuxJones | budluva: do lspci | grep Broadcom | 05:24 |
| Shadowpillar | use the one provided by the winehq.org repos | 05:24 |
| === E-bola [i=bola@a80-186-38-125.elisa-laajakaista.fi] has left #ubuntu [] | ||
| arrick | guest did you copy that from Shadowpillar ? | 05:24 |
| xstation | nickrud: but what about the sarge grub I am presently useing grub bootloader from sarge | 05:24 |
| iteniel | hi all! | 05:24 |
| LinuxJones | budluva: mine is an airforce 1 BCM4318 | 05:24 |
| iteniel | tud nekem valaki segteni? | 05:24 |
| === luisi_ [n=luisi@83.230.235.138] has joined #ubuntu | ||
| === jcplata [n=jcplata@200.30.101.4] has joined #ubuntu | ||
| budluva | 0000:03:07.0 Network controller: Broadcom Corporation BCM4318 [AirForce One 54g] 802.11g Wireless LAN Controller (rev 02) | 05:24 |
| Shadowpillar | best up to date version, and most apps will work with the current version much better (tenfold) than the version that comes with breezey | 05:24 |
| budluva | same card as you | 05:25 |
| nickrud | xstation, like I said, I'm not sure. That would be my first troubleshooting test. | 05:25 |
| ygetartson | does anyone know how to rescue a reiserfs partition with corrupted superblock? | 05:25 |
| arrick | Shadowpillar, guest is trying to run freebasic with wine, will it work? | 05:25 |
| LinuxJones | budluva: ok do sudo modprobe bcm43xx | 05:25 |
| === witless [n=witless@68.118.176.249] has left #ubuntu ["http://www.archive.org/details/Despotis1946] | ||
| Rdde | Yggdrassil, no telnet server running | 05:25 |
| iteniel | Hungari | 05:25 |
| LinuxJones | budluva: then launch network-admin and configure your card | 05:25 |
| budluva | nothing | 05:25 |
| xstation | nickrud : i will give it a try | 05:25 |
| budluva | modprobe shows nothing | 05:25 |
| ygetartson | this is really heavy | 05:25 |
| Shadowpillar | arrick: dunno, but the rule with wine is, if one version doesn't work, wait for the next | 05:25 |
| LinuxJones | budluva: that's a good thing :) | 05:25 |
| Shadowpillar | arrick: chances are it may with the latest version | 05:25 |
| jcplata | i have a hp deskjet 640c but i don't know how to configure. anyone can help me to configure it? | 05:26 |
| arrick | ok | 05:26 |
| budluva | linuxboy, lsmod shows the bcm43xx module though | 05:26 |
| Shadowpillar | which is actually a beta build, not an alpha nightly cvs landmark build | 05:26 |
| guest | arrick: good to know. ;) | 05:26 |
| LinuxJones | budluva: I'm not 100 % but I think it can only connect to open networks atm | 05:26 |
| Shadowpillar | 0.9.10 | 05:26 |
| arrick | yeah | 05:26 |
| budluva | hrmm | 05:26 |
| Shadowpillar | they do have an ubuntu repos | 05:26 |
| cdubya | ygetartson, what option did you use on the reiserfsck? | 05:26 |
| Shadowpillar | but they need it on a much better server | 05:26 |
| === quickquestion [n=kdizzle@ool-44c679dd.dyn.optonline.net] has joined #ubuntu | ||
| budluva | ya i have a secure network...maybe thats why i cant connect to it | 05:26 |
| Shadowpillar | it's based directly off sourceforge's server | 05:26 |
| budluva | hrmm...well ill try unsecure | 05:26 |
| Shadowpillar | usually why I just download the deb from the repo with wget | 05:27 |
| Yggdrassil | Rdde, I would say you might have to add the telnet deamon then... I would not be able to tell you how to do this. I just started evaluation ubuntu (which is debian based).. my main experience is with redhat which is rpm based when it comes to installing additional components. | 05:27 |
| arrick | guest you listening? | 05:27 |
| xstation | nickrud: when I boot up sarge is the fist option followed by sarge prompt then ubuntu and ubuntu prompt and mem test | 05:27 |
| === joel_ [n=joel@c-f6be72d5.013-38-73746f48.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| ygetartson | cdubya: --rebuild-sb | 05:27 |
| === vista [n=vista@222.33.200.30] has joined #ubuntu | ||
| vista | hi | 05:27 |
| ygetartson | then, --check | 05:28 |
| vista | need some help | 05:28 |
| Rdde | Yggdrassil, ok =) thanks for the help | 05:28 |
| cdubya | ygetartson, reiserfsck --rebuild-tree ???? | 05:28 |
| guest | arrick: yes. | 05:28 |
| arrick | vista, ask your question | 05:28 |
| budluva | LinuxJones, so just disable WEP on my wireless router right? and ubuntu should be able to connect? | 05:28 |
| arrick | ok | 05:28 |
| ygetartson | no | 05:28 |
| guest | arrick: ha! | 05:28 |
| === Lorvija [n=lorvija@dsl-lprgw5-fecdf900-132.dhcp.inet.fi] has joined #ubuntu | ||
| Yggdrassil | Rdde, at least you have an idea what to look for | 05:28 |
| ygetartson | this seemed to risk# | 05:28 |
| === Karpor [n=K4rp0r@pc.armas.fi] has joined #ubuntu | ||
| xstation | nickrud: can you give me the commands again at prompt please | 05:28 |
| ygetartson | y | 05:28 |
| Rdde | how can i connect to an ubuntu using telnet? | 05:28 |
| vista | hi, i got an error while install | 05:28 |
| vista | dpkg: error processing x11-common_7.0.0-0ubuntu25_i386.deb (--install): | 05:28 |
| vista | vista subprocess pre-removal script returned error exit status 10 | 05:28 |
| jcplata | anyone can help me to install a hp deskjet 640c in my computer? | 05:28 |
| nickrud | xstation, sudo update-grub && sudo grub-install /dev/hda | 05:29 |
| cdubya | Rdde, start ssh on your ubuntu box; download putty on the windows box. Open a putty session on windows and point the connection to the IP of the ubuntu box. | 05:29 |
| arrick | !printer | 05:29 |
| ubotu | printer is, like, totally, https://wiki.ubuntu.com/HardwareSupportComponentsPrinters or http://www.linuxprinting.org | 05:29 |
| vista | any suggesiton? | 05:29 |
| === budluva_ [n=budluva@d209-89-216-221.abhsia.telus.net] has joined #ubuntu | ||
| ygetartson | cdubya: this is the last chance, but can definitely destroy valuable remainders | 05:29 |
| cdubya | ygetartson, just looking...... | 05:29 |
| xstation | nickrud thanks exactly as you have written | 05:29 |
| arrick | jcplata, see if your printer is on the list, then someone might be able to help | 05:29 |
| Yggdrassil | Rdde, maybe you could snoop around in the add applications panel? (just an idea) | 05:29 |
| nickrud | jcplata, System-Admin-Printing, click new printer | 05:29 |
| arrick | thnks nickrud, i didnt know if it was supported | 05:30 |
| === tRSS [n=asiddiqu@202.174.142.2] has joined #ubuntu | ||
| === loststar4545 [n=loststar@12-221-142-119.client.insightBB.com] has joined #ubuntu | ||
| nickrud | arrick, I've seen that printer before, when I had a 940c | 05:30 |
| arrick | ok | 05:30 |
| tRSS | my ubuntu machine is not running the ssh service. How can i turn it on? | 05:30 |
| Davey | tRSS: install it :) | 05:30 |
| _jason | !ssh | 05:30 |
| ubotu | from memory, ssh is https://wiki.ubuntu.com/SSHHowto or https://wiki.ubuntu.com/AdvancedOpenSSH | 05:30 |
| tRSS | Davey: how? | 05:30 |
| tRSS | !ssh | 05:31 |
| Enthusiast78 | Anybody got kqemu packaged? | 05:31 |
| arrick | tRSS, follow the link above | 05:31 |
| Yggdrassil | hm | 05:31 |
| Yggdrassil | !telnet | 05:31 |
| ubotu | from memory, telnet is bad, use ssh (http://wiki.ubuntu.com/SSHHowto) | 05:31 |
| jcplata | arrick, nickrud :yes it is on the list but which resolution i have to use? | 05:31 |
| Yggdrassil | blah :P | 05:31 |
| tRSS | thanks guys! :) | 05:31 |
| === Yvonne [n=01101110@pdpc/supporter/active/Yvonne] has joined #ubuntu | ||
| arrick | nickrud you got way more experiance than me | 05:32 |
| loststar4545 | i trying to find a firefox icon to replace the blue world icon it uses now what dimensions should i use or anyone know where i can get one | 05:32 |
| arrick | !icon | 05:32 |
| ubotu | for icon see icons (and msg the bot i.e. >>/msg ubotu icon<< it does not spam the channel) | 05:32 |
| nickrud | jcplata, a sec | 05:32 |
| Yggdrassil | I wonder | 05:32 |
| ygetartson | hard disk changes from xp are really dangerous. i should have done nothing more than resize the ntfs partition, then reboot to ubuntu. instead, i used part.magic to create another ext2 partition there, which is now seen as a reiserfs partition... | 05:32 |
| Yggdrassil | !vpn | 05:32 |
| ubotu | vpn is, like, https://wiki.ubuntu.com/Gaming_VPN_Using_PPTPD | 05:32 |
| Yggdrassil | aha | 05:32 |
| jcplata | nickrud: ok | 05:32 |
| === rambo3_ [n=rambo3@c-bff871d5.027-6-6b73641.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| vista | hi | 05:32 |
| vista | anybody help? | 05:33 |
| === doober [n=doober@64-18-96-143.adsl.catt.com] has joined #ubuntu | ||
| xstation | nickrud: I think we have an answer where can I pate to show you please | 05:33 |
| === sclark [n=sclark@HSE-London-ppp3510403.sympatico.ca] has joined #ubuntu | ||
| === quickquestion [n=kdizzle@ool-44c679dd.dyn.optonline.net] has left #ubuntu [] | ||
| ygetartson | from fdisk. | 05:33 |
| cdubya | Rdde, http://www.chiark.greenend.org.uk/~sgtatham/putty/ | 05:33 |
| budluva_ | LinuxJones, ya, i go to activate eth1 (wireless card) and it just sits there | 05:33 |
| === Jimmey__ [n=james@user-4737.l1.c2.dsl.pol.co.uk] has left #ubuntu [] | ||
| Rdde | whats a good program to listen to webradio whit? (its going to be n 24/7) | 05:33 |
| tRSS | !firewall | 05:33 |
| ubotu | Ubuntu has, like every other linux distribution, firewalling built into the kernel. A simple frontend to this firewall is firestarter, which can be installed via synaptic. | 05:33 |
| Rdde | cdubya, thanks | 05:33 |
| === serfio [n=serafino@160.97.42.210] has joined #ubuntu | ||
| nickrud | jcplata, pick the resolution you would use most often, I'd guess | 05:34 |
| nickrud | xstation, http://paste.ubuntu-nl.org | 05:34 |
| cdubya | Rdde, np. do a sudo apt-get install openssh-server on your ubuntu box. once that's done, ssh is running. Then install putty on your windows box and create a connection that points to the IP address of your ubuntu box. It's actually pretty straightforward, but ask if you have issues. | 05:35 |
| === cintas [n=cintas@83.230.195.14] has joined #ubuntu | ||
| jcplata | nickrud: ok i will try,, let me a sec | 05:35 |
| serfio | sal e raga sono nuovo | 05:35 |
| serfio | salve | 05:35 |
| Rdde | cdubya, can i restrict what users will be able to connect over ssh? | 05:35 |
| === eduardo [n=eduardo@201.153.243.190] has joined #ubuntu | ||
| === gorduxxo [n=pvf@nat2.iscte.pt] has joined #ubuntu | ||
| cdubya | Rdde, afaik, just unix account users should be allowed. | 05:35 |
| === ciro_ [n=ciro@151.53.124.42] has joined #ubuntu | ||
| ciro_ | hi all | 05:35 |
| vista | what is "subprocess pre-removal script" plz | 05:36 |
| Storkme | what the fuck is going on | 05:36 |
| nickrud | jcplata, I don't have that printer, so some of the details you'll need to figure out. I can only give you a general walk through | 05:36 |
| Storkme | i just tried to install nvidia-glx and now it's removing everything i ever installed | 05:36 |
| vista | and why "subprocess pre-removal script returned error exit status 10"? | 05:36 |
| === meuserj|work [n=meuserj|@StandardLife-72-140-65.OneCall.Net] has joined #ubuntu | ||
| serfio | ma qui chi lo conosce bene ubuntu | 05:36 |
| xstation | nickrud: take a look please it talks about segmentation at the end | 05:36 |
| cdubya | Rdde, so whoever you have accounts created for on that ubuntu box should be able to login. | 05:36 |
| cdubya | Rdde, but only those. | 05:36 |
| serfio | c' qualcuno che parla italiano | 05:36 |
| === Lorvija [n=lorvija@dsl-lprgw5-fecdf900-132.dhcp.inet.fi] has joined #ubuntu | ||
| cdubya | !it | 05:37 |
| ubotu | Vai su #ubuntu-it o su #kubuntu-it se vuoi parlare in italiano, in questo canale usiamo solo l'inglese. Grazie! | 05:37 |
| Rdde | cdubya, if I dont want all the unix users to be albe to connect, can i do that? | 05:37 |
| tRSS | !firestarter | 05:37 |
| ubotu | Ubuntu has, like every other linux distribution, firewalling built into the kernel. A simple frontend to this firewall is firestarter, which can be installed via synaptic. | 05:37 |
| === LathropWells [n=bill@cpe-72-134-66-177.socal.res.rr.com] has joined #ubuntu | ||
| === stylesP [n=stylesp@80-218-99-195.dclient.hispeed.ch] has joined #ubuntu | ||
| === nkour [n=nkour@ppp14-adsl-119.ath.forthnet.gr] has joined #ubuntu | ||
| nkour | hello everyone | 05:37 |
| === caplink811-log [n=caplink8@dslb-088-073-104-112.pools.arcor-ip.net] has joined #ubuntu | ||
| cdubya | Rdde, not absolutely sure, but I think you could set their default shell to be /bin/false and they couldn't login......afaik anyways. | 05:37 |
| jcplata | nickrud: thank you, now the printer it's function very well... thanks a lot | 05:38 |
| ygetartson | cdubya: where could i get more informed about the prob? | 05:38 |
| nkour | lsb_release is this executable BUGGY in Ubuntu? | 05:38 |
| cdubya | ygetartson, I was just googling about it.....:) | 05:38 |
| nkour | in Dapper at least | 05:38 |
| === hatake_kakashi [n=meh@60-240-246-244.tpgi.com.au] has joined #ubuntu | ||
| nickrud | xstation, that error is different from yours. False alarm. :) | 05:38 |
| Yggdrassil | cdubya, yup, that or /dev/null (works to) | 05:38 |
| === grogoreo [n=grogoreo@sheeran.plus.com] has joined #ubuntu | ||
| grogoreo | hi | 05:38 |
| grogoreo | for some reason when I visit sites using Firefox, the only way I can view the page is if I resize the window and the rendered page will display | 05:38 |
| nkour | lsb_release --id --codename --release --short ==> 6.06 | 05:38 |
| === knanand [n=kutty@202.142.108.254.zeeaccess.com] has joined #ubuntu | ||
| cdubya | Yggdrassil, good, I'm not absolutely off the rocker in the corner o'the room on that one.....:) | 05:38 |
| === sfari [n=email@36.varbergkabel-net01c.varberg.net] has joined #ubuntu | ||
| xstation | nickrud: so still have to find out I suppose | 05:39 |
| === serfio [n=serafino@160.97.42.210] has left #ubuntu ["Sto] | ||
| nkour | in oly accepts last arguemnt! | 05:39 |
| Yggdrassil | cdubya, me neither :P | 05:39 |
| === Tomcat_ [n=Tomcat@p54A18B7C.dip0.t-ipconnect.de] has joined #ubuntu | ||
| ciro_ | i need help to mount my usb device. pmount cant load it automatically | 05:39 |
| cdubya | heh | 05:39 |
| ygetartson | cdubya: you are still in it? wow, i have to grow my time feeling a little better to fit IRC standards :D | 05:39 |
| cdubya | heh | 05:39 |
| nickrud | xstation, but, update-grub did not find your sarge partition | 05:39 |
| xstation | nickrud: which means? | 05:39 |
| cdubya | ygetartson, I've found a few things, but it takes a little "sifting".... | 05:39 |
| nickrud | xstation, you'll need to add it by hand | 05:40 |
| === Hoxzer [n=niko@a80-186-169-248.elisa-laajakaista.fi] has joined #ubuntu | ||
| === byronman [n=byron@dsl-130-247.aei.ca] has joined #ubuntu | ||
| ygetartson | yes, i imagine that | 05:40 |
| === green_earz [n=admin@213-232-83-67.dsl.prodigynet.co.uk] has joined #ubuntu | ||
| Enthusiast78 | I need kernel sources to build a kernel module but the kernel-source package available from aptitude (kernel-source-2.6.11 or kernel-source-2.6.10) doesn't match my running kernel (2.6.12-9). Do I have to upgrade my kernel-image? | 05:41 |
| ygetartson | but i think, i just have to have time now, as much as it takes | 05:41 |
| === Stormx2 [n=Stormx2@host-87-240-137-127.hi-velocity.net] has joined #ubuntu | ||
| knanand | I'm not able to browse files on my drives... When I goto Desktop on Places menu I get an error "There is no default action associated with this location." Why is it? How can I solve This? Somebody please Help Me... | 05:41 |
| cdubya | ygetartson, yeah | 05:41 |
| === rcaskey_ [n=rcaskey@cai17.music.uga.edu] has joined #ubuntu | ||
| === rcaskey_ [n=rcaskey@cai17.music.uga.edu] has joined #ubuntu | ||
| Yggdrassil | apt-get install openvpn - E: Couldn't find package openvpn ???? | 05:42 |
| cdubya | ygetartson, I just googled for "rebuilding reiser superblock on ubuntu" | 05:42 |
| ana | Hirvinen, i have downloaded OO2, but the launcher still launched OOo 1.1.5. i right-clicked on it to change the preferences and the launcher editor came up; i changed the path and then thelauncher didn't work, have changed it back to what it was but again it doesnt work - killed. ideas please... | 05:42 |
| Yggdrassil | oookay | 05:42 |
| ygetartson | cdubya: did that produce something nice? | 05:42 |
| cdubya | Rdde, you get it installed? | 05:42 |
| ana | ooops sorry meant to say Hi, not Hirvinen | 05:42 |
| === jadams [n=jadams@cs6625119-172.bham.res.rr.com] has joined #ubuntu | ||
| Stormx2 | Sound recorder is broken... I get "ALSA Device "default" had an error"... what do I do now? I really need this... | 05:42 |
| === merhojt [n=Jimmy@194-16-251-86.customer.telia.com] has joined #ubuntu | ||
| === bina [n=bina@81-179-83-225.dsl.pipex.com] has joined #ubuntu | ||
| cdubya | ygetartson, got lot's o'hits.....but google doesn't give me a nicety rating yet. | 05:42 |
| cdubya | :) | 05:42 |
| vista | could anyone tell how can i return to pure cmdline from xwindows? | 05:42 |
| Stormx2 | shouldn't have followed that stupid guide on the forums... | 05:42 |
| ana | knanand, you don't browse your files with places | 05:43 |
| ygetartson | :) | 05:43 |
| Rdde | cdubya, will im getting secont tought =) will probably do it latet tonight.. thanks for you help mate | 05:43 |
| cdubya | Rdde, np. | 05:43 |
| knanand | ana: How else??? | 05:43 |
| ana | knanand, you do applications, accessories, file manager | 05:43 |
| Yggdrassil | vista, you mean as in not booting into gui? | 05:43 |
| vista | or exit it | 05:43 |
| ana | sorry knanand file browser | 05:43 |
| nto-ubu | i get the message "No files to extract" when typing "unrar x ~/Downloads/FILENAME.rar ~/Downloads/" .. what am i doing wrong? | 05:43 |
| ygetartson | i think, with an ext fs, the sb might have been backuped | 05:44 |
| knanand | ana: Idon't find File Manager or Browser... | 05:44 |
| ygetartson | but this way, not. | 05:44 |
| Yggdrassil | vista, you would have to go whateverkernel-TUI when booting.. then you would use terminal only.. you can go gui by typing startx.. and exit gui by login off.. | 05:44 |
| Rdde | my ubuntu fileserver is going to play webradio 24/7.. anyone have a sugestion what program to use? | 05:44 |
| Stormx2 | Tell you what, could someone run "gstreamer-properties" and tell me what the default sink and source are? | 05:44 |
| ana | knanand, you might have it in system tools? | 05:44 |
| vista | opening terminal, and input "login off"? | 05:45 |
| ana | in the latest stable version, it is in Applications - > accessories - > file browser | 05:45 |
| Yggdrassil | vista, maybe I missunderstood you... can you repeat? | 05:45 |
| Rdde | anyone has an ide what program to use for 24/7 webradio? | 05:45 |
| vista | yes, i'd like to exit gui | 05:46 |
| knanand | ana : Idont find it anywhere... | 05:46 |
| === telemaco [n=telemaco@84.77.61.106] has left #ubuntu [] | ||
| cdubya | Rdde, you're wanting to just play an audio stream? | 05:46 |
| Storkme | when i start xserver/gnome it freezes on "Window Manager" | 05:46 |
| Yggdrassil | vista, log off (from the graphical menu) | 05:46 |
| vista | i want a pure cmdline envirenment for some updating | 05:46 |
| Yggdrassil | or log out | 05:46 |
| arrick | vista system>logout>logout | 05:46 |
| Rdde | cdubya, yeh,, as easy as possible | 05:46 |
| Rdde | cdubya, want it to play 24/7 =) | 05:46 |
| Rorgo | Yggdrassil: you were right, the locales were messed up on my system apparently | 05:46 |
| cdubya | Rdde, Rythmbox? | 05:46 |
| ana | knanand, try places home folder... | 05:47 |
| Yggdrassil | vista, if you want to go pure terminal mode (shell), you have to restart the workstation, and on the boot menu, you choose the TUI boot mode (Test User Interface) | 05:47 |
| vista | but there is no selection like "return to cmd" or "exit gui" | 05:47 |
| cdubya | Rdde, You can setup a new Internet Radio Station under File | 05:47 |
| === TiffOn [n=TiffOn@unaffiliated/tiff0n] has joined #ubuntu | ||
| Yggdrassil | text .. not test | 05:47 |
| vista | i got it | 05:47 |
| === dsr [n=fboyer@HSE-Montreal-ppp3464805.sympatico.ca] has joined #ubuntu | ||
| Storkme | when i start xserver/gnome it freezes on "Window Manager" | 05:47 |
| arrick | vists, logout out wll put you to command | 05:47 |
| cdubya | Rdde, err, under Music | 05:47 |
| green_earz | Rdde: check out streamtuner | 05:48 |
| vista | no, arrick | 05:48 |
| Rdde | green_earz, sounds good what is it? | 05:48 |
| vista | reboot might be a good suggestion | 05:48 |
| vista | i will try | 05:48 |
| arrick | vista, really, it does on mine | 05:48 |
| takedown | !easysource | 05:48 |
| ubotu | For an easy to use custom sources.list creator, visit http://ubuntulinux.nl/source-o-matic | 05:48 |
| knanand | ana : In places i have Desktop, my mount medias and then search for files and recent documents... | 05:48 |
| Yggdrassil | vista, ok... follow this | 05:48 |
| xstation | nickrud: ok give me a clue something like title sarge kernel 2.6.12-10-386 (recovery mode) (on /dev/hda0) | 05:49 |
| xstation | root (hd0,0) | 05:49 |
| xstation | kernel /boot/vmlinuz-2.6.12-10-386 root=/dev/hda0 ro single | 05:49 |
| xstation | initrd /boot/initrd.img-2.6.12-10-386 | 05:49 |
| xstation | savedefault | 05:49 |
| vista | i got relog in on mine | 05:49 |
| xstation | boot if this is incorrect please tell me | 05:49 |
| ana | knanand, it looks like you need to do a serious update/upgrade... | 05:49 |
| arrick | ok | 05:49 |
| === igcek [n=ubuntu@clj22-212.dial-up.arnes.si] has joined #ubuntu | ||
| green_earz | Rdde: internet radio app. as all the listing of shoutcast | 05:49 |
| ygetartson | cdubya: do you knew of a tool to read the content of a corrupt reiserfs partition, or to make a copy? | 05:49 |
| Yggdrassil | vista, start the computer.. from the boot menu, choose one of the TUI modes (Text User Mode).. you will end up on a login prompt.. log in.. if you then want GUI, you have to start the Xserver manualy by typing startx | 05:49 |
| arrick | when you relogin, you choose the tui from there vista | 05:49 |
| === epinephrine [i=geek@82-37-152-150.cable.ubr01.wals.blueyonder.co.uk] has joined #ubuntu | ||
| === udk is now known as UdontKnow | ||
| vista | thanks | 05:49 |
| vista | i know | 05:49 |
| arrick | ok | 05:50 |
| vista | bye for a reboot | 05:50 |
| arrick | yep | 05:50 |
| === krisg [i=Krisg@210.213.144.86] has joined #ubuntu | ||
| === hatake_kakashi [n=meh@60-240-246-244.tpgi.com.au] has joined #ubuntu | ||
| ygetartson | cdubya: i really have nothing near to a backup | 05:50 |
| arrick | I gotta go, later | 05:50 |
| === kent [n=kent@kr-lun-89-144-233-83.3.cust.bredband2.com] has joined #ubuntu | ||
| green_earz | Rdde:http://www.shoutcast.com/ | 05:50 |
| nickrud | xstation, please don't paste here ; and yes (that's not the kernel you show in your debian grub, by the way) | 05:50 |
| === epinephrin [i=geek@82-37-152-150.cable.ubr01.wals.blueyonder.co.uk] has joined #ubuntu | ||
| cdubya | ygetartson, ouch. That was what I was going to suggest....... | 05:50 |
| === lucaaas [n=lucas@h99n13c1o1124.bredband.skanova.com] has joined #ubuntu | ||
| ygetartson | ouch. | 05:50 |
| Yggdrassil | accordingly you could change the runlevel from 5 to 3 but since ubuntu gives you a tui boot option it's better to opt for that way | 05:50 |
| igcek | excuse me, is there any possibility to get instalation cd for ubuntu large for ex a 1mb, and when it boots it gets all the kernel and everyhing thru internet? thank you for the reply | 05:51 |
| Yggdrassil | igcek, you mean like suse does, a network install disk? | 05:51 |
| igcek | ya | 05:51 |
| knanand | ana: I use 5.10... Can i install any thing. I am new to Linux and i find it very difficult to do some common tasks, Like playing music, browsing files, Movies.... | 05:52 |
| xstation | nickrud: in the sare grub but is it exacly correct if not tell me please where the correction shuold be | 05:52 |
| cdubya | ygetartson, the one site I saw suggested doing that to another drive at least to recover the files....then running the --rebuild-tree, at least I think that's the order he did it in. | 05:52 |
| === caglar_ [n=caglar@dslb-084-056-084-009.pools.arcor-ip.net] has joined #ubuntu | ||
| xstation | sarge | 05:52 |
| nickrud | Yggdrassil, just so you know, ubuntu doesn't use run levels for controlling the gui/terminal startup ; it boots into rc.2 | 05:52 |
| === chris [n=flamin87@c220-237-79-141.kelvn1.qld.optusnet.com.au] has left #ubuntu [] | ||
| nickrud | *rc2.d i mean | 05:52 |
| ygetartson | cdubya: ok. how can 1 do this? | 05:52 |
| trainer | is anyone else here using eclipse? | 05:52 |
| === kl [n=kl@p548F5A56.dip.t-dialin.net] has joined #ubuntu | ||
| === urza [n=urza@mpool2-233.tsrv.ru] has joined #ubuntu | ||
| truz24 | trainer, I use eclipse. | 05:53 |
| === Ilokaaaasu [n=matti@dsl-aur-ff27c000-33.dhcp.inet.fi] has joined #ubuntu | ||
| ygetartson | the part is not mountable | 05:53 |
| === Seatux [n=Seatux@218.111.22.167] has joined #ubuntu | ||
| Yggdrassil | nickrud, ic... well I just started experimenting with this debian based system... I have been using redhat for ages | 05:53 |
| nickrud | xstation, title Debian GNU/Linux, kernel 2.4.27-2-386 <-- this is what your grub says you have | 05:53 |
| loststar4545 | whats the best program for podcasts | 05:53 |
| Yggdrassil | igcek, maybe this is of some help: http://gridpt1.fe.up.pt/mlopes/blog/index.php/ubuntu-network-install/ | 05:53 |
| === lwelyn [n=lwelyn@p549A664F.dip.t-dialin.net] has joined #ubuntu | ||
| trainer | truz24: have you experienced problems installing plugins? | 05:54 |
| === urza [n=urza@mpool2-233.tsrv.ru] has left #ubuntu ["Leaving"] | ||
| whaley | trainer: what types of problems? | 05:54 |
| === TSCHAK [n=thomas@71-208-166-27.hlrn.qwest.net] has joined #ubuntu | ||
| truz24 | just put the plugin in the plugins directory... | 05:54 |
| truz24 | thats what i do | 05:54 |
| truz24 | I use the tomcat plugin | 05:54 |
| xstation | nickrud: ok thanks then that part needs to be altered what about the words letters and spaves in the rest of the line please | 05:54 |
| === vidchi [n=vidchi@216.75.2.64] has joined #ubuntu | ||
| === Alex_BO2 [n=alex@adsl-ull-1-202.51-151.net24.it] has joined #ubuntu | ||
| xstation | spaces | 05:54 |
| trainer | truz24 i meant from within eclipse using and update url | 05:54 |
| nickrud | Yggdrassil, yeah, I figured that :) rc2.d -> rc5.d are the same. invoke-rc.d gdm stop is the way you'd do that | 05:54 |
| Yggdrassil | truz24, that, or create a link to it (ln -s) | 05:55 |
| truz24 | no, i do not use it that way. | 05:55 |
| truz24 | Yggdrassil, i'm using it under windows currently. | 05:55 |
| Yggdrassil | truz24, ic | 05:55 |
| === Zdra [n=zdra@81.247.172.23] has joined #ubuntu | ||
| === caplink811-log is now known as caplink811_log | ||
| === Bad_Magic [n=No@c-24-11-174-99.hsd1.mi.comcast.net] has joined #ubuntu | ||
| trainer | whaley: it seems that when I install eclipse via synaptic, it stores the features in /usr/share, while eclipse expects them to be located in /usr/lib | 05:55 |
| === operative [n=operativ@dynamic-62-56-11-157.park-s46b.dslaccess.co.uk] has joined #ubuntu | ||
| nickrud | xstation, if you do have a 2.4.27 kernel, you should be able to cut and paste from one menu.lst to the other. | 05:56 |
| ygetartson | does anyone know how to make a raw copy of a hdd partition? | 05:56 |
| === operative is now known as hyakuhei | ||
| Yggdrassil | nickrud, I must admit though, my first impressions are positive, ubuntu 5.10 detected all my hardware (including the acton wifi card - using madwifi) during installation. | 05:56 |
| Rdde | green_earz, shutcast is just for win= | 05:56 |
| whaley | trainer: I would install eclipse without using syanptic | 05:56 |
| === sYs^ is now known as sYs`afk | ||
| ana | my problem's been fixed, thanks | 05:56 |
| cdubya | ygetartson, just a sec | 05:57 |
| whaley | trainer: there were some hair permissions problems when i installed with syanptic | 05:57 |
| nickrud | Yggdrassil, I haven't used redhat since around 7.3, and ubuntu is way better :) | 05:57 |
| whaley | trainer: most of which dealt with plugins that didn't work correctly due to those permissions | 05:57 |
| === bur[n] er [n=burner@c-67-173-243-73.hsd1.co.comcast.net] has joined #ubuntu | ||
| xstation | nickrud: but its not in the ununtu menu.1st | 05:57 |
| Yggdrassil | nickrud, well once you work out the security bugs maybe :P | 05:57 |
| === eduardo [n=eduardo@201.153.243.190] has joined #ubuntu | ||
| nickrud | xstation, you need to add it | 05:57 |
| cdubya | ygetartson, maybe here? http://www.clasohm.com/blog/archive/2005/01/ | 05:57 |
| === zmo [n=zmo1138@62.58.40.86] has joined #ubuntu | ||
| _jason | xstation: make sure you do menu.lst, with a lowercase L, not menu.1st | 05:57 |
| ygetartson | thx, *reading* | 05:58 |
| nickrud | Yggdrassil, what stinkin' security bugs, lol | 05:58 |
| === ___david___ [n=david@Qf528.q.pppool.de] has joined #ubuntu | ||
| cdubya | ygetartson, np. Sorry, I gotta run. I'll be back on after a bit. | 05:58 |
| trainer | whaley: ok. figured i have to install one or the other manually. eclipse-platform has pretty numerous dependencies though | 05:58 |
| === cdubya [n=chris@207.192.218.163] has left #ubuntu [] | ||
| Yggdrassil | nickrud, storing passwords in clear text?? tsk tsk... | 05:58 |
| === kjcole [n=kjcole@ubuntu/member/kjcole] has joined #ubuntu | ||
| Yggdrassil | hehe | 05:58 |
| green_earz | Rdde: no you can stream direct off the shoutcast site or use streamtuner. aptitude show streamtuner | 05:59 |
| ygetartson | bye, then | 05:59 |
| knanand | How to browse files, listen Music, Play Music??? Please Help Me... | 05:59 |
| xstation | nickrud: yes i know but I do not know what to add in the sarge menu. lst I gave an example but I need to know what the exact line will be | 05:59 |
| Yggdrassil | nickrud, but I have to admit from the hardware support point, it's pretty good.. more hardware support than redhat... | 05:59 |
| === yeonhoo [n=yeonhoo@201.66.25.141] has joined #ubuntu | ||
| === amnezia [n=amnezia@p5080D61A.dip.t-dialin.net] has joined #ubuntu | ||
| nickrud | xstation, I gotta go for a bit: but what you're doing is copying from the debian menu.lst to the ubuntu one. It may not fix your problem, but you'll be working in just one, and the ubuntu one (more likely to get help here with that) One last thing, be sure that you have the right kernel identified | 06:00 |
| === SilverSpace_ [n=SilverSp@83-131-66-54.adsl.net.t-com.hr] has left #ubuntu [] | ||
| knanand | How to browse files, listen Music, Play Music??? Please Help Me... | 06:01 |
| === ckasprzak [n=ckasprza@69-162-199-115.bflony.adelphia.net] has joined #ubuntu | ||
| === lupito [n=ubuntu@200.107.47.70] has joined #ubuntu | ||
| === amnezia [n=amnezia@p5080D61A.dip.t-dialin.net] has left #ubuntu ["Leaving"] | ||
| nickrud | Yggdrassil, I have simple hardware needs, but the most important part I've seen is the plethora of tools for maintaining the system. | 06:01 |
| xstation | nickrud: ok thanks I will not bother with sarge for the moment I will stay with ubuntu | 06:01 |
| === knanand [n=kutty@202.142.108.254.zeeaccess.com] has left #ubuntu [] | ||
| _jason | knanand: places menu > home, applicatiosn > sound and video > rhythmbox | 06:01 |
| === jeddy3 [n=mattias@81-234-85-40-o1122.telia.com] has joined #ubuntu | ||
| === jessy_ [n=jessy@4va54-1-81-56-98-29.fbx.proxad.net] has joined #ubuntu | ||
| whaley | trainer: what is eclipse platform? | 06:02 |
| === HedgeMage [i=me@freenode/staff/HedgeMage] has joined #ubuntu | ||
| === ogra [n=ogra@ubuntu/member/ogra] has joined #ubuntu | ||
| === nkour [n=nkour@ppp14-adsl-119.ath.forthnet.gr] has left #ubuntu ["Leaving"] | ||
| nickrud | xstation, sarge has it's uses, but I'd use unstable on a desktop. Now, I really gotta go. See you | 06:02 |
| === nickrud [n=aias@ppp-70-250-225-194.dsl.hstntx.swbell.net] has left #ubuntu ["Ex-Chat"] | ||
| === susus_ [n=sz@p5089FE7E.dip.t-dialin.net] has joined #ubuntu | ||
| Yggdrassil | nickrud, my 2 main concerns are security and the ability to use the LTmodem and the Action wifi card... under redhat it has been proven a pain to set those up on my IBM thinkpad.. Ubuntu installed and configured the devices in a breeze... now I am testing and hardening the security of the system | 06:02 |
| === sheridan2025 [n=sheridan@lns-bzn-30-82-253-167-146.adsl.proxad.net] has joined #ubuntu | ||
| Yggdrassil | acton.. not action | 06:03 |
| trainer | whaley: the package i grab from synaptic | 06:03 |
| === h0nus [n=h0nus@c-71-193-230-158.hsd1.or.comcast.net] has joined #ubuntu | ||
| bronson | Is anyone else running the regular Ubuntu kernel with >1G of RAM? | 06:03 |
| whaley | trainer: that installs eclipse and what else? | 06:03 |
| bronson | I have 1.5G in my laptop but memory usage never goes above 1.0G. | 06:03 |
| whaley | trainer: i recall syanptic only installing eclipse and that was it | 06:03 |
| h0nus | can someone tell me the proper method for installing .rpm files? | 06:04 |
| === ckasprzak [n=ckasprza@69-162-199-115.bflony.adelphia.net] has left #ubuntu [] | ||
| Yggdrassil | h0nus, rpm -ivh rpmfile.rpm | 06:04 |
| apokryphos | Yggdrassil: no, not on Ubuntu | 06:04 |
| Yggdrassil | he asked about rpm files | 06:04 |
| === vista [n=vista@222.33.200.29] has joined #ubuntu | ||
| h0nus | ty | 06:04 |
| apokryphos | h0nus: there is no proper method; Ubuntu is a debian-based system and thus uses the .deb package management system. | 06:04 |
| === mily [n=mily@staticline24032.toya.net.pl] has joined #ubuntu | ||
| vista | i failed | 06:04 |
| Rdde | i get unexpected edning of stream when trying to listen to webradio in rythmbox | 06:05 |
| bronson | You can use alien to convert rpms to debs. | 06:05 |
| bronson | And bac. | 06:05 |
| === lupito [n=ubuntu@200.107.47.70] has joined #ubuntu | ||
| === mily [n=mily@staticline24032.toya.net.pl] has left #ubuntu ["Leaving"] | ||
| h0nus | will the rpm commadn work? | 06:05 |
| vista | i cannot find a selection about booting with cmdline | 06:05 |
| trainer | whaley: checking... | 06:05 |
| apokryphos | h0nus: your best chance is to always use alien, really. | 06:05 |
| bronson | Rdde, that's better than I get. Rhythmbox streaming is notoriously buggy. | 06:05 |
| Yggdrassil | h0nus, not with ubuntu | 06:05 |
| bronson | rpm | 06:05 |
| Rdde | bronson, what to use then? | 06:05 |
| apokryphos | h0nus: what are you trying to install? | 06:06 |
| === solid_liq [n=mike@c-67-167-98-109.hsd1.il.comcast.net] has joined #ubuntu | ||
| LathropWells | rdde - i use streamtuner | 06:06 |
| bronson | Personally, I use xmms. Rock solid. | 06:06 |
| vista | can i boot with only cmdline? | 06:06 |
| bronson | AND I WISH THERE WAS SOMETHING BETTER!!! | 06:06 |
| h0nus | i'm trying to find an asci c compiler | 06:06 |
| === yk [n=yk@sn50.informatik.uni-bremen.de] has joined #ubuntu | ||
| vista | i can set something to do this befroe | 06:06 |
| === mantono [n=mantono@c83-250-204-173.bredband.comhem.se] has joined #ubuntu | ||
| h0nus | preferably a binary so i don't have to compile | 06:06 |
| apokryphos | bronson: are you kidding? | 06:06 |
| bronson | It drives me nuts that I'm still using xmms, 6 years later. | 06:06 |
| _jason | h0nus: what does an asci c compiler do? | 06:06 |
| Yggdrassil | bronson, :P | 06:06 |
| jeddy3 | asci c compiler? | 06:06 |
| apokryphos | bronson: there are many far superior applications | 06:07 |
| TSCHAK | bronson, try banshee | 06:07 |
| Rdde | LathropWells, how to get? apt-get? | 06:07 |
| === jind [n=jind@dsl249-249.adsl.no] has joined #ubuntu | ||
| jeddy3 | or ansi c compiler? | 06:07 |
| bronson | TSCHAK, banshee doesn't do streaming. | 06:07 |
| solid_liq | bronson: personaly I use a combination of mpd and amarok | 06:07 |
| Yggdrassil | apt-get can't find packages... did I miss something? | 06:07 |
| LathropWells | install the streamtuner package with synaptic and it will install and configure xmms for internet radio and make 200+ radio station presets available | 06:07 |
| h0nus | it's a necessary component for another application i'm trying to install, which compiles some processes in c | 06:07 |
| === slack_prad [n=slack_pr@59.92.43.42] has left #ubuntu [] | ||
| _jason | Yggdrassil: what package? | 06:07 |
| jeddy3 | h0nus, but asci? | 06:07 |
| solid_liq | bronson: I need to get around to finding out if there's a way to use amarok to control mpd though :D | 06:07 |
| apokryphos | Yggdrassil: apt-cache search | 06:07 |
| Yggdrassil | _jason, openvpn | 06:07 |
| LathropWells | shoutcast and a few others | 06:08 |
| jeddy3 | h0nus, you mean an ordinary ansi c compiler, like gcc? | 06:08 |
| === aeho [n=aeho@cable-vlk-fe76de00-27.dhcp.inet.fi] has joined #ubuntu | ||
| _jason | ubotu: tell Yggdrassil about universe | 06:08 |
| h0nus | yes | 06:08 |
| === healot [n=healot@203.92.154.36] has joined #ubuntu | ||
| === zwf [n=zwf@218.109.119.36] has joined #ubuntu | ||
| bronson | solid_liq, I liked the idea behind mpd. I hope the UIs will catch up. | 06:08 |
| apokryphos | h0nus: install the build-essential package | 06:08 |
| h0nus | gcc is exactly what i'm looking for | 06:08 |
| h0nus | ok | 06:08 |
| h0nus | ty | 06:08 |
| Yggdrassil | _jason, I figured I missed something | 06:08 |
| Yggdrassil | thx | 06:08 |
| jeddy3 | h0nus, yes, what apokryphos said :) | 06:08 |
| === greg_ [n=greg@ip-37-234.sn1.eutelia.it] has joined #ubuntu | ||
| healot | freaking pppd "receive-all" options | 06:09 |
| solid_liq | bronson: that's why I'm hoping to be able to use amarok to control it someday. Right now I just use the CLI to control it. | 06:09 |
| === gmi01 [n=gmi01@62.84.85.68] has joined #ubuntu | ||
| === yk [n=yk@sn50.informatik.uni-bremen.de] has left #ubuntu ["Leaving"] | ||
| gmi01 | hello anyone i how can I add hostname completion? | 06:09 |
| === raphink [n=raphink@ubuntu/member/raphink] has joined #ubuntu | ||
| h0nus | i'm working as best i can with ubuntu because i cannot get gentoo to install for the life of me =\ | 06:09 |
| Yggdrassil | what's this synaptic everyone is talking about? a different package installer? | 06:09 |
| === tane| [n=acid9871@hoas-fe2fdd00-242.dhcp.inet.fi] has joined #UBUNTU | ||
| === slack_prad [n=slack_pr@59.92.43.42] has joined #ubuntu | ||
| === steffen [n=steffen@x1-6-00-10-dc-f2-14-6c.k675.webspeed.dk] has joined #ubuntu | ||
| === shajiphilip [n=shajiphi@pool-71-252-212-74.dllstx.fios.verizon.net] has joined #ubuntu | ||
| === miranda [n=miranda@83.230.235.204] has joined #ubuntu | ||
| Rdde | how do i start a program in a terminal and be able to close the terminal? | 06:11 |
| Yggdrassil | h0nus, gentoo is pretty complex to install.. it requires some working knowledge of linux... if you are rather new to the linux world, you are better of for the time being with distributions like ubuntu, mandriva or fedora | 06:11 |
| solid_liq | h0nus: I'm actually switching all my computers away from gentoo; it's way too much of a pain to maintain | 06:11 |
| Matic`Makovec | Rdde, you could screen it maybe | 06:11 |
| h0nus | hmm | 06:11 |
| healot | add "&" | 06:11 |
| miranda | quieres salir com migo | 06:11 |
| h0nus | i hear it is very flexible | 06:11 |
| AngryElf | hey all, I just installed apache from synaptic, but /etc/init.d/httpd doesn't exist......how do i stop/start the service, etc? | 06:12 |
| shajiphilip | HI EVERYBODY..is this a place to ask Question about ubuntu (ima a newbie) | 06:12 |
| === redguy [n=mati@adt99.neoplus.adsl.tpnet.pl] has joined #ubuntu | ||
| Yggdrassil | h0nus, it is yes... but you first need to understand how linux works.. babysteps man | 06:12 |
| whaley | h0nus: to piggy back what Yggdrassil said, I would learn the bare fundamentals from something besides gentoo first, then try gentoo later | 06:12 |
| Matic`Makovec | AngryElf, you could do it by apachectl start/stop/restart | 06:12 |
| === miranda [n=miranda@83.230.235.204] has joined #ubuntu | ||
| miranda | ovnvnjvv | 06:12 |
| Matic`Makovec | or if you downloaded apache2 it's apache2ctl | 06:12 |
| green_earz | Rdde: have a look at screen > http://www.hn2.org/docs/tbg/screen.html | 06:12 |
| whaley | h0nus: gentoo is a great distro to learn the ins and outs, but can be absolutely daunting and painful to a beginner | 06:12 |
| solid_liq | h0nus: it's fun for learning, but you'd be better off learning with slackware first if you're looking to learn. It'll teach you a lot more. | 06:12 |
| gmi01 | How can I add hostname completion to the bash completion? | 06:12 |
| ragu | snmpwalk: No securityName specified (Sub-id not found: (top) -> enterprises) | 06:13 |
| ragu | what error is this | 06:13 |
| h0nus | well i have a friend who uses gentoo and i was hoping to get some help from him | 06:13 |
| h0nus | but i can't even get the friggin thing to install | 06:13 |
| h0nus | keeps hanging | 06:13 |
| h0nus | o well | 06:13 |
| h0nus | =) | 06:13 |
| Yggdrassil | solid_liq, I agree, slackware (eventhough looking complex to install) is far easier to install than gentoo for a beginner | 06:13 |
| whaley | h0nus: hanging at what part (i know this isn't #gentoo, but I'm curious) | 06:13 |
| h0nus | the part where i click "install" and it just sits there for 9 hours on end | 06:14 |
| === shajiphilip [n=shajiphi@pool-71-252-212-74.dllstx.fios.verizon.net] has left #ubuntu ["Leaving"] | ||
| whaley | lol :) | 06:14 |
| h0nus | ^^^ | 06:14 |
| Stormx2 | man | 06:14 |
| whaley | you must be using their new graphical installer | 06:14 |
| ragu | any one using netsnmp | 06:14 |
| Stormx2 | as much as I hate IE | 06:14 |
| Stormx2 | i really need it for web dev >.> | 06:14 |
| === Xylene [n=nonono@c-68-45-113-99.hsd1.nj.comcast.net] has joined #ubuntu | ||
| Stormx2 | and the version I have running sucks at JS | 06:14 |
| ragu | snmpwalk: No securityName specified (Sub-id not found: (top) -> enterprises) i get this error | 06:14 |
| === xai [n=pasta@about/networking/0.0.0.0/xai] has joined #ubuntu | ||
| h0nus | i tried graphical, then tried command-line and tried compiling my own kernel | 06:14 |
| solid_liq | Yggdrassil: and it'll teach you a lot more because you have to do everything manually, instead of relying upon python scripts to do the work for you | 06:14 |
| h0nus | problem is i can't get the thing to recognize my eth0 card | 06:14 |
| xai | Is there a tool I can use in icewm that will tell me battery status for a laptop? | 06:14 |
| === s|k [n=bjorn@ip70-171-203-220.tc.ph.cox.net] has joined #ubuntu | ||
| h0nus | so i can't connect to the net | 06:15 |
| Yggdrassil | solid_liq, agreed, that how I learned linux.. thx to slackware.. I cursed, but I learned a lot | 06:15 |
| === ice [n=ice@71-10-94-106.dhcp.roch.mn.charter.com] has joined #ubuntu | ||
| Xylene | what's the path for Xorg drivers in ubuntu dapper flight 5? i have to replace an old neomagic driver (i have to with all distros, the included Xorg driver is bad) but now I can't find the path | 06:15 |
| whaley | h0nus: *shrug*... the #gentoo guys are pretty helpful if you want to ask them about it | 06:15 |
| solid_liq | Yggdrassil: yeah I loved it | 06:15 |
| h0nus | lol | 06:15 |
| h0nus | tried | 06:15 |
| whaley | doh :( | 06:15 |
| h0nus | sat there for 20 minutes listening to their conversation | 06:15 |
| h0nus | not one had anything to say to me | 06:15 |
| === mrios [n=mrios@c-24-61-12-141.hsd1.ma.comcast.net] has joined #ubuntu | ||
| solid_liq | Yggdrassil: I'd consider going back to it if it had a better packaging system and came compiled for CPUs other than the i486 :) | 06:15 |
| h0nus | how flexible is ubuntu? | 06:16 |
| Stormx2 | xai: Think so. Try right clicking a panel and going "Add to panel", there should be one there | 06:16 |
| === sylvain_ [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has joined #ubuntu | ||
| Yggdrassil | solid_liq, that was exactly my reason for moving on to redhat... now I am testing ubuntu.. this is my first experience with a debian based system.. so far it's mostly positive. | 06:16 |
| === yeonhoo [n=yeonhoo@201.66.25.141] has joined #ubuntu | ||
| Yggdrassil | just have to figure out some stuff | 06:17 |
| Yggdrassil | trail and error lol | 06:17 |
| ice | I can't ssh into my school server | 06:17 |
| ice | everytime I ssh it gives me prompt for a password | 06:17 |
| solid_liq | Yggdrassil: yeah I like it. I used gentoo for about 2.5+ years after switching away from slackware... way too much compiling | 06:17 |
| ice | then I put my root pass in and it doesn't work | 06:17 |
| ice | what do I do | 06:17 |
| === Frogzoo [n=Frogzoo@202.155.165.25] has joined #ubuntu | ||
| ice | is it my version my ssh maybe | 06:18 |
| solid_liq | ice: why are you using your root pass? | 06:18 |
| === ice is now known as fit4lfe | ||
| Yggdrassil | solid_liq, yup... I looked at the gentoo installation manual (5 pages, mostly about compiling for days without an end)... sighed and said: takes to long... forget it | 06:18 |
| solid_liq | ice: it's asking for your password for your school account | 06:18 |
| === gmi01 [n=gmi01@62.84.85.68] has left #ubuntu ["Leaving"] | ||
| solid_liq | Yggdrassil: nah, that's not the half of it. I mean when you run emerge -u world to update your system on a daily basis, and it takes 45 minutes to 4 hours to update, ON A DAILY BASIS!!!! | 06:19 |
| AngryElf | my firefox doesn't want to read mythweb.php ....it keeps asking for a program to run it, if i tell firefox to open the file it just repeats, what's going on? | 06:19 |
| Yggdrassil | solid_liq, eew | 06:19 |
| === jessy_ [n=jessy@4va54-1-81-56-98-29.fbx.proxad.net] has joined #ubuntu | ||
| === commongrounds [n=commongr@adsl-69-154-9-230.dsl.austtx.swbell.net] has joined #ubuntu | ||
| === ice [n=ice@71-10-94-106.dhcp.roch.mn.charter.com] has joined #ubuntu | ||
| Yggdrassil | solid_liq, who has time for that? | 06:20 |
| === ice is now known as fit4lfe | ||
| solid_liq | Yggdrassil: well you don't have to monitor it, but it's still a real pain | 06:20 |
| === yeonhoo [n=yeonhoo@201.66.25.141] has joined #ubuntu | ||
| === Jhair [n=user@85.115.3.118] has joined #ubuntu | ||
| === bigbootay [n=bigboota@209.250.156.214] has joined #ubuntu | ||
| fit4lfe | why can't I ssh into my school linux server | 06:21 |
| fit4lfe | is it because the school as an older ssh server maybe | 06:21 |
| === igcek [n=ubuntu@clj22-212.dial-up.arnes.si] has joined #ubuntu | ||
| === ze0phlik [i=anbu@n1-32-175.dhcp.drexel.edu] has joined #ubuntu | ||
| === patricia [n=patricia@83.230.195.14] has joined #ubuntu | ||
| solid_liq | Yggdrassil: it makes me LOVE how fast updates are with ubuntu :D | 06:21 |
| Jhair | fit4lfe: and the error message is...? | 06:21 |
| chamo | fit4lfe, can you access it from other places ? | 06:21 |
| patricia | ola | 06:21 |
| === susus [n=sz@p5089F348.dip.t-dialin.net] has joined #ubuntu | ||
| === |androxx| [n=kvirc@BSN-77-245-228.dial-up.dsl.siol.net] has joined #ubuntu | ||
| Yggdrassil | solid_liq, I liked the redhat up2date option... fast and simple.. and I noticed ubuntu uses a simular system... bottom line is... once I have the system hardened and have a vpn client running I actualy might stick with it and turn away from redhat | 06:22 |
| chamo | ola patricia | 06:22 |
| igcek | hello, is it posible to install ubuntu thru internet? | 06:22 |
| patricia | !!! | 06:22 |
| ubotu | patricia: Syntax error in line 1. Try searching at http://ubuntu.cc.com.au/ | 06:22 |
| fit4lfe | Permission denied (publickey,keyboard-interactive). | 06:22 |
| patricia | ei k pasaaa | 06:22 |
| === vista [n=wisitven@222.33.200.30] has joined #ubuntu | ||
| patricia | k tal de dond eres | 06:22 |
| chamo | mmhg | 06:22 |
| solid_liq | Yggdrassil: apt is way better than anything redhat has ever done | 06:22 |
| fit4lfe | all it does is tell me to input a password | 06:22 |
| Jhair | fit4lfe: you are entering a wrong password or your account doesn't exist | 06:22 |
| vista | i cant login with a cmline | 06:22 |
| fit4lfe | it exist | 06:23 |
| === joelbryan [n=joelbrya@210.213.156.213] has joined #ubuntu | ||
| vista | how can i set it as default? | 06:23 |
| === cesar [n=cesar@82.213.176.181] has joined #ubuntu | ||
| Jhair | fit4lfe: then you are entering a wrong password | 06:23 |
| fit4lfe | I use putty on my windows machine and I get in just fine | 06:23 |
| solid_liq | fit4lfe: you're not allowed to log in then | 06:23 |
| patricia | ola | 06:23 |
| fit4lfe | well how can I log in from putty then | 06:23 |
| fit4lfe | and it works | 06:23 |
| nosilver4u | Angryelf, it's most likely a misconfigured webserver | 06:23 |
| patricia | argun espaol x favor? | 06:23 |
| Yggdrassil | solid_liq, maybe... I will decide that for myself (no offense, but I'm picky hehe)... security is a BIG issue to me | 06:23 |
| solid_liq | fit4lfe: have you checked your capslock key? | 06:23 |
| mds\ | fit4lfe: have you checked your log files? | 06:23 |
| patricia | k? | 06:24 |
| greg_ | try with this command ssh -l account nr. ip | 06:24 |
| mds\ | see if theres a helpful message there | 06:24 |
| patricia | k koo dics!!! | 06:24 |
| solid_liq | Yggdrassil: there's a reason debian is way more popular among experienced linux users than redhat | 06:24 |
| Jhair | fit4lfe: try with the ssh -v option to see more details | 06:24 |
| === pitti [n=pitti@ubuntu/member/pitti] has joined #ubuntu | ||
| fit4lfe | k | 06:24 |
| greg_ | fit4 try this comand | 06:24 |
| Yggdrassil | solid_liq, but first I have to figure out the way debian is being managed. I'm so used to redhat I keep looking in the wrong spots hehe | 06:24 |
| patricia | minnie_patricia@hotmail.com!!! | 06:24 |
| === sYs`afk is now known as sYs^ | ||
| Jhair | fit4lfe: or better: use ssh -vv | 06:25 |
| patricia | ola | 06:25 |
| solid_liq | fit4lfe: oh that reminds me, is your linux user name the same as your school account user name? you need -l to specify it if not | 06:25 |
| patricia | bobby | 06:25 |
| === bintut [n=bintut@203.131.183.252] has joined #ubuntu | ||
| === aeolist [n=aeolist@ppp125.dialup.ntua.gr] has joined #ubuntu | ||
| patricia | tas ai? | 06:25 |
| fit4lfe | did that too | 06:25 |
| bintut | anyone here implement ubuntu-5.10 + ltsp? | 06:25 |
| patricia | ' | 06:25 |
| fit4lfe | ssh -l username ip | 06:25 |
| fit4lfe | didn't work | 06:25 |
| fit4lfe | either | 06:25 |
| greg_ | yes | 06:25 |
| patricia | killo kiers un cafe? | 06:26 |
| bintut | when i tried to boot my first workstation, i got this error: | 06:26 |
| solid_liq | Yggdrassil: well gentoo's portage system is similar. Once you get used to portage or apt, you *never* look back. They are *SO* much better than any other package managers. | 06:26 |
| greg_ | have you not account | 06:26 |
| bintut | Segment [0009E6E8,0009EC80] does not fit in any memory region | 06:26 |
| bintut | ldog unless | 06:26 |
| patricia | emmmm | 06:26 |
| === Versed [n=Versed@c-69-253-173-154.hsd1.nj.comcast.net] has joined #ubuntu | ||
| fit4lfe | I have an account | 06:26 |
| greg_ | try with root | 06:26 |
| bintut | <abort> | 06:26 |
| fit4lfe | k | 06:26 |
| bintut | Probing pci nic | 06:26 |
| greg_ | if you know it | 06:26 |
| bintut | Probing isa nic | 06:26 |
| bintut | <sleep> | 06:26 |
| bintut | anyone? | 06:26 |
| greg_ | ssh -l root ip | 06:26 |
| patricia | k paxa pixaaaaa | 06:26 |
| patricia | bueno k yo m las piro vampiroo | 06:26 |
| === sylvain_ [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has joined #ubuntu | ||
| Yggdrassil | solid_liq, I am more talking about system management and configuration (prime example, debian works with rc's, redhat with runlevels) takes a while to figure all those little differences out | 06:27 |
| solid_liq | bintut: that from an ubuntu install? | 06:27 |
| greg_ | of course the pc answer to you password root | 06:27 |
| fit4lfe | that worked | 06:27 |
| patricia | xiusaaaaaaaaaaa | 06:27 |
| patricia | k m voy | 06:27 |
| fit4lfe | why do I have use root | 06:27 |
| fit4lfe | don't get it | 06:27 |
| patricia | sylvain_ holaaaaaaaaaaaaaa!!! | 06:27 |
| patricia | hello!!!! | 06:27 |
| greg_ | what?? | 06:27 |
| Jhair | fit4lfe: you are the administrator of your school server? or are you just trolling here? | 06:27 |
| greg_ | now is ok?? | 06:27 |
| bintut | solid_liq: yes | 06:28 |
| solid_liq | Yggdrassil: yeah, every distro has different init scripts | 06:28 |
| bintut | solid_liq: i apt-get it | 06:28 |
| === Init5 [n=DHA@3E6B6BD2.rev.stofanet.dk] has joined #ubuntu | ||
| === bip_ [n=bip@host208-111.pool80181.interbusiness.it] has joined #ubuntu | ||
| === jimcooncat [n=jim@216-220-225-50.midmaine.com] has joined #ubuntu | ||
| patricia | m voy | 06:28 |
| solid_liq | bintut: huh? | 06:28 |
| Yggdrassil | solid_liq, yup... and ubuntu stores some configuration files at different locations... so that's something I have to figure out to... but that is (like you correctly pointed out) normal for any distribution... | 06:29 |
| Init5 | hi all, I just installed fluxbox on my breezy, -how do I make it boot into that window manager? | 06:29 |
| fit4lfe | I can either be administrator or I have a web account I use for the apache serve | 06:30 |
| === zaibiechu [n=woody@222.88.155.212] has joined #ubuntu | ||
| fit4lfe | either way I can get in | 06:30 |
| === jessy_ [n=jessy@4va54-1-81-56-98-29.fbx.proxad.net] has joined #ubuntu | ||
| solid_liq | Yggdrassil: and annoying. If I had lots of spare time on my hands, I would create a fuse filesystem to give a virtual filesystem into /etc with the locations for everything in the vfs standardized across all distros | 06:30 |
| bintut | brb | 06:30 |
| Yggdrassil | solid_liq, well, that why once you know a specific distro, you tend to stick with it... | 06:31 |
| solid_liq | fit4lfe: do you mean you have to be logged in as root on your local machine to ssh, or login as root on the remote machine? | 06:31 |
| === Versed [n=Versed@c-69-253-173-154.hsd1.nj.comcast.net] has left #ubuntu [] | ||
| === zapy [n=zapy@dsl-10-133-175.b2b2c.ca] has joined #ubuntu | ||
| sfar | name a good ftp-client please | 06:31 |
| Yggdrassil | solid_liq, but in general, it's only a minor inconveneance | 06:31 |
| sfar | Init5, you can choose "session" when you log in | 06:31 |
| === Kie [n=Kierhon@161.57.100.3] has joined #ubuntu | ||
| solid_liq | Yggdrassil: even more important, that's why there aren't any good GUI configuration tools that aren't distro specific | 06:31 |
| zapy | salut | 06:31 |
| === ubuntu [n=ubuntu@c-67-185-156-65.hsd1.or.comcast.net] has joined #ubuntu | ||
| fit4lfe | ssh on my home machine to remote into school machine | 06:32 |
| ubuntu | hey guyz , i just got ubuntu live cd and i like it | 06:32 |
| fit4lfe | but I'm in now | 06:32 |
| ubuntu | how ??? | 06:32 |
| fit4lfe | just wierd how I got in | 06:32 |
| solid_liq | Yggdrassil: I would love to have a web admin tool available, cross-distro | 06:32 |
| zapy | bye | 06:32 |
| === th0rndike [n=th0rndik@host188-87.pool8710.interbusiness.it] has joined #ubuntu | ||
| Yggdrassil | fit4lfe, you will have to talk to your shool network admin | 06:32 |
| fit4lfe | yeah | 06:32 |
| fit4lfe | but why does it work with putty | 06:32 |
| Yggdrassil | Soliah, one day maybe... remember.. linux is on the move | 06:32 |
| fit4lfe | though | 06:32 |
| === Init5 [n=DHA@3E6B6BD2.rev.stofanet.dk] has left #ubuntu [] | ||
| sfar | ubuntu, type /nick yournickname | 06:32 |
| sfar | where "yournickname" can be anything | 06:33 |
| fit4lfe | I think its the ssh version from dapper | 06:33 |
| solid_liq | fit4lfe: no, I meant which machine requires you to use root? Your local machine I take it? | 06:33 |
| Yggdrassil | fit4lfe, he might have to grant you remote login permitions | 06:33 |
| th0rndike | guys | 06:33 |
| ubuntu | hey | 06:33 |
| fit4lfe | maybe | 06:33 |
| solid_liq | fit4lfe: no, I meant which machine requires you to use root? Your local machine I take it? | 06:33 |
| ubuntu | its not changin nick | 06:33 |
| healot | It is on the move, maybe not for average desktop users | 06:33 |
| === danf_1979 [n=dan@pc-158-78-104-200.cm.vtr.net] has joined #ubuntu | ||
| fit4lfe | yeah | 06:33 |
| _jason | ubuntu: /nick newname | 06:33 |
| sfar | ubuntu: maybe the nickname already was taken | 06:33 |
| ubuntu | `windows is fur games , linix is for internet right ???? | 06:33 |
| th0rndike | guys i need to set some enviroment variables... how do i do that? i want them to stay | 06:33 |
| solid_liq | fit4lfe: do: ls -l `which ssh` | 06:33 |
| Storkme | wtfd is this | 06:34 |
| === thoffmeyer|AFK is now known as thoffmeyer | ||
| solid_liq | fit4lfe: and tell me what the file permissions are | 06:34 |
| === jcplata [n=jcplata@200.30.101.4] has joined #ubuntu | ||
| healot | VARIABLE=VALUE, th0rndike | 06:34 |
| === mxpxpod_ is now known as mxpxpod | ||
| Storkme | whenever i try and use the kernel "2.6.12-10-k7-smp" it just says "Segmentation fault" a few times while booting up, and quits | 06:34 |
| Yggdrassil | healot, export to make then sticky? | 06:34 |
| ubuntu | WHAT IS THE BINIFIT OF USING LINIX OVER WINDOWS ????? | 06:34 |
| sfar | windows is for nothing, games are not very much for linux | 06:34 |
| _jason | !caps | 06:34 |
| ubotu | FYI, typing in ALL CAPS is considered to be 'yelling', and therefore rude behaviour. | 06:34 |
| healot | you can put it on your bashrc... | 06:34 |
| Yggdrassil | healot, ic.. thx | 06:35 |
| ubuntu | i am yellin :) | 06:35 |
| ubuntu | sorry | 06:35 |
| ubuntu | so what is the binifit ? | 06:35 |
| solid_liq | ubuntu: benefit? | 06:35 |
| th0rndike | healot, that simple? like i wanna add classpath i juz do it like that? the prob is that i have more jdk installed and i want it to look in some specific place | 06:35 |
| ubuntu | yes | 06:35 |
| solid_liq | fit4lfe: done that yet? | 06:35 |
| _jason | ubuntu: libre and often gratis | 06:35 |
| === jleino [n=jleino@a84-231-31-184.elisa-laajakaista.fi] has joined #ubuntu | ||
| h0nus | how do i install ssh2? | 06:36 |
| Yggdrassil | ubotu, frankly, you use the operating system you feel most comfortable with and best suits your needs... there is no such thing as a "good" or "bad" operating system.. it all depends on what you want to do with it. | 06:36 |
| healot | yes... that simple | 06:36 |
| ubotu | Yggdrassil: I think you lost me on that one | 06:36 |
| h0nus | v0.11 | 06:36 |
| solid_liq | ubuntu: stability, lack of viruses/adware/spyware/marketing bs | 06:36 |
| healot | VARIABLE=VALUE | 06:36 |
| Storkme | ubuntu, what you should be asking is, what are the benefits of using winows over ubuntu? | 06:36 |
| === ogra [n=ogra@ubuntu/member/ogra] has joined #ubuntu | ||
| healot | for JDK, the variable is "CLASSPATH" | 06:36 |
| Kie | Oooh ooh pick me, i know the answer to that one! | 06:37 |
| === lappies [i=lappies@dsl-146-193-60.telkomadsl.co.za] has joined #ubuntu | ||
| Kie | Windows has NO benefit, other than it's stupified | 06:37 |
| Storkme | th0rndike, use the -cp or -classpath option to set the classpath | 06:37 |
| === sylvain_ [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has joined #ubuntu | ||
| healot | Kie, you so anti microsoft :) | 06:37 |
| lappies | Kie i'm with you | 06:37 |
| th0rndike | Storkme, yeh but its annoying... i want it to look there right away | 06:38 |
| xai | stormx2: I'm running icewm. | 06:38 |
| abre | would anyone know of a good place for doucmentation on the hybserv package? | 06:38 |
| Storkme | th0rndike, what are you taslking about? | 06:38 |
| solid_liq | wow, it's obvious you guys are relatively new to linux!! I'm used to being around people who haven't used windows since windows 3.11, 95 or 98 | 06:38 |
| Stormx2 | xai: o.O you lost me... what was your prob again? | 06:38 |
| === reggaemanu [n=manu@ARennes-257-1-158-160.w86-214.abo.wanadoo.fr] has joined #ubuntu | ||
| th0rndike | when i compile the java prog i need to say "javac -classpath <path> program.java | 06:38 |
| solid_liq | they are *way* more anti microsoft than you guys :D | 06:38 |
| lappies | ahoy | 06:39 |
| h0nus | <<<this n00b needs help (again) | 06:39 |
| healot | solid_liq, i don't care about when I started using linux. i even started computing with SunOS | 06:39 |
| h0nus | lol | 06:39 |
| zaibiechu | is there a IDE for c | 06:39 |
| th0rndike | i dont want to add the stupid -classpath option | 06:39 |
| Kie | I think it's important be bilingual in all OSystems | 06:39 |
| lappies | whats a good kde bluetooth tool? | 06:39 |
| solid_liq | zaibiechu: kdevelop | 06:39 |
| Jhair | zaibiechu: yes: emacs | 06:39 |
| Yggdrassil | solid_liq, I deal on a daily base with a large variety of OS's... they all have their pro's and con's.. like I said earlier.. whatever you feel comfortable with and whatever suits your needs best... | 06:39 |
| lappies | i got this one that works with winamp, won't a winamp plugin work with xmms? | 06:40 |
| === tvo [n=tobi@5354EA9B.cable.casema.nl] has joined #ubuntu | ||
| === ph8 [n=ph8@85-210-14-152.dsl.pipex.com] has joined #ubuntu | ||
| Kie | So what if i learned the basics from windows, at least i know it to help others, right!? | 06:40 |
| zaibiechu | i have not installed kde,and don't know how to use emacs | 06:40 |
| solid_liq | Kie: bilingual in all OS's? uh... you might want to look up the definition of bilingual :D | 06:40 |
| ph8 | hi all, has anyone come across the problem of not being able to install extensions in firefox? | 06:40 |
| === Shadowline [n=shadowli@ppp-70-226-94-119.dsl.klmzmi.ameritech.net] has joined #ubuntu | ||
| healot | lappies, no, win32 binaries cannot run in native linux application | 06:40 |
| Kie | Yeah i caught that solid | 06:40 |
| ph8 | it just opens the extensions window (which is blank) when i try to install one | 06:40 |
| zaibiechu | how can i compile c in vi | 06:40 |
| Kie | *hits head* Slow thinking today | 06:40 |
| solid_liq | Jhair: emacs isn't an IDE. I would recommend vim if that's what he was asking :P | 06:40 |
| Kie | Here's a random ?? How old is everyone in here? I'm always interested to see the variety | 06:41 |
| Yggdrassil | < ancient | 06:41 |
| Yggdrassil | :P | 06:41 |
| === idefix__ [n=Vincent@cc846502-a.ensch1.ov.home.nl] has joined #ubuntu | ||
| === kleinlappies2 [i=lappies@dsl-146-193-60.telkomadsl.co.za] has joined #ubuntu | ||
| === ifr [n=nselby@pool-70-19-73-158.ny325.east.verizon.net] has left #ubuntu [] | ||
| Kie | hah, ancient is better in most cases | 06:41 |
| === thoffmeyer [n=tim@2001:5c0:8fff:fffe:0:0:0:4ae1] has joined #ubuntu | ||
| Jhair | solid_liq: I use emacs daily, and it is an integrated development environment for sure (CC-Mode, PCL-CVS, etc.), and a very powerful one. | 06:41 |
| kleinlappies2 | i got this one that works with winamp, won't a winamp plugin work with xmms? | 06:41 |
| Storkme | i'm 16. | 06:42 |
| idefix__ | why do the script commands which have a range end with the command from back to front? | 06:42 |
| Yggdrassil | I was playing with minix when you where still doodling :P | 06:42 |
| solid_liq | zaibiechu: if you have a makefile, just enter :! make | 06:42 |
| === patrix [n=patrix@patrix.ott.istop.com] has joined #ubuntu | ||
| Kie | Wow, i never see people even close to my age anywhere in these channels. 18 here | 06:42 |
| zaibiechu | solid_liq, i have not make | 06:42 |
| Storkme | Kie, i'm 16. | 06:42 |
| solid_liq | Jhair: where's the GUI interface editor | 06:42 |
| ph8 | i'm 19 kie | 06:42 |
| === marzo [n=marzo@216.Red-81-36-240.dynamicIP.rima-tde.net] has joined #ubuntu | ||
| solid_liq | Jhair: ? | 06:43 |
| === solid_liq is 28 years old | ||
| Kie | Sweetness ^.^ | 06:43 |
| zaibiechu | i hear that to make a MAP will do this ,but how | 06:43 |
| kleinlappies2 | does winamp plugins work with xmms | 06:43 |
| === Russel [n=engelzz@d174.stw.stud.uni-saarland.de] has joined #ubuntu | ||
| Dyna-Work | 27 here... | 06:43 |
| Russel | hiho | 06:43 |
| === Beleys [n=Beleys@62.94.102-84.rev.gaoland.net] has joined #ubuntu | ||
| marzo | join #polis | 06:43 |
| === pitti [n=pitti@ubuntu/member/pitti] has joined #ubuntu | ||
| healot | kleinlappies, nay | 06:43 |
| Storkme | kleinlappies, why would they? winamp and xmms are very different. | 06:43 |
| Jhair | solid_liq: claiming an IDE should have a GUI interface editor is nonsense (see http://en.wikipedia.org/wiki/Integrated_development_environment) | 06:43 |
| healot | no non | 06:43 |
| Russel | i want to run another xserver to run my games in it, but xinit tells me i am not authorized | 06:44 |
| solid_liq | zaibiechu: you should read one of the simple guides for vim for programmers. You can type :help to find one | 06:44 |
| Yggdrassil | kleinlappies, you can use older winamp skins with xmms.. but that is about it | 06:44 |
| Yggdrassil | man vim | 06:44 |
| Yggdrassil | lol | 06:44 |
| === nick|here [n=boran@unaffiliated/nickhere/x-000000001] has joined #ubuntu | ||
| solid_liq | Jhair: that's what people from the windows world expect, so to argue otherwise with any references you can find is irrelevant | 06:44 |
| === yoyo [n=yoyo@corp01.fr3.egwn.net] has joined #ubuntu | ||
| === yoyo [n=yoyo@corp01.fr3.egwn.net] has left #ubuntu ["Quitte"] | ||
| Jhair | solid_liq: this is not #windows, but #ubuntu | 06:44 |
| kleinlappies2 | so if a wine install winamp load the plugin i could maybe remote control my pc | 06:45 |
| solid_liq | Jhair: doesn't matter, the asker is a new convert from windows, which means he is used to the windows "way" | 06:45 |
| === ick [n=moggio@213-48-145-66.cro.cvx.blueyonder.co.uk] has joined #ubuntu | ||
| solid_liq | Jhair: er, actually, believe it or not, arrogant bastards at m$ actually call it the "microsoft way" | 06:46 |
| Yggdrassil | windows = click and point.. linux = read, study, experiment, learn. | 06:46 |
| === ml-- [i=kenta@c-33d4e255.217-9-64736c12.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| void^ | and now he knows designing applications with a mouse isn't the linux way | 06:46 |
| h0nus | trying to find sapr3, and was recommended to this site: | 06:46 |
| h0nus | http://www.sap.com/solutions/netweaver/linux/eval/index.asp | 06:46 |
| h0nus | can someone help me find a download? i'm missing it | 06:46 |
| Storkme | hi, i need some major help: I just installed 'kernel 2.6.12-10-k7-smp' with apt-get and it wont boot up.. it gives me a lot of "segmentation faults" on boot, then hangs. | 06:46 |
| Jhair | solid_liq: I don't believe your claim "windows users/programmers expect a GUI interface editor in any IDE", using Visual Studio without any GUI editor is common, and nobody claims Visual Studio is not an IDE anymore because of that | 06:46 |
| ml-- | is XAMPP available from the repos? i cant find it. | 06:46 |
| === gnu2it2 [n=kgrimm@cpe-069-134-161-191.nc.res.rr.com] has joined #ubuntu | ||
| Jhair | solid_liq: anyway I will stop discussing this now. It's futile | 06:46 |
| === duelboot [n=duelboot@72-255-77-65.client.stsn.net] has joined #ubuntu | ||
| solid_liq | but people need a gentle introduction to prevent them from fleeing back to the dark side because it takes them too much work to learn before they can even see for themselves where any of the benefits lie | 06:47 |
| solid_liq | Jhair: you're full of shit | 06:47 |
| === Spiro|laptop [n=laptop@83-131-133-86.adsl.net.t-com.hr] has joined #ubuntu | ||
| healot | xmms support remote control too | 06:47 |
| === awelynant [n=awelynan@black.renesys.com] has joined #ubuntu | ||
| Yggdrassil | catfight !!!!!!!!! | 06:47 |
| === highvoltage [n=Jono@mtngprs7.mtn.co.za] has joined #ubuntu | ||
| === |androxx| [n=kvirc@BSN-77-176-185.dial-up.dsl.siol.net] has joined #ubuntu | ||
| healot | kleinlappies, open xmms config, Tab to "General Plugin", and configure "Irman Control" | 06:48 |
| duelboot | and I just jointed...don't know what started it...darn | 06:48 |
| solid_liq | Jhair: lemme just ask you one question: when's the last time you saw a windows app that *didn't* have a GUI interface? hmmm? | 06:48 |
| Jhair | solid_liq: please don't insult people (me) in this channel, stop now. I will ignore you from now on. | 06:48 |
| patrix | solid_liq, telnet ! | 06:48 |
| solid_liq | hahah | 06:48 |
| Yggdrassil | solid_liq, I just saw one... it's called "command prompt" | 06:48 |
| Yggdrassil | hehe | 06:48 |
| === tavancini [n=tavancin@200-171-177-8.dsl.telesp.net.br] has joined #ubuntu | ||
| Yggdrassil | :P | 06:49 |
| patrix | solid_liq, ftp ! | 06:49 |
| solid_liq | patrix: that's technicall a DOS program, not a windows program | 06:49 |
| === detten [n=Detten@d51A45434.access.telenet.be] has joined #ubuntu | ||
| void^ | solid_liq: please do not write *nix software. thank you. | 06:49 |
| === LoRez [i=lorez@freenode/staff/lorez] has joined #ubuntu | ||
| === bris [n=bris@fla93-1-81-57-169-29.fbx.proxad.net] has joined #ubuntu | ||
| healot | solid_liq, alot | 06:49 |
| solid_liq | void^: why? because I understand what the noobs expect? | 06:49 |
| h0nus | can anyone help? i'm having trouble finding the proper modules to install | 06:49 |
| h0nus | http://paste.ubuntu-nl.org/11107 | 06:49 |
| healot | most of Windows NT Posix compat apps does not have any GUI | 06:49 |
| h0nus | pasted | 06:50 |
| patrix | solid_liq, in taht case you'll never find windows apps that are command line only, since lal the command line windows apps are "technically" "DOS APPS" | 06:50 |
| Yggdrassil | oh guys.. let's go back to assembly language ok? | 06:50 |
| void^ | solid_liq: the "noobs" aren't the ones who should code | 06:50 |
| xai | stormx2: I guess I just was looking for a tool that would tell me battery status. Can be CLI or gui. | 06:50 |
| solid_liq | void^: I don't cater to the winfreaks, I just know what they're used to from having provided support in irc channels for several years | 06:50 |
| solid_liq | (for linux) | 06:50 |
| === krisg [i=Krisg@210.213.144.86] has left #ubuntu [] | ||
| healot | dude, get a hold of yourself | 06:50 |
| healot | Lnux isn't a religion | 06:51 |
| patrix | WHAT? | 06:51 |
| Yggdrassil | xai, just add the powermeter gadget to your toolbar | 06:51 |
| solid_liq | patrix: they are. I used to work as a C++ software engineer, under windows, and the only way to create a CLI app with Visual Studio is to make your target a DOS executable | 06:51 |
| healot | we are here to help, no matter from what background, what level of knowledge | 06:51 |
| === patrix falls apart, tears down his chapel, and wanders around aimlessly ;) | ||
| Yggdrassil | healot, blasphemy :P | 06:51 |
| Yggdrassil | hehe | 06:51 |
| xai | I installed gkrellm and it seems to indicate battery ok.. But the lappy crashed in the middle of nothing, and then went dormant for 10 mins.. we could not boot it.. using the i810 Xorg driver.. | 06:51 |
| xai | We're trying to rule out different problems right now | 06:51 |
| xai | Yggdrassil: thanks. | 06:51 |
| patrix | solid_liq, so your question, asking if there are windows CLI apps, is useless, since they're all DOS apps if they're CLI ;) | 06:52 |
| === kokey [n=ubunture@201.153.63.87] has joined #ubuntu | ||
| === tavancini [n=tavancin@200-171-177-8.dsl.telesp.net.br] has left #ubuntu [] | ||
| void^ | .. last time i checked they used to call it "win32 command line executable" | 06:52 |
| === highvoltage [n=Jono@ubuntu/member/highvoltage] has left #ubuntu [] | ||
| h0nus | !libssh | 06:52 |
| ubotu | h0nus: Huh? Try searching at http://ubuntu.cc.com.au/ | 06:52 |
| === Hoxzer [n=niko@a80-186-169-248.elisa-laajakaista.fi] has joined #ubuntu | ||
| solid_liq | patrix: that wasn't my question, it was my statement | 06:52 |
| h0nus | !librfc | 06:52 |
| ubotu | NO SPEAKE ENLISH! Try searching at http://ubuntu.cc.com.au/, h0nus | 06:52 |
| patrix | solid_liq Jhair: lemme just ask you one question: when's the last time you saw a windows app that *didn't* have a GUI interface? hmmm | 06:52 |
| healot | split alert | 06:53 |
| solid_liq | patrix: you should read before speaking | 06:53 |
| patrix | it was a question ;) | 06:53 |
| Stormx2 | xai: Ah | 06:53 |
| h0nus | !saprfc | 06:53 |
| ubotu | No idea, try searching at http://ubuntu.cc.com.au/, h0nus | 06:53 |
| patrix | solid_liq, please, be nice | 06:53 |
| Stormx2 | xai: Well I only know about the gnome app | 06:53 |
| h0nus | !ssh2 | 06:53 |
| ubotu | h0nus: Do they come in packets of five. Try searching at http://ubuntu.cc.com.au/ | 06:53 |
| Stormx2 | applet rather | 06:53 |
| Storkme | hi, i need some major help: I just installed 'kernel 2.6.12-10-k7-smp' with apt-get and it wont boot up.. it gives me a lot of "segmentation faults" on boot, then hangs. | 06:53 |
| Stormx2 | let me check.... | 06:53 |
| === nickrud [n=aias@ppp-70-250-225-194.dsl.hstntx.swbell.net] has joined #ubuntu | ||
| Jhair | patrix: ? | 06:53 |
| === winXperts [n=winXpert@ip70-171-10-206.ga.at.cox.net] has joined #ubuntu | ||
| === Zdra [n=zdra@81.247.172.23] has joined #ubuntu | ||
| h0nus | gg ubotu has nothing for me | 06:53 |
| solid_liq | patrix: and the "hmmm" at the end was to imply that you wouldn't find one | 06:53 |
| === t1n_l0tus [n=lotus@cpe-72-226-4-218.nycap.res.rr.com] has joined #ubuntu | ||
| === jeddy3 [n=mattias@81-234-85-40-o1122.telia.com] has joined #ubuntu | ||
| === btsai_ [n=VRWarper@cpe-24-90-212-152.nyc.res.rr.com] has joined #ubuntu | ||
| === Trae [n=october@ip24-252-207-46.mc.at.cox.net] has joined #ubuntu | ||
| === B_166-ER-X [n=oli@c207.134.16-188.clta.globetrotter.net] has joined #ubuntu | ||
| healot | Storkme, is your box have two or more CPUs? | 06:53 |
| patrix | solid_liq, and my point is that since all cli apps are dos apps and windows apps, your statement doesn't make sense, since you'll always classify them as DOS apps, even if they can only run, say, in WinXP etc | 06:53 |
| Storkme | healot, of course | 06:54 |
| === MasterC [n=MasterC@dslb-084-060-202-170.pools.arcor-ip.net] has joined #ubuntu | ||
| Storkme | healot, AMD X2 4200+ | 06:54 |
| healot | dude, you can target a command line even for a Win32 app | 06:54 |
| Storkme | according to my bios | 06:54 |
| === loco_gr [n=thanasis@ppp7-adsl-142.ath.forthnet.gr] has joined #ubuntu | ||
| solid_liq | patrix: no, it has everything to do with the libraries they link to. Don't you know C/C++ programming principals wrt operating systems? | 06:54 |
| healot | that's duel core, Storkme :) | 06:54 |
| healot | not dual CPUs. | 06:54 |
| Yggdrassil | x2.. dual processor | 06:54 |
| === leonel_ [n=leonel@201.123.94.180] has joined #ubuntu | ||
| Yggdrassil | err. dual core processor | 06:55 |
| Storkme | healot, it's the same - i used to use smp.. | 06:55 |
| === HiveChild [n=HiveChil@x1-6-00-10-a7-08-8e-f7.k195.webspeed.dk] has joined #ubuntu | ||
| idefix__ | why do the script commands which have a range end with the command from back to front? | 06:55 |
| healot | it is still a Single CPU with two core processor :) | 06:55 |
| healot | not two separate CPUs | 06:55 |
| Storkme | i used to use the smp kernel, then now it doesn't work | 06:55 |
| Yggdrassil | shouldn't be a problem | 06:55 |
| h0nus | !lpq | 06:55 |
| ubotu | h0nus: I give up. Try searching at http://ubuntu.cc.com.au/ | 06:55 |
| === cassidy [n=cassidy@physInfo-mac26.ulb.ac.be] has joined #ubuntu | ||
| h0nus | argh! | 06:55 |
| solid_liq | no, the procs are actually separate, they just live on the same die | 06:55 |
| duelboot | Storkme, smp with ubuntu or another distro? | 06:55 |
| solid_liq | it's not like hyperthreading | 06:56 |
| Storkme | ubuntu | 06:56 |
| === bisquit [n=bisquit@1Cust5713.an4.dca16.da.uu.net] has joined #ubuntu | ||
| h0nus | !lssl | 06:56 |
| ubotu | My cat's name is Mittens! Try searching at http://ubuntu.cc.com.au/, h0nus | 06:56 |
| bisquit | How do I check if DRI is enabled? | 06:56 |
| h0nus | !-lssl | 06:56 |
| ubotu | h0nus: Did you get hit by a windmill? Try searching at http://ubuntu.cc.com.au/ | 06:56 |
| solid_liq | duelboot: you do have to use SMP. I have an Athlon64 X2 3800+ myself... | 06:56 |
| h0nus | ok | 06:56 |
| === leonel_ is now known as leonel | ||
| healot | bisquit, via the X.0.log file? | 06:56 |
| duelboot | solid_lid...wasn't disputing anything...didn't see the beginning of the conversation | 06:57 |
| duelboot | liq...sorry | 06:57 |
| caglar_ | do you know a program which can derive mathematic functions? | 06:57 |
| bisquit | healot: No I mean by the grep way | 06:57 |
| h0nus | i'm trying to compile hydra, and hitting a "/usr/bin/ld: cannot find -lssl" error | 06:57 |
| === Foodcoman [n=berickso@mcdonaldwhsl.com] has joined #ubuntu | ||
| Yggdrassil | caglar_, calculator? | 06:57 |
| h0nus | what is ld? | 06:57 |
| === _michael_ [n=michael@host-74.216-16-13.iw.net] has joined #ubuntu | ||
| Yggdrassil | lol | 06:57 |
| solid_liq | duelboot: use the k8-smp kernel | 06:57 |
| caglar_ | Yggdrassil: which one? | 06:57 |
| Jhair | caglar_: octave I think | 06:57 |
| healot | well cat and grep it, bisquit | 06:57 |
| caglar_ | Yggdrassil: Im sure the standard gnome calc wont do that | 06:57 |
| healot | oh | 06:58 |
| ml-- | !xampp | 06:58 |
| ubotu | I guess xampp is an easy to install Apache distribution containing MySQL, PHP and Perl. XAMPP is really very easy to install and to use - just download, extract and start. Get it at http://www.apachefriends.org/en/xampp-linux.html | 06:58 |
| healot | he did use K7! | 06:58 |
| bisquit | healot: Lol, what's the command though, I forgot what it was | 06:58 |
| === j2daosh [n=josh@66-191-145-50.dhcp.roch.mn.charter.com] has joined #ubuntu | ||
| bisquit | healot: like grep | direct? | 06:58 |
| healot | never saw that coming... | 06:58 |
| === ajamuk [n=ajamuk@91.red-82-159-57.user.auna.net] has joined #ubuntu | ||
| === jelkner [n=jelkner@158.59.193.240] has joined #ubuntu | ||
| === swab79 [n=euan@host86-132-163-218.range86-132.btcentralplus.com] has joined #ubuntu | ||
| Yggdrassil | caglar_, try to set the view to scientific | 06:58 |
| === nto-ubu [n=nto@h52n2fls31o290.telia.com] has joined #ubuntu | ||
| healot | bisquit, cat file | grep "string" | 06:58 |
| duelboot | solid_liq: I didn't have a question for me...I have an dual core, but not 64 bit | 06:58 |
| === patrix [n=patrix@patrix.ott.istop.com] has left #ubuntu ["Leaving"] | ||
| healot | K8 for AMD 64 | 06:58 |
| Storkme | what's the difference between k8 and k7? | 06:58 |
| ml-- | !lamp | 06:58 |
| ubotu | Linux-Apache-MySQL-PHP, one of the standard internet server installations. Installing LAMP in Ubuntu is fairly straightforward. More info at https://wiki.ubuntu.com/ApacheMySQLPHP | 06:58 |
| ajamuk | alguien habla espaol? | 06:58 |
| duelboot | solid_liq: I used smp with Mandr***, but I'm okay with ubuntu | 06:59 |
| healot | the processor itself, the instructions set, Storkme ? | 06:59 |
| Storkme | this damned k7 kernel wont work | 06:59 |
| Storkme | maybe i broke my 2nd cpu | 06:59 |
| healot | AMD 64 should use K8-smp kernel, Storkme | 06:59 |
| === n3m0r1n0 [n=nemorino@host113-211.pool873.interbusiness.it] has joined #ubuntu | ||
| === tRSS [n=asiddiqu@202.174.142.2] has joined #ubuntu | ||
| healot | good luck dueling | 07:00 |
| Storkme | AMD 64 isn't exactly stable as of yet | 07:00 |
| healot | sure | 07:00 |
| swab79 | I have a DAC960 SCSI controler, managed to get RAID 5 working, however I can't see any device for the SCSI tape drive, and I have no /proc/scsi folder. Any ideas? | 07:00 |
| tRSS | Anyone knows where I can find the OS X like dock for kubuntu? | 07:00 |
| healot | nothing is | 07:00 |
| Storkme | 32 is a lot more so | 07:00 |
| Jhair | h0nus: does /usr/lib/libssl.so exist? if not install libssl-dev | 07:00 |
| Storkme | i can't play quake4 on 64 | 07:00 |
| h0nus | ty! | 07:00 |
| === Donvinzk_ [n=vincent@26.43.101-84.rev.gaoland.net] has joined #ubuntu | ||
| healot | Storkme, you can if you recompile... | 07:01 |
| Yggdrassil | swab79, you might be missing the modules for the controller (drivers)... or they might be there but not being initialized during boot | 07:01 |
| h0nus | i just don't know the names of the packages i need o_0 | 07:01 |
| === pulgoki [i=pulgoki@detachable.peeen.us] has joined #ubuntu | ||
| healot | h0nus, waht's the app? | 07:01 |
| Storkme | healot, recompile what? | 07:01 |
| h0nus | hydra | 07:01 |
| === scandian [n=scandian@ppp-160-93.25-151.libero.it] has joined #ubuntu | ||
| healot | h0nus, a good search starts at http://packages.ubuntu.com | 07:02 |
| Yggdrassil | I'm off. | 07:02 |
| === Yggdrassil [n=me@bsjrmb01dc1-241-61.dynamic.mts.net] has left #ubuntu ["Leaving"] | ||
| === KmanCat [n=KmanCat@dsldhcp8-49.greenmountainaccess.net] has joined #ubuntu | ||
| healot | Storkme, the CPU itself, or the source code? guess :) | 07:02 |
| h0nus | healot, ty | 07:02 |
| === goki- [n=sdfsdf@84-51-141-144.itis099.adsl.metronet.co.uk] has joined #ubuntu | ||
| scandian | who can say me a beautifull game to download with synaptic | 07:02 |
| === catalinux [n=catalinu@86.35.32.57] has joined #ubuntu | ||
| === catch22 [n=purdev@65-182-54-93.biltmorecommunications.net] has joined #ubuntu | ||
| === swab79 [n=euan@host86-132-163-218.range86-132.btcentralplus.com] has joined #ubuntu | ||
| healot | hum | 07:03 |
| === sylvain [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has joined #ubuntu | ||
| === me2win [n=me2win@adsl-69-153-16-10.dsl.snantx.swbell.net] has joined #ubuntu | ||
| healot | how about "powermanga" :) | 07:03 |
| trappist | scandian: frozen-bubble | 07:03 |
| tRSS | Anyone knows where I can find the OS X like dock for kubuntu? | 07:03 |
| === Steve^ [n=Steve@host-138-38-239-234.nat.bath.ac.uk] has joined #ubuntu | ||
| scandian | ok thanks | 07:03 |
| healot | oldschool style space shooter or maybe "tuxracer"? | 07:03 |
| Steve^ | What's a good CD/DVD burning program? | 07:03 |
| Storkme | healot, the source code for what? | 07:03 |
| trappist | oh yeah tuxracer | 07:03 |
| me2win | /quit | 07:03 |
| swab79 | sorry, i got cut off... I had to load DAC960 to get the array to work, could there be more modules/drivers i need? | 07:04 |
| === me2win [n=me2win@adsl-69-153-16-10.dsl.snantx.swbell.net] has joined #ubuntu | ||
| === jakobc [n=jakobc@c-68-50-188-205.hsd1.md.comcast.net] has joined #ubuntu | ||
| healot | Storkme, guess? | 07:04 |
| === iBalo [n=user@dslb-088-072-236-009.pools.arcor-ip.net] has joined #ubuntu | ||
| h0nus | Jhair, now it says "/usr/bin/ld: cannot find -lpq" | 07:04 |
| Storkme | whatever | 07:04 |
| sfar | what does "-9" do in the kill-command? | 07:04 |
| === jakobc [n=jakobc@c-68-50-188-205.hsd1.md.comcast.net] has left #ubuntu ["Leaving"] | ||
| danf_1979 | man man man man | 07:05 |
| idefix__ | someone I know says perpetuum mobile's aren't possible | 07:05 |
| idefix__ | I have designed one | 07:05 |
| === vista [n=wisitven@222.33.200.30] has left #ubuntu [] | ||
| Steve^ | noone can suggest some cd burning software? | 07:06 |
| === djm62 [n=djm62@82-40-136-135.cable.ubr08.uddi.blueyonder.co.uk] has joined #ubuntu | ||
| === nickrud waits with bated breath | ||
| h0nus | healot, where on packages.ubuntu.com would i find security packages? | 07:06 |
| nickrud | Steve^, I've had some success with k3b | 07:06 |
| === ick [n=moggio@213-48-145-66.cro.cvx.blueyonder.co.uk] has left #ubuntu [] | ||
| h0nus | i'm looking specifically for libssh and sapr3 | 07:06 |
| === samurai22 [n=purdev@65-182-54-93.biltmorecommunications.net] has joined #ubuntu | ||
| === chavella [n=domenico@ppp-129-208.30-151.libero.it] has joined #ubuntu | ||
| === Istario [n=[tgn] cok@63.201.14.135] has joined #ubuntu | ||
| Steve^ | nickrud, I think that's what I used with suse, but i'm trying to avoid using kde stuff in gnome | 07:07 |
| === moises [n=moises@83.230.235.11] has joined #ubuntu | ||
| === timon is now known as timon-ubu | ||
| idefix__ | do you guys think I'm crazy? is it really impossible to design a PM ? | 07:07 |
| healot | h0nus, the packages lists has a security updates list.... | 07:07 |
| === Nafai [n=nafai@rrcs-24-73-247-70.sw.biz.rr.com] has joined #ubuntu | ||
| scandian | there is a billard game where i can play alone?? | 07:07 |
| samurai22 | Trying to get Japanese SCIM to work on breezy | 07:07 |
| nickrud | Steve^, I mentioned the one I had the best success with ; gnomebaker & gravman work ok | 07:07 |
| === catalinux [n=catalinu@86.35.32.57] has left #ubuntu ["Leaving"] | ||
| healot | samurai, use uim instead... | 07:08 |
| h0nus | healot, i think i'm missing it? | 07:08 |
| === irad [n=irad@80.74.115.33] has joined #ubuntu | ||
| samurai22 | I have already compiled the latest from the debian source (gets rid of segfault) | 07:08 |
| healot | install anthy,uim-gapplet and uim, load the gapplet, bam | 07:08 |
| === honkzilla [n=honkman@svwr1-253.svtv.com] has joined #ubuntu | ||
| === ubuntugeek [n=ubuntuge@64.141.138.3] has joined #ubuntu | ||
| === [129-CarNagE] [n=CarNi@dslb-084-057-253-148.pools.arcor-ip.net] has joined #ubuntu | ||
| irad | how does the xvid/divx codec for kubuntu package named?? | 07:09 |
| nickrud | scandian, apt-cache search billiards shows three | 07:09 |
| samurai22 | healot, what is the difference between uim and scim? | 07:09 |
| === bigbootay [n=bigboota@209.250.156.214] has joined #ubuntu | ||
| LadyNikon | !mozilla1.5 | 07:09 |
| ubotu | My cat's name is Mittens! Try searching at http://ubuntu.cc.com.au/, LadyNikon | 07:09 |
| LadyNikon | hmm | 07:09 |
| healot | (u) and (sc) | 07:10 |
| LadyNikon | !mozilla | 07:10 |
| ubotu | parse error: Try searching at http://ubuntu.cc.com.au/, LadyNikon | 07:10 |
| sfar | ubotu, tell LadyNikon about firefox1.5 | 07:10 |
| LadyNikon | dang | 07:10 |
| healot | scim has wrapper to most IM | 07:10 |
| LadyNikon | sfar: thanks | 07:10 |
| === purple^haze [n=blaze@c-69-139-7-167.hsd1.pa.comcast.net] has joined #ubuntu | ||
| irad | anyone? | 07:10 |
| === _-benz-_ [n=benz@sf-corp-nat11.pno.net] has joined #ubuntu | ||
| bisquit | Ermm.. I followed the ATI Binary Wiki, and well when I start a 3d app, (I have Xorg) it says :: Xlib: extension "XFree86-DRI" missing on display | 07:10 |
| purple^haze | whats a good dvd simulator program for .iso and .bin/cue files? | 07:10 |
| samurai22 | (sc) understood | 07:10 |
| === bisquit is confused | ||
| === anabelen [n=anabelen@82.198.125.242] has joined #ubuntu | ||
| anabelen | hola | 07:11 |
| anabelen | hola | 07:11 |
| LadyNikon | hi | 07:11 |
| === haluk [n=haluk@85.101.153.95] has joined #ubuntu | ||
| healot | samurai22, for GNOME use, uim is more lightweight, and there is a a gapplet to activate uim for any GNOME application | 07:12 |
| irad | how does the xvid/divx codec package is named? | 07:12 |
| === agabus_ [n=agabus@210-84-35-118.dyn.iinet.net.au] has joined #ubuntu | ||
| anabelen | hello | 07:12 |
| === pvanhoof [n=pvanhoof@d54C0E27E.access.telenet.be] has joined #ubuntu | ||
| === sfar [n=sfar@c-30f2e253.18-2-64736c10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| samurai22 | healot, can you use both at the same time or are they m.exclusive? | 07:13 |
| === marbej [n=marbej@eob81.neoplus.adsl.tpnet.pl] has joined #ubuntu | ||
| === gfxstyler [n=gfxstyle@i577A4E2B.versanet.de] has joined #ubuntu | ||
| gfxstyler | hi | 07:13 |
| purple^haze | whats a good dvd simulator program for .iso and .bin/cue files? | 07:13 |
| anabelen | hi | 07:13 |
| gfxstyler | how can i change the hostname? | 07:13 |
| healot | per application... just like Microsoft Japanese IME | 07:13 |
| gfxstyler | i tried "dpkg-reconfigure hostname" but its not working ... so i wonder how to do that? | 07:13 |
| haluk | hello everyone i m a new linux user and i want to install java runtime edition so i downloaded it but i can't install. How can i do? | 07:13 |
| anabelen | is talh spanis | 07:13 |
| anabelen | ??? | 07:14 |
| gfxstyler | i edited /etc/hostname.conf but now sudo doesn't work anymore ... something with "getHostByName()" | 07:14 |
| nickrud | gfxstyler, edit /etc/hostname , /etc/hosts , and hostname <name> | 07:14 |
| === miranda [n=miranda@83.230.235.204] has joined #ubuntu | ||
| gfxstyler | nickrud: thanks | 07:14 |
| === aleksi [n=aleksi@a84-231-144-167.elisa-laajakaista.fi] has joined #ubuntu | ||
| === aleksi [n=aleksi@a84-231-144-167.elisa-laajakaista.fi] has left #ubuntu ["Lhdss"] | ||
| === thefish [n=thefish@unaffiliated/thefish] has joined #ubuntu | ||
| nickrud | gfxstyler, you're gonna need to reboot into recovery mode, and edit /etc/hosts & /etc/hostname | 07:14 |
| === yaff [n=yacine@86.71.140.17] has joined #ubuntu | ||
| === max [n=max@p549FAF73.dip0.t-ipconnect.de] has joined #ubuntu | ||
| miranda | quieres salir com migo? | 07:14 |
| samurai22 | healot, will try uim. thanks for your help | 07:14 |
| nickrud | !es | 07:14 |
| ubotu | Hispanohablantes: Por favor usen #ubuntu-es, #kubuntu-es o #edubuntu-es, alli obtendran mas ayuda. | 07:14 |
| === ssanchez [n=ssanchez@83.230.235.11] has joined #ubuntu | ||
| gfxstyler | nickrud: okay, im trying it, thank you :) | 07:15 |
| === gfxstyler [n=gfxstyle@i577A4E2B.versanet.de] has left #ubuntu ["Leaving"] | ||
| yaff | hi | 07:15 |
| ssanchez | hola | 07:15 |
| yaff | I just got a bug while trying to launch space-orbit | 07:15 |
| yaff | under dapper | 07:15 |
| === leonel_ [n=leonel@201.123.94.180] has joined #ubuntu | ||
| yaff | a problem with freeglut or something | 07:15 |
| healot | samurai22, in synapctic list you should see "anthy", "uim" and "uim gapplet" | 07:16 |
| === pitti [n=pitti@ubuntu/member/pitti] has joined #ubuntu | ||
| yaff | I can't play :( | 07:16 |
| anabelen | hola | 07:16 |
| nickrud | yaff, try #ubuntu+1 , that's the dapper channel | 07:16 |
| anabelen | de donde eres ?? | 07:16 |
| yaff | nickrud, thanks | 07:16 |
| Seveas | anabelen, english please | 07:16 |
| Seveas | !es | 07:16 |
| ubotu | Hispanohablantes: Por favor usen #ubuntu-es, #kubuntu-es o #edubuntu-es, alli obtendran mas ayuda. | 07:16 |
| === yaff [n=yacine@86.71.140.17] has left #ubuntu ["Quitte"] | ||
| healot | dapper is in testing version and bleh | 07:16 |
| === chris [n=chris@6532135hfc138.tampabay.res.rr.com] has joined #ubuntu | ||
| anabelen | hello | 07:18 |
| samurai22 | healot, do you mean uim-applet-gnome | 07:18 |
| chris | is there away to reinstall ubuntu with out the cd | 07:18 |
| ssanchez | hola | 07:18 |
| ssanchez | k tal | 07:18 |
| healot | yup | 07:18 |
| purple^haze | whats a good dvd simulator program for .iso and .bin/cue files? | 07:18 |
| healot | gapplet | 07:18 |
| healot | just load the applet on GNOME taskbar | 07:19 |
| healot | and get going... | 07:19 |
| ubuntugeek | !forums | 07:19 |
| === s0ciopath [n=user@net34-155.netkaster.ca] has joined #ubuntu | ||
| anabelen | bien y tu ? | 07:19 |
| purple^haze | !virtual dvd | 07:19 |
| ubotu | What? Try searching at http://ubuntu.cc.com.au/, purple^haze | 07:19 |
| healot | purple^haze, you can mount the ISO file... but however you need to strip your bin file into ISO format first... | 07:19 |
| === sylvain [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has left #ubuntu ["Quitte"] | ||
| purple^haze | healot, thank u | 07:20 |
| anabelen | de donde eres ?? | 07:20 |
| chris | is there away to reinstall ubuntu with out the c | 07:20 |
| purple^haze | healot, what about .img files? | 07:20 |
| === ernz [n=ernz@217.17.122.252] has joined #ubuntu | ||
| healot | purple^haze, need to strip taht too | 07:20 |
| === meisam [n=meisam@219.93.242.162] has joined #ubuntu | ||
| ernz | Helllo again people | 07:20 |
| === Sergi0 [n=serge@ip227-28-166-62.adsl.versatel.nl] has joined #ubuntu | ||
| ernz | How can I play RealMedia files on Ubuntu? | 07:21 |
| healot | only ISO9660 image is natively supported | 07:21 |
| === eekrano [n=eekrano@c-24-131-187-162.hsd1.ma.comcast.net] has joined #ubuntu | ||
| === kung [n=kung@dslb-084-058-242-137.pools.arcor-ip.net] has joined #ubuntu | ||
| anabelen | de donde eres | 07:21 |
| awelynant | I accidentaly removed GAIM from the gnome panel, and now the notification icon shows up in a little standalone window | 07:22 |
| healot | anabelen, hablen anglais? thanks :) | 07:22 |
| awelynant | how do I get it back? | 07:22 |
| === djm62 [n=djm62@82-40-136-135.cable.ubr08.uddi.blueyonder.co.uk] has left #ubuntu [] | ||
| === sexcopter8000m [n=james@dslb-082-083-214-140.pools.arcor-ip.net] has joined #ubuntu | ||
| Frogzoo | awelynant: I believe it's an option in the settings somewhere | 07:22 |
| awelynant | Frogzoo:any idea which settings? | 07:23 |
| === leonel_ is now known as leonel | ||
| === Tomcat_ [n=Tomcat@p54A18B7C.dip0.t-ipconnect.de] has joined #ubuntu | ||
| ernz | Anyone got a suggestion on how to play RealMedia files on Ubuntu? | 07:23 |
| === anabelen [n=anabelen@82.198.125.242] has joined #ubuntu | ||
| Frogzoo | awelynant: no, sorry | 07:23 |
| === Selucresh [n=Selucres@CPE-65-30-180-7.wi.res.rr.com] has joined #ubuntu | ||
| anabelen | hello | 07:23 |
| healot | "Notification Message" | 07:23 |
| anabelen | hello | 07:23 |
| anabelen | hello | 07:23 |
| healot | sorry "Message Notification" | 07:23 |
| ernz | Awelynany, try a right click on the panel, add an item and then try a search | 07:24 |
| healot | under Plugin... | 07:24 |
| LadyNikon | anabelen: you dont have to repeat yourself. | 07:24 |
| === marbej [n=marbej@eob81.neoplus.adsl.tpnet.pl] has left #ubuntu ["Wychodz"] | ||
| === mattwestm [n=mattwest@adsl-144-175-138.rmo.bellsouth.net] has joined #ubuntu | ||
| healot | anabelen, any question that you're seeking answer for? | 07:24 |
| === sergio_ [n=sergio@85-49-139-17.mad2.adsl.uni2.es] has joined #ubuntu | ||
| mattwestm | how do I get a list of all users? | 07:24 |
| anabelen | is talk spanis | 07:25 |
| Frogzoo | awelynant: healot has a good point - do you still have "notification area" in the task bar? if not, you'll have to add it back in | 07:25 |
| Rubin | mattwestm: users are defined in /etc/passwd | 07:25 |
| === ygetartson [n=s307473@p213.54.82.133.tisdip.tiscali.de] has left #ubuntu [] | ||
| ernz | :( Someone help? | 07:26 |
| === Ku-guy [n=Ku-guy@p54A6CE2A.dip.t-dialin.net] has joined #ubuntu | ||
| healot | non, me no hablen espanol... anabelen | 07:26 |
| === ernz is seriously loosing faith in Ubuntu | ||
| nick|here | ernz, i heard realplayer has a version for linux | 07:26 |
| anabelen | my no inglis | 07:26 |
| ernz | Only RPM and BIN installers Nick|Here | 07:26 |
| healot | ernz, you sucked for media :) | 07:27 |
| LadyNikon | !es | 07:27 |
| awelynant | Frogzoo: I added a new notification area, no joy. It still appears in its own little window | 07:27 |
| ubotu | Hispanohablantes: Por favor usen #ubuntu-es, #kubuntu-es o #edubuntu-es, alli obtendran mas ayuda. | 07:27 |
| anabelen | my shou shoy talk inglys | 07:27 |
| healot | ernz, you can "alien" RPM packages | 07:27 |
| samurai22 | healot, installed the packages, but where do I find them in the menu? | 07:27 |
| Frogzoo | awelynant: now look for a gaim option to minimize to taskbar | 07:27 |
| ernz | I tried using alien healot, and it said it was an unrecognised command | 07:27 |
| LadyNikon | heh Frogzoo i remember the first time i did that | 07:27 |
| === oropeza [n=oropeza@200.65.6.100] has joined #ubuntu | ||
| LadyNikon | i was like.. woah it didnt just close our. | 07:28 |
| LadyNikon | out* | 07:28 |
| oropeza | hi | 07:28 |
| === [FR33_B33R] [n=ashish@221.134.28.81] has joined #ubuntu | ||
| healot | samurai22, add the gapplet by clicking right on GNOME panels | 07:28 |
| oropeza | Hola | 07:28 |
| [FR33_B33R] | umm... hey all.... anyone got JACK working? | 07:28 |
| healot | "Add to Panel" -> find the UIM gapplet... | 07:28 |
| LadyNikon | wow | 07:28 |
| LadyNikon | there are alot of spanish users | 07:28 |
| anabelen | you mi comprend | 07:28 |
| === babo [n=babo@220.94.104.5] has joined #ubuntu | ||
| healot | ernz, "alien" isn;'t isntalled by default, "apt-get" it :) | 07:29 |
| babo | Can anyone have another look here ... pls ... ? http://pastebin.com/631103 | 07:29 |
| === gremid [n=middell@p54BDDB82.dip.t-dialin.net] has joined #ubuntu | ||
| === ssanchez [n=ssanchez@83.230.235.11] has left #ubuntu ["Abandonando"] | ||
| oropeza | hola alguien que hable espaol | 07:29 |
| LadyNikon | anabelen: por favor usen #ubuntu-es | 07:29 |
| oropeza | :D | 07:29 |
| healot | jo no comprende tu :) | 07:29 |
| === ubuntu [n=ubuntu@ACBCD490.ipt.aol.com] has joined #ubuntu | ||
| ubuntu | hi | 07:29 |
| ubuntu | i need help | 07:30 |
| ernz | healot, I am noob here - I dont even know what sudo is | 07:30 |
| oropeza | un saludo a todos desde Mxico | 07:30 |
| sfar | hi ubuntu.. type /nick yournickname to change nick :) | 07:30 |
| ernz | I think apt-get is some sort of online installer interface | 07:30 |
| LadyNikon | oropeza: por favor usen #ubuntu-es | 07:30 |
| === ubuntu is now known as minif | ||
| minif | i need help | 07:30 |
| sfar | just ask | 07:30 |
| healot | ernz, a great journey start with a goal :) | 07:30 |
| minif | u know the GRUB thing? | 07:30 |
| sfar | yes | 07:30 |
| ernz | Yea....? | 07:30 |
| === s_g [i=s_g@toronto-HSE-ppp4038907.sympatico.ca] has joined #ubuntu | ||
| ernz | :S | 07:30 |
| healot | the bootloader | 07:30 |
| minif | i need to get it back to the windows thing | 07:31 |
| === gremid [n=middell@p54BDDB82.dip.t-dialin.net] has left #ubuntu [] | ||
| anabelen | how are you ? | 07:31 |
| healot | minif, load your Window XP/2000 CD | 07:31 |
| === epinephrine [i=geek@82-37-152-150.cable.ubr01.wals.blueyonder.co.uk] has joined #ubuntu | ||
| minif | cos im wanting to safely uninstall linux (dualboot system) | 07:31 |
| s_g | Alrighty, I need some help from a hardware geek. | 07:31 |
| === jjesse [n=jjesse@mail.ftpb.com] has joined #ubuntu | ||
| === mahangu [n=mahangu@unaffiliated/mahangu] has joined #ubuntu | ||
| minif | cant find CD | 07:31 |
| healot | run it in Recovery... then run "fixboot" and "fixmbr" | 07:31 |
| jjesse | i have a quesiont on eveloution and excahnge | 07:31 |
| ernz | Hey Healot, I am now wanting the app described HERE: wget http://beerorkid.com/automatix/automatix_5.4-2_i386.deb - But it can't resolve this DEB package, it says 404 Cant be found | 07:31 |
| [FR33_B33R] | hahha... help with uninstallation but yea... installing XP should clear hte MBR right? | 07:32 |
| === oropeza [n=oropeza@200.65.6.100] has left #ubuntu ["Abandonando"] | ||
| jjesse | when I try to setup Evelotuion to connect to MS Exchange it asks for a username and no matter what I put into it i cannot click on next | 07:32 |
| ernz | http://ubuntuos.com/2006/02/automatix-easy-installation.html <<- Soz, thats the URL | 07:32 |
| minif | run which in recovery? | 07:32 |
| healot | ernz, the file is just not there :) | 07:32 |
| === mattwestm [n=mattwest@adsl-144-175-138.rmo.bellsouth.net] has left #ubuntu ["Leaving"] | ||
| s_g | I'm just debating on whether or not I should buy this Pentium D 920/945P-A combo for $220 from Fry's, or should I wait until the price drops in late April. | 07:32 |
| deefzi | does anyone know what the "Turn On your tags" on dc-hubs mean? i'm using valknut | 07:32 |
| ernz | Where can I get a big list of jazz to install? | 07:32 |
| samurai22 | healot, got it, but gedit crashes now | 07:32 |
| s_g | Anyone got any suggestions? | 07:32 |
| === mauro [n=mauro@dsl-200-67-236-216.prod-empresarial.com.mx] has joined #ubuntu | ||
| ernz | Like automatix | 07:32 |
| minif | ? | 07:32 |
| Frogzoo | s_g: get an A64 | 07:33 |
| healot | samurai22, did you run the uim setup yet? | 07:33 |
| minif | so how do i go about it? | 07:33 |
| === gnomefreak [n=gnomefre@unaffiliated/gnomefreak] has joined #ubuntu | ||
| [FR33_B33R] | umm... hey all.... anyone got JACK working? | 07:33 |
| Steve^ | no, he's a lazy bastard | 07:33 |
| minif | ???? | 07:33 |
| s_g | Frogzoo: Yeah, it's cheaper and completely kills the 920 at gaming, but the whole dual core thing has got my panties in a bunch. | 07:33 |
| healot | samurai22, "uim"+tab+tab :) | 07:33 |
| Frogzoo | s_g: how so? dual core is very mature tech? | 07:34 |
| === Jaquelin [n=Jaquelin@83.230.235.24] has joined #ubuntu | ||
| healot | minif, load the CD, you'll find out | 07:34 |
| === Sergi0 [n=serge@ip227-28-166-62.adsl.versatel.nl] has left #ubuntu ["Konversation] | ||
| healot | Microsoft made things easier just for you :) | 07:34 |
| samurai22 | trying it out | 07:34 |
| === hatake_k1kashi [n=meh@60-240-246-244.tpgi.com.au] has joined #ubuntu | ||
| Jaquelin | hello | 07:34 |
| minif | i really need to get my dual boot system back to normal, i was thinkin of reinstallin ubuntu as fat 32 but it has conflicts......and i cant find my win xp cd | 07:34 |
| s_g | Frogzoo: Games aren't multithreaded (yet). So a good A64 does ~50fps more. | 07:34 |
| === marck [n=marck@radios.netwaybbs.com.br] has joined #ubuntu | ||
| pulgoki | can anyone tell me, when you have wrappers setup in hosts.allow and hosts.deny, when there is a scan for the port that is open from an unauthorized address, is it just dropped or will it reply as existing but closed? | 07:34 |
| === snake-holiday [i=snake@82-45-112-35.stb.ubr02.maid.blueyonder.co.uk] has joined #ubuntu | ||
| minif | ... | 07:35 |
| healot | samurai22, if you actually find the setup for uim, find the "lazy loading" feature, check it and reload the gapplet | 07:35 |
| minif | wot to do..... | 07:35 |
| === marck [n=marck@radios.netwaybbs.com.br] has left #ubuntu ["Fui] | ||
| === haller [n=haller@i577AAFC0.versanet.de] has joined #ubuntu | ||
| healot | minif, then nothing, Windows XP CD is the best way to recover your window nt bootloader and mbr | 07:36 |
| s_g | Frogzoo: In the long run, which would last me longer? A single core 3700+, or a D 920? | 07:36 |
| === Kyn [n=Kyn@207.65.228.185] has joined #ubuntu | ||
| snake-holiday | hi anyone able to help me i cant get my pc to connect to the internet | 07:36 |
| === haller [n=haller@i577AAFC0.versanet.de] has joined #ubuntu | ||
| minif | is there neway i cud do it thru the ubuntu cd??? | 07:36 |
| Kyn | What is your setup like, snake? | 07:36 |
| healot | damn, what's the name of that BootCD that can recover Windows XP password/bootloader? | 07:36 |
| === ssanchez [n=ssanchez@83.230.235.11] has joined #ubuntu | ||
| gnomefreak | healot: xp cd can do it or 98 boot disk | 07:37 |
| Kyn | BartPE? | 07:37 |
| === Meinaaja [n=antti@dsl-jklgw3-fe1ddf00-94.dhcp.inet.fi] has joined #ubuntu | ||
| === geek_ [n=geek@84.90.83.65] has joined #ubuntu | ||
| healot | 98 doesn't recover the bootloader, gnomefreak | 07:37 |
| Frogzoo | s_g: maybe neither - just wait till M2 is released, sometime real soon now | 07:37 |
| snake-holiday | well ummm i real new to this but everything else works but no ip | 07:37 |
| healot | it only replaces the mbr bootcode | 07:37 |
| ernz | YEEEEEEHAAA!!! I done it | 07:37 |
| swab79 | I have a DAC960 scsi controller. got RAID 5 working, but can't see a device for my tape drive (HP C1537A). I have the DAC960 module loaded, any ideas? | 07:38 |
| ernz | Man - I am smart. | 07:38 |
| ernz | :P | 07:38 |
| snake-holiday | it is the lastest one on the site | 07:38 |
| === j2daosh [n=josh@66-191-145-50.dhcp.roch.mn.charter.com] has left #ubuntu ["Leaving"] | ||
| healot | done what, ernz ? | 07:38 |
| samurai22 | healot, palyed with the config but still crashes - should I try and remove all scim-related packages | 07:38 |
| Kyn | Snake: Are you connecting via a router? a modem? | 07:38 |
| healot | yeah | 07:38 |
| healot | yeah | 07:38 |
| gnomefreak | healot: it can erase the mbr of grub and puts win bootloader on it but it wont boot linux | 07:38 |
| === DjDarkman [n=djdarkma@86.126.205.187] has joined #ubuntu | ||
| snake-holiday | pc to switch to modem | 07:38 |
| s_g | Frogzoo: That's a few months away, I'm not a patient man. The thing is, 939 will be phased out by M2, but 775 is still going to be used by Intel. | 07:39 |
| healot | SCim wraps uim too, samurai22, yeah happened to me too | 07:39 |
| healot | gnomefreak, I just told you | 07:39 |
| === Squaredge [n=Squaredg@ALille-151-1-70-99.w86-207.abo.wanadoo.fr] has joined #ubuntu | ||
| Kyn | Snake: So, you have a DSL modem -> 10/100 switch -> 2 computers? | 07:39 |
| Kyn | Snake: That can't work. | 07:39 |
| Frogzoo | s_g: when you realise you can't run pacifica, you'll kick yourself if you've just upgraded... | 07:39 |
| healot | but the NTloader bootlist cannot be recovered with Windows 98 CD | 07:39 |
| DjDarkman | hy ,how can i add a program ,to always run ,with cron? | 07:40 |
| snake-holiday | umm (mmkay) uptil i changed over it was 5 pc to swich to cable modem | 07:40 |
| ssanchez | como te llamas | 07:40 |
| gnomefreak | psssst ntbootloader is garbage anyway | 07:40 |
| hatake_k1kashi | snake-holiday: modem will only give out the connection to one computer, not two. You need a router or something as the gateway | 07:40 |
| === lupz [n=lupz@85-18-14-6.fastres.net] has joined #ubuntu | ||
| s_g | Frogzoo: Heh, well, I'm tempted to buy this. I haven't been into games for a long time, but this year has a lot of interesting stuff coming out. | 07:40 |
| === dije [n=dije@62.58.114.253] has joined #ubuntu | ||
| Frogzoo | DjDarkman: you mean have a program always running, like a daemon? | 07:40 |
| healot | gnomefreak, it is not... you just don't know how to empower it :) | 07:41 |
| DjDarkman | yes | 07:41 |
| Kyn | snake: I would suspect that it isn't a switch then. It's probably a router. What is it, specifically? | 07:41 |
| Kyn | snake: gimme a model number. | 07:41 |
| snake-holiday | (mmkay) it is a surfboard sb4100 | 07:41 |
| Frogzoo | s_g: if gaming is even 30% of the purchasing decision, go the AMD | 07:41 |
| DjDarkman | yes Frogzoo | 07:41 |
| Kyn | snake: That sounds like the name of your dsl modem. | 07:41 |
| === hatake_k1kashi is now known as hatake_kakashi | ||
| s_g | Frogzoo: What about DDR2? AMD doesn't support it until M2. | 07:41 |
| Frogzoo | s_g: plus AMDs burn quite a few less watts, so work out even cheaper long term | 07:42 |
| === pitti [n=pitti@ubuntu/member/pitti] has joined #ubuntu | ||
| snake-holiday | yes and it can support up to 32 pcs | 07:42 |
| s_g | Hmm. | 07:42 |
| Kyn | snake: So, there's no switch? | 07:42 |
| Frogzoo | s_g: current a64 doesn't need ddr2 - plain ddr is quite sufficient to keep the pipes full - it's only intel that have a memory b/w problem | 07:42 |
| hatake_kakashi | snake-holiday: are you sure its a modem? or is it a modem/router | 07:42 |
| snake-holiday | umm (mmkay) can i Private Message you | 07:42 |
| samurai22 | healot, still crashes but only when I click on the gedit window now (instead of directly upon startup) | 07:43 |
| s_g | Frogzoo: How much do you think I should spend, then? And which processor? I've been thinking about the 3700+. | 07:43 |
| === guest_ [n=guest@pool-71-114-18-154.washdc.dsl-w.verizon.net] has joined #ubuntu | ||
| === bintut [n=bintut@203.131.183.252] has left #ubuntu ["Leaving"] | ||
| === jjesse [n=jjesse@mail.ftpb.com] has left #ubuntu ["Konversation] | ||
| LathropWells | buy the best video card you can afford and build the system around it? - wide grin | 07:44 |
| healot | I don't have DDR2 mobo/RAM, does it have any significant over the DDR RAM? | 07:44 |
| === PsyberOne [n=psyber@c-24-14-165-171.hsd1.il.comcast.net] has joined #ubuntu | ||
| Kyn | snake: That's a router/switch cablemodem, it looks like. | 07:44 |
| Frogzoo | s_g: whichever model currently overclocks like a freak :D | 07:45 |
| Kyn | If you have it configured to give out DHCP leases, you shouldn't have any problems at all configuring your ubuntu machine to DHCP (default). | 07:45 |
| === anderson [n=anderson@VPNPOOL04-0101.UNI-MUENSTER.DE] has joined #ubuntu | ||
| ernz | OK, this is cool | 07:45 |
| ernz | Something called Automatix | 07:46 |
| ernz | Installs LOADS of wicked freebees | 07:46 |
| s_g | Frogzoo: Heh, sounds good to me. I personally don't care about graphics, so as long as I'm able to play a game, even at the lowest settings, I'm happy. So with that in mind, how long would a 3700+ last me? A year? Year and a half? | 07:46 |
| hatake_kakashi | !tell ernz about automatix | 07:46 |
| === sYs^ is now known as sYs`afk | ||
| Kyn | snake: Are there link lights on that thing? Is the link light on for the ubuntu box? | 07:46 |
| Frogzoo | DjDarkman: it's probably not a great idea to rely on cron to keep your daemon running | 07:46 |
| === tony_2806 [n=tony2086@adsl-72-50-67-173.prtc.net] has joined #ubuntu | ||
| snake-holiday | yes and yes | 07:46 |
| === jariep1_ [n=a@adsl-68-91-26-173.dsl.eulstx.swbell.net] has joined #ubuntu | ||
| DjDarkman | Frogzoo: but i don`t have root access | 07:46 |
| ernz | Thanks hatake_kakashi - Smash my dreams, what would you suggest as an alternative? | 07:47 |
| ernz | WINDOWS!? | 07:47 |
| Frogzoo | s_g: are you planning on dual vid cards any time soon? SLI/Crossfire? | 07:47 |
| === MacSlow [n=mirco@dslb-084-063-004-204.pools.arcor-ip.net] has joined #ubuntu | ||
| hatake_kakashi | ernz: easyubuntu | 07:47 |
| ernz | WTF is easybuntu? | 07:47 |
| samurai22 | hatake, do you do Japanese Input on your system/ | 07:47 |
| === raic_ [n=raic@gu-students-42-15.graceland.edu] has joined #ubuntu | ||
| === razzmatazz [n=bob@213.197.163.38] has joined #ubuntu | ||
| Dr_Willis | or learn how to install the stuff yourself. | 07:47 |
| hatake_kakashi | samurai22: no, but I ought to :) | 07:47 |
| Dr_Willis | :) | 07:47 |
| ernz | !tell me about easyubuntu | 07:47 |
| Frogzoo | DjDarkman: well cron won't help with that | 07:47 |
| === Biscuitian_Warhe [n=chatzill@1Cust5489.an3.dca16.da.uu.net] has joined #ubuntu | ||
| ernz | !tell ernz about easyubuntu | 07:48 |
| === ErZo [n=ErZo@82.212.70.95] has joined #ubuntu | ||
| ErZo | What's the "default" root password that the installer sets? | 07:48 |
| ErZo | Trying to help a friend. | 07:48 |
| === lwelyn_ [n=lwelyn@p549A57CE.dip.t-dialin.net] has joined #ubuntu | ||
| hatake_kakashi | !tell ernz about easyubuntu | 07:48 |
| gnomefreak | ErZo: your user password | 07:48 |
| snake-holiday | any ideas then Kyn cos im lost with it | 07:48 |
| Frogzoo | !sudo | 07:48 |
| ubotu | somebody said sudo was a command that will let users run commands as root. Look at http://wiki.ubuntu.com/RootSudo for all information. | 07:48 |
| DjDarkman | then Frogzoo how do i add a service without root? | 07:48 |
| Biscuitian_Warhe | I just installed the fglrx driver with the ATI Website Binary, following the wiki's instructions, but now my xserver wont start, the screen just goes black | 07:48 |
| === healot [n=healot@203.92.154.36] has joined #ubuntu | ||
| Dr_Willis | Faq #1 | 07:48 |
| hatake_kakashi | ErZo: use sudo, | 07:48 |
| healot | EBCD ? Emergency Boot CD | 07:48 |
| === didier [n=didier@84.4.205.114] has joined #ubuntu | ||
| === jerzykiller [i=f1z3w5@nat-tar.aster.pl] has joined #ubuntu | ||
| === jerzykiller [i=f1z3w5@nat-tar.aster.pl] has left #ubuntu ["Wychodz"] | ||
| ErZo | gnomefreak: hatake_kakashi If I don't want her to use sudo then? I want her to be able to be root <.< | 07:49 |
| ErZo | oops. | 07:49 |
| === Frustrum [n=gilesp@c-67-183-23-247.hsd1.wa.comcast.net] has joined #ubuntu | ||
| ErZo | gnomefreak: She said she tried with her own password, it wasn't it. | 07:49 |
| gnomefreak | Biscuitian_Warhe: sudo dpkg-reconfigure xserver-xorg (make sure the driver and card are correct) | 07:49 |
| Frogzoo | DjDarkman: you run it on a high > 1023 port | 07:49 |
| raic_ | any hints as to how to get recording to work again in dapper? | 07:49 |
| gnomefreak | ErZo: the person that installed it its their password | 07:49 |
| ernz | hatake_kakashi - Nothing | 07:49 |
| healot | that's the bootcd that I usually use for Windows XP recovery | 07:49 |
| Biscuitian_Warhe | gnomefreak: I did, I selected fglrx and picked the right card | 07:50 |
| gnomefreak | raic_: dapper is now found at #ubuntu+1 | 07:50 |
| === katotah [n=tiago@201-27-218-45.dsl.telesp.net.br] has joined #ubuntu | ||
| hatake_kakashi | ErZo: it is not recommended to login as root, you can do it fairly easily with tty but with xwindows, you need to edit files, etc | 07:50 |
| === lwelyn_ is now known as Lwelyn | ||
| === techrush [n=techrush@ip68-227-56-163.lv.lv.cox.net] has joined #ubuntu | ||
| raic_ | thanks | 07:50 |
| techrush | !restricted | 07:50 |
| ubotu | methinks restricted is https://wiki.ubuntu.com/RestrictedFormats Most of the formats listed here can be replaced by !FreeFormats | 07:50 |
| === raic_ [n=raic@gu-students-42-15.graceland.edu] has left #ubuntu ["Ex-Chat"] | ||
| s_g | Frogzoo: Sorry, phone call. Probably no SLI anytime soon, I personally don't give a damn about running at a bazillion FPS. I used to get by on Half-Life at 15fps. | 07:50 |
| ErZo | hatake_kakashi: Do you need to type in a password for sudo? | 07:50 |
| hatake_kakashi | ernz: you should be able to see it previously or something | 07:50 |
| hatake_kakashi | ErZo: yes and its your user password that you have set | 07:51 |
| healot | "sudo" for ubuntu, yay! | 07:51 |
| s_g | Frogzoo: As long as I can get at least 30fps, I'm happy. But I expect to get much more than that for current-gen games. | 07:51 |
| gnomefreak | ErZo: sudo -i for a root terminal | 07:51 |
| samurai22 | healot, I have the stack trace of the crash - seems to be coming from uim | 07:51 |
| hatake_kakashi | gnomefreak: that's one of the methods ;) | 07:52 |
| === ErZo [n=ErZo@82.212.70.95] has left #ubuntu ["Ok,] | ||
| snake-holiday | (mmkay) anyone able to solve my problem ubuntu ip wont solve | 07:52 |
| gnomefreak | hatake_kakashi: one of many | 07:52 |
| hatake_kakashi | yup | 07:52 |
| Frogzoo | s_g: what I don't understand is the urgency - if you wait a couple of months, you can invest in an M2, with pacifica - new mobo/ram & then in 18 months when you upgrade, you reuse the mobo - just upgrade the cpu | 07:52 |
| healot | removed "scim" yet? | 07:52 |
| === I_am_the_cure [n=master@c-67-191-86-100.hsd1.fl.comcast.net] has joined #ubuntu | ||
| samurai22 | thought so, how to make sure? | 07:53 |
| === thoffmeyer [n=tim@ppp-70-229-36-69.dsl.klmzmi.ameritech.net] has joined #ubuntu | ||
| Dr_Willis | if thersim waiting for the next gen of cpus and stuff to get out - befor i upgrade. :P | 07:53 |
| Frustrum | For some reason I can't download CD images with BitTorrent. Here's my error: <<"dapper-install-i386.iso": Aborting the torrent as it was rejected by the tracker while not connected to any peers. Message from the tracker: Requested download is not authorized for use with this tracker.>> Am I being dumb, or is something broken? | 07:53 |
| === DJ_Mirage [n=djmirage@biggetje.xs4all.nl] has joined #ubuntu | ||
| Frogzoo | Frustrum: the tracker doesn't like you | 07:53 |
| s_g | Frogzoo: There's no real urgency, I just have a lack of patience. | 07:53 |
| healot | remove all scim/scim related files? | 07:53 |
| === isilzha [n=isilzha@155.69.162.67] has joined #ubuntu | ||
| === LeeJunFan [n=junfan@s64-186-37-84.skycon.net] has joined #ubuntu | ||
| gnomefreak | Frogzoo: try a non torrent mirror | 07:54 |
| I_am_the_cure | question, I need 2 install wine * it says its package is not there even after update... How do I get it installed now? | 07:54 |
| gnomefreak | !wine | 07:54 |
| samurai22 | healot, how to make sure it's all deleted? | 07:54 |
| gnomefreak | ubotu tell I_am_the_cure about wine | 07:54 |
| healot | because basically scim will wrap all the IME installed | 07:55 |
| healot | scim is heavy to load... | 07:55 |
| healot | Frustrum, broken/outdated torrent | 07:55 |
| Frogzoo | s_g: what I'm trying to say is, I can't advise you any better than to say wait a couple of months, I'd be lying to say any different | 07:55 |
| I_am_the_cure | I also need to know how 2 open sh files using gui.. | 07:55 |
| === mauro is now known as dientespodridos | ||
| I_am_the_cure | I have alien & deb package handling packages installed but dont think it works | 07:55 |
| healot | when tehre is no scim/scim related packages installed, dude use SYnaptic | 07:56 |
| Frogzoo | s_g: do you understand what pacifica will do? | 07:56 |
| s_g | Frogzoo: The other thing is I don't want to pay that much; M2 will be very expensive at launch. I'm looking to do around $250 for the mobo and CPU. | 07:56 |
| s_g | Frogzoo: Not really. | 07:56 |
| === krauter [n=krauter@host74-173.pool8258.interbusiness.it] has joined #ubuntu | ||
| === epinephrin [i=geek@82-37-152-150.cable.ubr01.wals.blueyonder.co.uk] has joined #ubuntu | ||
| === espresso [n=espresso@adsl-69-231-173-45.dsl.irvnca.pacbell.net] has joined #ubuntu | ||
| === Zoroaster [n=System@70-243-24-226.ded.swbell.net] has joined #ubuntu | ||
| Frogzoo | s_g: pacifica removes the emulation layer from VMs like vmware and qemu - you'll be able to run multiple virtual machines at full CPU speed - it will be totally awesome | 07:57 |
| === ghoulee [n=lnc@63.211.200.74] has joined #ubuntu | ||
| espresso | Frogzoo: I'm a HUGE fan of VMware... but my virtual machine doesn't run as fast as the host OS. | 07:58 |
| ernz | hatake_kakashi - I just looked it up, pretty much the same thing | 07:58 |
| I_am_the_cure | lag!1 | 07:58 |
| samurai22 | I'll try again from the beginning some other time | 07:58 |
| samurai22 | thanks for your help | 07:58 |
| s_g | Frogzoo: Would that apply to Wine as well? | 07:58 |
| espresso | then again, I don't have a whole lot of ram | 07:58 |
| hatake_kakashi | ernz: wouldn't be surprised | 07:58 |
| Frogzoo | espresso: of course not - but the new cpus will change all that | 07:58 |
| === Bluekuja [n=bluekuja@host123-174.pool8250.interbusiness.it] has joined #ubuntu | ||
| === knanand [n=kutty@202.142.108.254.zeeaccess.com] has joined #ubuntu | ||
| I_am_the_cure | I got an 8 meg graphics card, why do Istill lag with 512 meg ram on a 500 mhz pc.. isnt linux supposed too be more effitient | 07:58 |
| I_am_the_cure | ?? | 07:58 |
| ernz | hatake_kakashi - Just looks more official, with less apps and more support. | 07:58 |
| === Darky [n=avi@85-250-15-170.bb.netvision.net.il] has joined #ubuntu | ||
| espresso | Frogzoo: right... 64-bit architecture does amazing stuff as far as making processes lightning fast | 07:59 |
| Darky | hi all | 07:59 |
| Frogzoo | s_g: for wine there will be zero improvement, as it's not an emulator | 07:59 |
| LathropWells | and safer from buffer overflows | 07:59 |
| s_g | Frogzoo: I figured as much, one can only hope. | 07:59 |
| espresso | I have a windows VM and an ubuntu VM running on a SuSE host | 07:59 |
| === pv_ [n=pv@a212-54-30-232.elisa-laajakaista.fi] has joined #ubuntu | ||
| Darky | Can any one give me A P2P Softweres? | 07:59 |
| I_am_the_cure | I cant open debain binarys!! | 07:59 |
| espresso | Darky: are you running bittorrent? | 07:59 |
| === Pablo_C [n=Pablo@03.71.d1c4.cidr.airmail.net] has joined #ubuntu | ||
| Darky | yap | 08:00 |
| Frogzoo | espresso: the point with pacifica & intel's hardware vm implementation is that vms will run at full cpu speed | 08:00 |
| I_am_the_cure | running breezy badger not debain! | 08:00 |
| knanand | How can I play MP3 files???? | 08:00 |
| espresso | Darky: look up azureus | 08:00 |
| hatake_kakashi | ernz: either way, I'm sure you would benefit with more support rather than being on your own | 08:00 |
| Darky | i know,, | 08:00 |
| hatake_kakashi | !tell knanand about mp3 | 08:00 |
| s_g | Well, I don't need VMs. So what would the point be? | 08:00 |
| Darky | but something else? | 08:00 |
| espresso | Frogzoo: that may be the case... but a computer is truly as fast as its slowest bus speed, as that is where bottlenecking occurs for mutliple processes | 08:00 |
| === thoffmeyer [n=tim@ppp-70-229-36-69.dsl.klmzmi.ameritech.net] has joined #ubuntu | ||
| === moonlite [n=moonlite@starbase.olf.sgsnet.se] has joined #ubuntu | ||
| h0nus | brb | 08:01 |
| === knanand [n=kutty@202.142.108.254.zeeaccess.com] has left #ubuntu [] | ||
| === ethan_ [n=ethan@71-208-126-224.hlrn.qwest.net] has joined #ubuntu | ||
| Frogzoo | s_g: I'd say go the 3700 then - tbh - my main box is a 3200 and I've been extremely happy with it, but obviously I'm now seriously considering the M2 rather than an upgrade | 08:01 |
| === CNAP [n=frankie@mr-jax-210-48.dmisinetworks.net] has joined #ubuntu | ||
| espresso | you can have a 4.2GHz 64-bit processor loaded to the gills with ram, but if the bus speed is only 266MHz, then you're gonna be slow | 08:01 |
| ernz | hatake_kakashi - Are you volunteering?? :p | 08:02 |
| CNAP | does anybody know where i can find information on ICS with ubuntu? | 08:02 |
| hatake_kakashi | ernz: no | 08:02 |
| ernz | :( | 08:02 |
| I_am_the_cure | I want too get wine package not some BS demain binary I cannot open debain binarys!! | 08:02 |
| === CryoTox [n=Prophet@165.154.14.211] has joined #ubuntu | ||
| I_am_the_cure | debain* | 08:02 |
| espresso | granted, your compy might not be freezing up as much with that much proc speed, it will still slow down some | 08:02 |
| === Thomb [n=Thomb@c-956170d5.012-147-6b736810.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| === ac [n=ac@vil69-2-82-224-82-2.fbx.proxad.net] has joined #ubuntu | ||
| hatake_kakashi | ernz: I'm not on any of the projects :) I'm just a normal user on here | 08:03 |
| === cmvo [n=cmvo@62.225.11.174] has joined #ubuntu | ||
| I_am_the_cure | I need wine for breezy badger NOT debain! | 08:03 |
| === gabrieltomate [n=gabriel@201009066216.user.veloxzone.com.br] has joined #ubuntu | ||
| espresso | Darky: what more could you want? | 08:03 |
| CryoTox | Can anyone tell me the terminal command to create a new user? | 08:03 |
| Frogzoo | espresso: put it this way - with pacifica, you'll be able to run ubuntu in a vm & it will run as fast as ubuntu does on a real cpu | 08:03 |
| === ac [n=ac@vil69-2-82-224-82-2.fbx.proxad.net] has left #ubuntu ["Quitte"] | ||
| espresso | Frogzoo: googling pacifica... never heard of it | 08:03 |
| hatake_kakashi | CryoTox: sudo adduser | 08:03 |
| CryoTox | thanks | 08:03 |
| === h0nus [n=h0nus@c-71-193-230-158.hsd1.or.comcast.net] has joined #ubuntu | ||
| Darky | DC++? | 08:03 |
| === AnObfuscator [n=onering@ip70-171-31-10.ga.at.cox.net] has joined #ubuntu | ||
| I_am_the_cure | cryox will that add a root access for a gui username also? | 08:04 |
| === bj01_ [n=bj01@217.97.185.5] has joined #ubuntu | ||
| LeeJunFan | anyone know why the mirrors lack the plaintext Packages files? | 08:04 |
| === pitti [n=pitti@ubuntu/member/pitti] has joined #ubuntu | ||
| === nicklas [n=nicklas@c-289fe255.72-5-64736c10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| I_am_the_cure | or at least a super user permissions for my current login? | 08:04 |
| espresso | Frogzoo: Google has let me down :(... what is pacifica?> | 08:04 |
| === ethan_ is now known as Eleaf | ||
| === din is now known as din_lunch | ||
| === Sexy_Girl19 [n=fuertes@232.Red-83-32-135.dynamicIP.rima-tde.net] has joined #ubuntu | ||
| CNAP | can anyone point me in the direction of a howto about sharing an internet connection | 08:04 |
| === Silencer [n=Silencer@82.208.215.13] has joined #ubuntu | ||
| healot | LeeJunFan, if you use Firefox with GZ plugin, you will see the list uncompressed on the fly | 08:05 |
| === BlackZun [n=BlackZun@c-289fe255.72-5-64736c10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| trappist | CNAP: I can do one better - I can point you to a script | 08:05 |
| espresso | CNAP: I know this is a lame response but... buy a router | 08:05 |
| I_am_the_cure | hatake will aduse in sudo allow me 2 login as superuser in gui?? I need some kinda login decides plain user.. | 08:05 |
| LeeJunFan | healot: yeah, but problem is that debmirror needs the unzipped version of the file. | 08:05 |
| h0nus | is there a difference between libss2 and ssh2? | 08:05 |
| === flonesaw_ [n=flonesaw@longship.net] has joined #ubuntu | ||
| trappist | CNAP: http://linuxkungfu.org/files/scripts/ics | 08:05 |
| nickrud | I_am_the_cure, why in the world would you want a root gui login? | 08:05 |
| === katotah [n=tiago@201-27-218-45.dsl.telesp.net.br] has left #ubuntu [] | ||
| healot | are you trying to setup your own? | 08:05 |
| I_am_the_cure | because I cannot install in gui | 08:06 |
| espresso | trappist: couldn't that be done via iptables using a FORWARD chain? | 08:06 |
| trappist | espresso: not using the FORWARD chain, no. | 08:06 |
| Sexy_Girl19 | hello | 08:06 |
| I_am_the_cure | there is no gui version of sudo or su | 08:06 |
| flonesaw_ | Hi all | 08:06 |
| caglar_ | can I change the version number of a already installed debian package? | 08:06 |
| Sexy_Girl19 | i hava a problem | 08:06 |
| nickrud | I_am_the_cure, gksudo | 08:06 |
| gnomefreak | I_am_the_cure: gksudo | 08:06 |
| trappist | espresso: it has to be ALLOWED in the FORWARD chain, but it's not made to happen there. | 08:06 |
| === odat [n=house@ip126.180.235.64.suscom.net] has joined #ubuntu | ||
| hatake_kakashi | I_am_the_cure: you can run it under terminal or run the program as | 08:06 |
| Sexy_Girl19 | please help me | 08:06 |
| espresso | eh, worth a thought | 08:06 |
| CNAP | i did buy a router, however i won't receive it for a couple of days. i need a band-aid for the time being | 08:06 |
| Sexy_Girl19 | heaven__mariposalibre@hotmail.com | 08:06 |
| === isilzha is now known as Isil`Zha | ||
| === Isil`Zha is now known as _isilzha_ | ||
| gnomefreak | I_am_the_cure: when you open synaptic it prompts you for password you the user password that prompt is gksudo | 08:07 |
| === theskunk [n=theskunk@ip-152010112026.student.appstate.edu] has joined #ubuntu | ||
| trappist | CNAP: see my script | 08:07 |
| healot | trappist, you can simplify iptables by using GUI tools like shorewall or firestart | 08:07 |
| healot | er | 08:07 |
| I_am_the_cure | that doesnt give me access 2 click on a file & run & install it under root command | 08:07 |
| Sexy_Girl19 | i have a problem with ubuntu help please heaven__mariposalibre@hotmail.com | 08:07 |
| === _isilzha_ is now known as Isil`Zha | ||
| trappist | healot: yeah... | 08:07 |
| s_g | Frogzoo: Alright, thanks a ton! You've officially talked me out of the D 920. | 08:07 |
| === pramz [n=pramod@c-67-168-84-207.hsd1.wa.comcast.net] has joined #ubuntu | ||
| gnomefreak | !helpme | 08:07 |
| ubotu | If you do not actually ask a question, we can not actually help you. | 08:07 |
| trappist | healot: or you can just run my script, if all you need is ad-hoc connection sharing ;) | 08:07 |
| gnomefreak | I_am_the_cure: gksudo natilus | 08:07 |
| I_am_the_cure | I want too be able 2 open a file in gui under root login or su login so I dont have 2 use gksudo | 08:07 |
| healot | don't make life hard... | 08:07 |
| nickrud | gnomefreak, ew. | 08:07 |
| healot | yeah a good script is welcome too :) | 08:08 |
| gnomefreak | nickrud: i agree | 08:08 |
| trappist | healot: see the link I gave CNAP | 08:08 |
| espresso | has anyone here used amavisd-new before? | 08:08 |
| CNAP | trappist: thanks for the script...now i just need to figure out how to run it ;-) | 08:08 |
| gnomefreak | I_am_the_cure: why would you want to opena file as root? | 08:08 |
| trappist | CNAP: wget it or copy it into a text file, chmod +x the text file, and run it with sudo | 08:08 |
| === wold [n=wold@ev-217-129-81-225.netvisao.pt] has joined #ubuntu | ||
| healot | but the problem with script...it may have been built for that scripter's box | 08:09 |
| healot | it may not work outside the box | 08:09 |
| espresso | I'm trying to set up an email server, and this ubuntu forum said I had to install it... before I blindly install some widget that I discovered on a forum, I thought I'd see if a live warm body had any experience | 08:09 |
| === haich [n=haich@98.Red-80-39-128.dynamicIP.rima-tde.net] has joined #ubuntu | ||
| trappist | healot: no, I made it very portable | 08:09 |
| === spine [n=spine@c-66-176-98-9.hsd1.fl.comcast.net] has joined #ubuntu | ||
| trappist | healot: it detects your default gateway device and goes from there | 08:09 |
| flonesaw_ | Does Ubuntu have issues with 2 sound cards? | 08:09 |
| healot | great job | 08:09 |
| healot | because I am a person who involved in deployment | 08:10 |
| I_am_the_cure | Duh too install it | 08:10 |
| nickrud | espresso, there's a pretty good postfix setup on the wiki | 08:10 |
| === gnu2it2 [n=kgrimm@cpe-069-134-161-191.nc.res.rr.com] has joined #ubuntu | ||
| === bigbootay [n=bigboota@209.250.156.214] has joined #ubuntu | ||
| caglar_ | anyone managed running opera with mplayer? | 08:10 |
| healot | kinda frustrating if your script cannot be deployed easily | 08:10 |
| === seth is now known as seth|away | ||
| espresso | it's not this, is it: http://www.ubuntuforums.org/showthread.php?t=40047 | 08:10 |
| caglar_ | is there anyone who can run opera with the mplayer plugin? | 08:10 |
| espresso | ? | 08:10 |
| === mikul [n=mikul@81-233-78-174-no73.tbcn.telia.com] has joined #ubuntu | ||
| Frogzoo | s_g: cool & gl | 08:11 |
| I_am_the_cure | In gui you have plain user access you cannot install cedega without root access it goes in /usr/bin acccess denied & also errors occur.. | 08:11 |
| === StarQuake [n=StarQuak@ip51cfbfaa.direct-adsl.nl] has joined #ubuntu | ||
| trappist | healot: it could - I could give you a one-liner to download it and run it, but I feel queasy about telling people to wget and pipe to sudo | 08:11 |
| === tonyyarussosleep [n=anthony@HSE-Toronto-ppp295631.sympatico.ca] has joined #ubuntu | ||
| I_am_the_cure | ok I did gksudo natilus & nothing happened | 08:11 |
| nickrud | I_am_the_cure, the double click method of install is windows centric, use a terminal & the recommended install techniques. Even cedga has a howto | 08:11 |
| === tonyyarussosleep is now known as tonyyarusso | ||
| === cdubya [n=chris@adsl-69-152-32-194.dsl.ksc2mo.swbell.net] has joined #ubuntu | ||
| Biscuitian_Warhe | What are the differences between the ATI.com driver and the repo driver? | 08:11 |
| === kley [n=luigi@host16-211.pool870.interbusiness.it] has joined #ubuntu | ||
| === joumana [n=joumana@ASt-Lambert-109-1-8-8.w193-252.abo.wanadoo.fr] has joined #ubuntu | ||
| === pippins [n=chris@CPE00904baa3ad5-CM00140492cd3e.cpe.net.cable.rogers.com] has joined #ubuntu | ||
| === pippins [n=chris@CPE00904baa3ad5-CM00140492cd3e.cpe.net.cable.rogers.com] has left #ubuntu ["Leaving"] | ||
| I_am_the_cure | terminal f's everything up. I cant use apt-get itwont let me just run file itself | 08:12 |
| healot | it's the latest version... | 08:12 |
| trappist | Biscuitian_Warhe: the ati.com driver will give you 3d acceleration and other benefits | 08:12 |
| I_am_the_cure | I have 2 use install & it f's up | 08:12 |
| healot | ATI's requires recompilation of the driver etc... | 08:12 |
| Zoroaster | I will setup a samba server for use as a file server at a remote office for about 10 usersI that I go,t my question is, does it really need to be a command line server? how much does GNOME really bring down the server | 08:12 |
| tonyyarusso | Biscuitian_Warhe: There is a packaged version from Seveas. | 08:12 |
| I_am_the_cure | ubuntu is user friendly so it claims, so far not friendly at all | 08:12 |
| === ethan_ [n=ethan@71-208-126-224.hlrn.qwest.net] has joined #ubuntu | ||
| === Init5 [n=DHA@3E6B6BD2.rev.stofanet.dk] has joined #ubuntu | ||
| AnObfuscator | Ubuntu is user friendly *for a linux distro* | 08:13 |
| AnObfuscator | ;) | 08:13 |
| trappist | I_am_the_cure: do you have a question? | 08:13 |
| === G0SUB [n=ghoseb@ubuntu/member/g0sub] has joined #ubuntu | ||
| Biscuitian_Warhe | tonyyarusso: From seveas, how well does it work, I did the wiki and I ca't get the gui to load | 08:13 |
| ragu | how to find what network ports are open in linux? | 08:13 |
| void^ | I_am_the_cure: trying to play with cedega? | 08:13 |
| Frogzoo | ragu: lsof -t | 08:13 |
| === ethan_ is now known as Eleaf | ||
| Biscuitian_Warhe | I_am_the_cure: What do you have against ubuntu so much? | 08:13 |
| ragu | thanks | 08:13 |
| flonesaw_ | ASUS A7V mobo w/ ob via8237 audio is being masked by MAudio Delta 44. Want both audio cards, but only Delta 44 is seen by lspci. | 08:13 |
| nickrud | I_am_the_cure, I've never installed cedega, but I cannot believe it's that hard. https://wiki.ubuntu.com/Cedega | 08:13 |
| tonyyarusso | Biscuitian_Warhe: I tried them once, and they were fine except for a known bug in fglrx relating to console switching. | 08:13 |
| h0nus | has anyone downloaded/installed libssh 0.11? | 08:13 |
| healot | I_am_the_cure, it may not suit all | 08:13 |
| trappist | nickrud: it is a little hard to install cedega these days | 08:13 |
| healot | even for newbies | 08:13 |
| h0nus | i'm lost after "./configure" | 08:14 |
| === insta` [n=bboettch@rrcs-67-53-25-242.west.biz.rr.com] has joined #ubuntu | ||
| === elsvent [n=elsvent@59-105-107-19.adsl.dynamic.seed.net.tw] has joined #ubuntu | ||
| healot | because some people expect magic out of using Ubuntu | 08:14 |
| === cassidy [n=cassidy@d83-182-4-234.cust.tele2.be] has joined #ubuntu | ||
| nickrud | trappist, oh. Well, fix it :) | 08:14 |
| nickrud | lol | 08:14 |
| Biscuitian_Warhe | tonyyarusso: What card did you have? | 08:14 |
| === RomanK [n=roman@p54A27455.dip.t-dialin.net] has joined #ubuntu | ||
| === wistow [n=wistow@bbx189.neoplus.adsl.tpnet.pl] has joined #ubuntu | ||
| === carlos [n=carlos@56.Red-88-4-2.staticIP.rima-tde.net] has joined #ubuntu | ||
| tonyyarusso | Biscuitian_Warhe: X300 | 08:14 |
| === cdubya [n=chris@adsl-69-152-32-194.dsl.ksc2mo.swbell.net] has left #ubuntu [] | ||
| Init5 | hi folks, I am runing breezy with the default firefox 1.0.7 witch I'd like to upgrade to firefox-1.6, -how do I do that? It's not in the repositories... | 08:14 |
| === lene_ [n=lene@port242.ds1-had.adsl.cybercity.dk] has joined #ubuntu | ||
| Biscuitian_Warhe | nickrud: cedega is all fancy these days *wobbles fingers like a soothsayer | 08:14 |
| I_am_the_cure | I got the file its n su file | 08:14 |
| trappist | nickrud: it's not broken - it's the result of deliberate design decisions | 08:14 |
| Biscuitian_Warhe | tonyyarusso: Nice, that's what card I have, how did the driver do for acceleration | 08:14 |
| insta` | On a new Ubuntu machine, I'm having problems with alsasink working. osssink works, but it is the only pipeline that does. alsamixer recognizes my soundcard, and can change properties. See http://pastebin.com/631182 | 08:14 |
| wistow | hi folks ubuntu is very nice i use it, good job | 08:15 |
| tonyyarusso | Init5: I assume you mean 1.5, not 1.6; see the msg from ubotu for a link to instructions. | 08:15 |
| I_am_the_cure | I CNNOT run debain binarys I REPEAT I cannot run Debain BINARYS! | 08:15 |
| elsvent | hello could someone help me for this? | 08:15 |
| === njan [n=james@unaffiliated/james] has joined #ubuntu | ||
| === ssam [n=ssam@80-41-93-124.dynamic.dsl.as9105.com] has joined #ubuntu | ||
| elsvent | elsvent@HYC:~/Desktop$ fakeroot X_VERSION=x690 ./ati-driver-installer-8.23.7-i386.run | 08:15 |
| elsvent | /usr/bin/fakeroot: line 150: X_VERSION=x690: command not found | 08:15 |
| nickrud | trappist, ah, thanks. | 08:15 |
| caglar_ | is there anyone who can run opera with the mplayer plugin? | 08:15 |
| tonyyarusso | Biscuitian_Warhe: Framerates were something like 6,000 /s I think. | 08:15 |
| insta` | elsvent: just do it as root | 08:15 |
| === alapzaj [n=tomek@dsl51B6B91F.pool.t-online.hu] has joined #ubuntu | ||
| healot | elsvent, Variable first | 08:15 |
| espresso | nickrud: thanks for the tips... I'm setting up postfix now :) | 08:15 |
| healot | before commands | 08:15 |
| Biscuitian_Warhe | I_am_the_cure: You dont just "double click" them, you cd to there directory with a terminal and use sudo apt-get install foobar.deb | 08:15 |
| Init5 | tonyyarusso, what msg? | 08:15 |
| Biscuitian_Warhe | tonyyarusso: Is that good or bad? | 08:15 |
| I_am_the_cure | omfg u dont listen a sh file does NOT open in gnome | 08:15 |
| elsvent | ok thanks | 08:16 |
| tonyyarusso | Biscuitian_Warhe: Was still slow for certain screensavers though. (It's good.) | 08:16 |
| I_am_the_cure | I tried just file.sh command not found | 08:16 |
| healot | "X_VERSION=x690 fakeroot ./ati-driver-installer-8.23.7-i386.run" | 08:16 |
| tonyyarusso | Init5: Haha, whoops. One second. | 08:16 |
| Biscuitian_Warhe | tonyyarusso: Could you play games with it? | 08:16 |
| === suresh00_ [n=tsureshk@125.22.9.47] has joined #ubuntu | ||
| === sylvain [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has joined #ubuntu | ||
| Init5 | tonyyarusso, tnx man ;] | 08:16 |
| I_am_the_cure | the deb file contains a debain binary | 08:16 |
| === spine [n=spine@c-66-176-98-9.hsd1.fl.comcast.net] has joined #ubuntu | ||
| I_am_the_cure | I cant run DEBAIN BINARY! | 08:16 |
| Biscuitian_Warhe | I_am_the_cure: You use sh file.sh, not just file.sh, and if you try double clikc open in GNOME they have to be executable (file permissons) | 08:17 |
| tonyyarusso | Biscuitian_Warhe: Well, I'm not a heavy gamer really, but it seemed fine. | 08:17 |
| === jerry__ [n=jerry@207-225-34-144.bois.qwest.net] has joined #ubuntu | ||
| === rafaman [n=rafaman@adsl-157-35-152.mco.bellsouth.net] has joined #ubuntu | ||
| elsvent | healot, thanks | 08:17 |
| Biscuitian_Warhe | tonyyarusso: Alrite, it sounds good to me, I was never good with drivers | 08:17 |
| Biscuitian_Warhe | Haha | 08:17 |
| jerry__ | Hello? | 08:17 |
| trappist | I_am_the_cure: do you have a question | 08:17 |
| rafaman | hey | 08:17 |
| === tonyyarusso makes note to self: nickserv doesn't have factoids :P | ||
| rafaman | this is a lot of users | 08:17 |
| jerry__ | I can't get my updates. I think the repo's have changed. | 08:17 |
| === Cturtle [n=Cturtle@a213-84-50-38.adsl.xs4all.nl] has joined #ubuntu | ||
| rafaman | right now i'm running the live cd on another computer | 08:18 |
| I_am_the_cure | I been asking question u give me BS I already done & keep teling you I cannto DO! | 08:18 |
| I_am_the_cure | I have cedega.sh | 08:18 |
| I_am_the_cure | I try running in terminal command not found | 08:18 |
| jerry__ | I have dapper drake. | 08:18 |
| void^ | I_am_the_cure: did you use ./ ? | 08:18 |
| frank23 | rafaman: yeah considering there were around 1000 people here during the breezy release, there should be many more when dapper is released | 08:18 |
| I_am_the_cure | I tried using install it does not install properly & will not run | 08:18 |
| I_am_the_cure | I tried in kde same problems | 08:18 |
| Biscuitian_Warhe | Hey, since I have a P4 with Hyper Threading, should I install the linux-686 smp kernel instead of the 386 one? | 08:19 |
| insta` | Biscuitian_Warhe: yep | 08:19 |
| I_am_the_cure | kde supports sh files but still causes errors & will not play the game I install | 08:19 |
| I_am_the_cure | yes | 08:19 |
| Biscuitian_Warhe | isnta`: What would the difference be? | 08:19 |
| I_am_the_cure | I been told this before | 08:19 |
| === KmanCat [n=KmanCat@69-171-194-176.sbtnvt.adelphia.net] has joined #ubuntu | ||
| === zipper [n=zipper@port19.ds1-hj.adsl.cybercity.dk] has joined #ubuntu | ||
| I_am_the_cure | & I keep telling u it says Command not found | 08:19 |
| void^ | oh well.. | 08:19 |
| insta` | Biscuitian_Warhe: the 686 kernel takes advantage of higher-level features in the processor | 08:19 |
| flonesaw_ | Biscuitian -- SMP will not give huge performance boost in all cases w/ hyperthreading. | 08:19 |
| insta` | Like the abilitity to page memory quicker using MMX and 3dNow! calls | 08:19 |
| insta` | Which a 386 processor doesn't have. | 08:19 |
| Biscuitian_Warhe | instal`: oh, ok | 08:20 |
| frank23 | Biscuitian_Warhe: yeah. although by default HT is disabled because it's a security risk. You have to activate it somehow | 08:20 |
| === Spudchat [n=Spud@adsl-68-74-146-215.dsl.emhril.ameritech.net] has joined #ubuntu | ||
| Seveas | !tell I_am_the_cure about attitude | 08:20 |
| Biscuitian_Warhe | frank23: How would I activate it? | 08:20 |
| Frogzoo | ragu: lsof -U | 08:20 |
| rafaman | buh-bye | 08:20 |
| === rafaman [n=rafaman@adsl-157-35-152.mco.bellsouth.net] has left #ubuntu [] | ||
| Biscuitian_Warhe | I mean, I know GIMP on Winblows hates HT, but yeah | 08:20 |
| frank23 | Biscuitian_Warhe: not sure... I don't think it's too hard though | 08:20 |
| I_am_the_cure | Tell sevas about ppl giving wrong awnsers over & over peeving ppl off | 08:20 |
| lkd-efs | !tell lkd-efs about attitude | 08:20 |
| flonesaw_ | Biscuitian - Activate via BIOS setting. | 08:20 |
| === david_ [n=david@201.245.213.123] has joined #ubuntu | ||
| Biscuitian_Warhe | flonesaw_: Oh, it's activated in BIOS | 08:20 |
| I_am_the_cure | I told you everything & u keep suggesting same carp | 08:21 |
| void^ | I_am_the_cure: my advice: if you're new to linux, don't mess with cedega, keep your windows games to native windows. | 08:21 |
| Frogzoo | I_am_the_cure: so don't pay the bill | 08:21 |
| === mode/#ubuntu [+b *!*n=master@*.hsd1.fl.comcast.net] by Seveas | ||
| === I_am_the_cure was kicked off #ubuntu by Seveas (bye bye then) | ||
| === ardchoille [n=user@unaffiliated/ardchoille] has joined #ubuntu | ||
| Biscuitian_Warhe | I mean is there some Linux setting that says "Oh, to bad, can't use it unless you change this setting"? | 08:21 |
| === ivan_ [n=ivan@81.196.214.254] has joined #ubuntu | ||
| insta` | Biscuitian_Warhe: easiest way to tell, is to load the new kernel, and run top. While runnign top, press '1'. It should switch to two CPUs at the top of the screen. | 08:21 |
| flonesaw_ | Biscuitian - depends on MoBo, but usually. | 08:21 |
| ivan_ | sal | 08:21 |
| === Ogg`u [n=kamil@80.51.6.6] has joined #ubuntu | ||
| insta` | If the BIOS reports two processors, it will use two processors. The only way to disable it is with disableht as a kernel parameter | 08:21 |
| === UdontKnow [i=udontkno@freenode/staff/udontknow] has joined #ubuntu | ||
| Biscuitian_Warhe | insta`: Like when you look at hardware profile it says that there is 2 cpus when there is really 1? | 08:22 |
| espresso | !postfix | 08:22 |
| ubotu | parse error: Try searching at http://ubuntu.cc.com.au/, espresso | 08:22 |
| ivan_ | hello | 08:22 |
| insta` | Biscuitian_Warhe: there are two processors. | 08:22 |
| === toresba [n=toresbe@dionysus.freecode.no] has joined #ubuntu | ||
| insta` | Hyperthreading is effectively two processors sharing the same L2 cache | 08:22 |
| === toresba [n=toresbe@dionysus.freecode.no] has left #ubuntu ["Leaving"] | ||
| insta` | Just two processors on the same die. | 08:22 |
| Biscuitian_Warhe | isnta`: Oh, so I have two, but they are like 1? | 08:22 |
| === Vspirit [n=casper@nat.kollegienet.dk] has joined #ubuntu | ||
| insta` | Well, you have one physical chip | 08:23 |
| Biscuitian_Warhe | Uh huh | 08:23 |
| insta` | But the way the voodoo inside works, it appears as two, to just about any process that asks | 08:23 |
| frank23 | insta`: Biscuitian_Warhe, but by default HT is disabled even with a SMP kernel. security risk | 08:23 |
| Vspirit | what is best practice for installing common plugins to firefox such as flash and java runtime environment on ubuntu 5.10 ? | 08:23 |
| Biscuitian_Warhe | Oh, ok | 08:23 |
| === ivan_ [n=ivan@81.196.214.254] has joined #ubuntu | ||
| === lillpelle [i=mickep@c-221ce055.311-17-64736c12.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| Ogg`u | insta you game QuakeWorld ? | 08:24 |
| elsvent | uhm....the ATI driver i downloaded from ATI official web i execute it by fakeroot and try to make a package | 08:24 |
| === lucaas [n=lucas@h56n16c1o1124.bredband.skanova.com] has joined #ubuntu | ||
| insta` | Ogg`u: nope, he musta stolen my name ;) | 08:24 |
| elsvent | but it didn't generate any package? | 08:24 |
| Biscuitian_Warhe | Alrite, well I'm gonna 1) Get this linux-686 smp kernel and see how it works 2) smack this ATI driver 3) eat some chex mix | 08:24 |
| flonesaw_ | [Q] Why would one sound card mask the onboard sound card so that "lspci" cannot see it? | 08:24 |
| insta` | frank23: That must be a new thing, because I have a Breezy 2.6.12-10 kernel installed which used HT right out of the box | 08:24 |
| erikl | I have problem with .mkv h.264 when I go forward or backward alla players crash | 08:24 |
| Biscuitian_Warhe | elsvent: did it have any errors? | 08:24 |
| frank23 | Biscuitian_Warhe: intel screwed up somewhere and it's possible for a process on one logical cpu to read data from a process on the other logical cpu | 08:24 |
| elsvent | what's the wrong or step i missed? | 08:24 |
| === Janos [n=cramos@nat1.inalambrica.net] has joined #ubuntu | ||
| elsvent | Biscuitian_Warhe, no i didn't see any errors | 08:24 |
| Ogg`u | www.forum.quakeworld.pl | 08:24 |
| Ogg`u | ? | 08:24 |
| BlackZun | Any1 know where I can find a program that is able to read .deb files? | 08:25 |
| insta` | BlackZun: #debian | 08:25 |
| Biscuitian_Warhe | elsevent: try this link | 08:25 |
| elsvent | Biscuitian_Warhe, or i should build a Debian package? | 08:25 |
| Seveas | insta`, ? | 08:25 |
| frank23 | insta`: I pretty sure one of the kernel security updates was to disable HT by default. I don't remember when that was though | 08:25 |
| Seveas | Ubuntu uses .deb files too... | 08:25 |
| insta` | Seveas: so? | 08:25 |
| Zoroaster | I will setup a samba server for use as a file server at a remote office for about 10 usersI that I go,t my question is, does it really need to be a command line server? how much does GNOME really bring down the server | 08:26 |
| Biscuitian_Warhe | Seveas: are you like the guy that has like the repo with the Ati built driver thingeys? | 08:26 |
| === lkd-efs [n=lkd-efs@cpc3-blfs6-0-0-cust45.belf.cable.ntl.com] has joined #ubuntu | ||
| === Nafai [n=nafai@rrcs-24-73-247-70.sw.biz.rr.com] has joined #ubuntu | ||
| Biscuitian_Warhe | elsvent: https://wiki.ubuntu.com/BinaryDriverHowto/ATI | 08:26 |
| insta` | Zoroaster: why does it need to be graphical? | 08:26 |
| === dosser [n=virus@nc-71-54-45-50.dhcp.sprint-hsd.net] has joined #ubuntu | ||
| elsvent | Biscuitian_Warhe, i am following this page yet | 08:26 |
| Init5 | tonyyarusso, that manual upgrade of firefox seems a bit complicated. Can I expect the latest firefox with Dapper relase? | 08:26 |
| Frogzoo | Zoroaster: you don't want users complaining when the screensaver kicks in though | 08:26 |
| Zoroaster | insta`, no, it doesn't, I'm just wondering if it really kills the server to be graphical | 08:26 |
| === moonlite1 [n=moonlite@starbase.olf.sgsnet.se] has joined #ubuntu | ||
| Biscuitian_Warhe | elsevent: Try Seveas repo driver then, I'm not sure why it isn't building for you | 08:27 |
| === jlenor1_ [n=jlenor1@lab2-22.CS.McGill.CA] has joined #ubuntu | ||
| frank23 | Init5: yes all programs will be current when dapper releases | 08:27 |
| jlenor1_ | how do I restart x from a konsole? | 08:27 |
| Zoroaster | Frogzoo, true, but I could disable | 08:27 |
| insta` | Zoroaster: it'll free up a few resources for other processes. | 08:27 |
| jlenor1_ | or logout from a konsole | 08:27 |
| Frogzoo | Zoroaster: probaly not as long as you're sensible, you should be fine | 08:27 |
| Seveas | Biscuitian_Warhe, yes, only for breezy though ant not the .23 version yet | 08:27 |
| Zoroaster | insta`, ok | 08:27 |
| Biscuitian_Warhe | jlenore1_: Ctrl Alt Backspace should kill it | 08:27 |
| Init5 | frank23, ok, how come Breezy comes with an old one? :) | 08:27 |
| === zMikhailz [i=Mikhail@ppp85-140-47-152.pppoe.mtu-net.ru] has joined #ubuntu | ||
| Zoroaster | Frogzoo, ok | 08:27 |
| jlenor1_ | Biscuitian_Warhe, I need a command | 08:27 |
| zipper | i've just installed apache2 using the guide... But i'm missing one thing, letting the individual user have a public_html dir, which you can access through www.bla.com/~user . I've found out i need the mod called userDir, but i failed to find a place that describes how to enable that. Hints anyone? | 08:27 |
| elsvent | Biscuitian_Warhe, ok but where is the Seveas repo driver? | 08:28 |
| === zMikhailz [i=Mikhail@ppp85-140-47-152.pppoe.mtu-net.ru] has left #ubuntu [] | ||
| insta` | Zoroaster: no reason to really have graphical on there ... anythign you can do in there you can do in command-line. And it makes more sense for a server environment anyway to free up the resources ... | 08:28 |
| frank23 | Init5: programs are not updated (except for security) within a release. so breezy is fixed until dapper comes out | 08:28 |
| Biscuitian_Warhe | Seveas: How well do they work, in your opinion I mean I made my own with the ATI installer but it won't let me start the gui (no errors or 'nething) | 08:28 |
| flonesaw_ | zipper -- it might be in html.conf | 08:28 |
| odat | anyone able to help me install ffmpeg2theora | 08:28 |
| Seveas | Biscuitian_Warhe, you need some xorg tweaking as explained on the wiki | 08:28 |
| Biscuitian_Warhe | elsvent: add the repo line, and then look for the fgrlx one with your kernel | 08:28 |
| theD3viL | when i wanna stream with mozilla-plugin (mplayer-plguin) mplayer opens twice! Why? | 08:29 |
| Biscuitian_Warhe | Seveas: I ran the sudo dpkg-reconfigure xserver-xorg | 08:29 |
| flonesaw_ | zipper -- which version of Apache? | 08:29 |
| elsvent | Biscuitian_Warhe, oh u mean first method? | 08:29 |
| Zoroaster | insta`, I know that command line is the appropriate thing to do an all, it's just that I guess I'm still a little scared to not have the GUI to fall back on, since I am still in my Ubuntu toddler years | 08:29 |
| zipper | flonesaw_, apache2... httpd.conf seems to have become obsolete | 08:29 |
| Biscuitian_Warhe | elsvent: No, not the repo default driver, add Seveas's repo to apt (synaptic) and reload the info | 08:29 |
| Zoroaster | insta`, just wanted some opinions | 08:29 |
| === Kezzer [n=Kezzer@88-105-244-13.dynamic.dsl.as9105.com] has joined #ubuntu | ||
| insta` | Zoroaster: do a server install. When you get to the shell after rebooting and logging in, apt-get install xubuntu-desktop | 08:30 |
| pulgoki | has anyone been able to get firestarter to play well with samba? | 08:30 |
| insta` | Configure your server from within the safety of a small X environment | 08:30 |
| Vspirit | uhmm.. I've found ubuntuguide.org, and I issue a 'sudo apt-get install sun-j2rel-5' but it simply complains with 'E: Couldn't find package sun-j2rel.5' what are my options ? | 08:30 |
| elsvent | Biscuitian_Warhe, oh i see | 08:30 |
| Zoroaster | insta`, ok, thanks | 08:30 |
| flonesaw_ | zipper -- Well, in Apache 1.x, you set up those options in httpd.conf | 08:30 |
| Zoroaster | insta`, ok, sounds like a plan | 08:30 |
| === mwe [n=mwe@port462.ds1-ynoe.adsl.cybercity.dk] has joined #ubuntu | ||
| insta` | Once that's done, switch to a virtual terminal (Ctrl+Alt+F4), log in there, sudo to bash, and /etc/init.d/gdm stop | 08:30 |
| insta` | Kill X | 08:30 |
| insta` | Then remove xubuntu-desktop | 08:30 |
| flonesaw_ | zipper - Apache2 will have similar capabilities. | 08:30 |
| frank23 | Vspirit: don't use ubuntuguide. It's old and unsafe | 08:30 |
| insta` | And leave it as a console server | 08:30 |
| elsvent | Biscuitian_Warhe, but what's Seveas's addres for add to source.list? | 08:30 |
| frank23 | !tell Vspirit about java | 08:30 |
| === renato_ [n=renato@200.249.192.132] has joined #ubuntu | ||
| zipper | flonesaw_, i really dont think so. httpd.conf seem 100% obsolete, it even says so itself | 08:31 |
| flonesaw_ | zipper4 - Time to peruse the Apache docs on the apache site. | 08:31 |
| === Silencer [n=Silencer@82.208.215.13] has joined #ubuntu | ||
| odat | anyone able to help me install ffmpeg2theora | 08:31 |
| mwe | I have a pentium m processor. does anyone know how to determine what core is has, if it's dothan or what? /proc/cpuinfo doesn't seem to tell. | 08:31 |
| Biscuitian_Warhe | elsvent: deb http://mirror.ubuntulinux.nl/ breezy-seveas drivers | 08:31 |
| elsvent | eeeks | 08:31 |
| elsvent | Biscuitian_Warhe, i am using dapper | 08:31 |
| flonesaw_ | zipper - sorry, i'm not apache2 user. | 08:32 |
| Biscuitian_Warhe | elsvent: Oh, that changes everything then | 08:32 |
| Seveas | elsvent, dapper has the very latest fglrx drivers already | 08:32 |
| flonesaw_ | [Q] I have problems enabling two sound cards. | 08:32 |
| === uc50ic4more [n=robert@d38-196-48.home1.cgocable.net] has joined #ubuntu | ||
| === thoffmeyer [n=tim@unaffiliated/hoffy] has joined #ubuntu | ||
| zipper | flonesaw_, fair enough, but as i said before, i tried reading the docs on apache's site earlier, only found a lot of info about the actual mods, not how to enable them | 08:32 |
| Biscuitian_Warhe | elsvent: Did you do the fakeroot X_VERSION=x690 ./blah blah blah before you ran the installer | 08:32 |
| === mfuentes [n=mario@200.54.6.204] has joined #ubuntu | ||
| flonesaw_ | zipper -- check out configuration info. | 08:32 |
| elsvent | Biscuitian_Warhe, yes | 08:32 |
| Biscuitian_Warhe | elsvent: Oh, then I dunno there... | 08:33 |
| === lwelyn [n=lwelyn@p549A57CE.dip.t-dialin.net] has joined #ubuntu | ||
| zipper | flonesaw_, i am, but i didnt compile apache, i used dpkg | 08:33 |
| elsvent | Biscuitian_Warhe, ok i will try find out why | 08:33 |
| === LathropWells [n=bill@cpe-72-134-66-177.socal.res.rr.com] has joined #ubuntu | ||
| elsvent | Biscuitian_Warhe, thanks for help | 08:33 |
| === pis [n=pis@116.Red-81-36-151.dynamicIP.rima-tde.net] has joined #ubuntu | ||
| === JDahl [n=joachim@3E6B7449.rev.stofanet.dk] has joined #ubuntu | ||
| === Versed` [n=Versed@c-69-253-173-154.hsd1.nj.comcast.net] has joined #ubuntu | ||
| Biscuitian_Warhe | Seveas: What kind of xorg tweaking besides reconfiguring? | 08:34 |
| elsvent | Seveas, thanks for help | 08:34 |
| Biscuitian_Warhe | elsvent: De nada | 08:34 |
| === jdw [n=jdw@ip145-168-59-62.adsl.versatel.nl] has joined #ubuntu | ||
| flonesaw_ | zipper -- it's the "LoadModule" command in the config file | 08:34 |
| === patrick__ [n=patrick@dsl72bA182.sdtnet.de] has joined #ubuntu | ||
| === WildZeck [n=zeck@ax113-3-82-234-26-6.fbx.proxad.net] has joined #ubuntu | ||
| === patrick__ is now known as gizmo101 | ||
| Vspirit | frank23: thanks | 08:34 |
| === gizmo101 [n=patrick@dsl72bA182.sdtnet.de] has left #ubuntu ["Verlassend"] | ||
| === phreakpc [n=phreakpc@209.137.247.194] has joined #ubuntu | ||
| === Alex_C [n=alex@host86-128-102-21.range86-128.btcentralplus.com] has joined #ubuntu | ||
| === phil91 [n=phil@static-195-248-97-242.adsl.hotchilli.net] has joined #ubuntu | ||
| Alex_C | Hey | 08:35 |
| flonesaw_ | zipper -- You are wrong about httpd.conf being obsolete. | 08:35 |
| === ara [n=ara@c-360de353.01-94-7673741.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| Alex_C | how do I upgrade to Dapper? | 08:35 |
| Frogzoo | !upgrade | 08:35 |
| ubotu | Upgrading to Ubuntu 5.10 breezy -> http://wiki.ubuntu.com/BreezyUpgrade. Upgrading to dapper (remember it may break). Please test the dist-upgrader -> https://lists.ubuntu.com/archives/ubuntu-devel/2006-January/014700.html. | 08:35 |
| flonesaw_ | zipper -- I'm on Apache 2.2 doc pages | 08:35 |
| Frogzoo | Alex_C: be aware dapper is still currently beta | 08:35 |
| === whaq [i=whaq@203.130.197.106] has joined #ubuntu | ||
| === izmaelis [n=izmaelis@85.206.227.243] has joined #ubuntu | ||
| erikl | Is it worth to upgrade to dapper at the moment? | 08:36 |
| flonesaw_ | zipper - the "LoadModule" command in httpd.conf is what you want. | 08:36 |
| odat | anyone able to help me install ffmpeg2theora | 08:36 |
| Alex_C | Frogzoo, YEh I know - but i want to try XGL, all the guids I found say to upgrade to dapper | 08:36 |
| === uc50ic4more [n=robert@d38-196-48.home1.cgocable.net] has left #ubuntu [] | ||
| Biscuitian_Warhe | flonesaw_: If you isntall apache via apt it will have no httpd.conf, if you compile via source it should have one | 08:36 |
| Frogzoo | erikl: dapper is currently beta - so it's a personal decision | 08:36 |
| tristanmike | dapper is still "broken" so if you can handle the fact that it "might" break out of the blue, go ahead | 08:36 |
| LathropWells | nvidia-glx enables GL but not video acceleration. - how do i fix that? | 08:36 |
| Kezzer | odd, in my home folder it used to point to the home folder, now it just points to / | 08:36 |
| Kezzer | how do I change the path of it? | 08:36 |
| Alex_C | is there a way to use XGL without Dapper? | 08:36 |
| flonesaw_ | Biscuitian - That's crazy. Apache needs a conf file. | 08:37 |
| zipper | flonesaw_, ah okay, guess i misunderstood something on the way. Thanks | 08:37 |
| insta` | flonesaw_: apache2.conf is the proper config file for Apache 2.0 | 08:37 |
| insta` | httpd.conf is, indeed, obsolete. | 08:37 |
| Biscuitian_Warhe | flonesaw_: I'm not sure why though | 08:37 |
| frank23 | Alex_C: not really. for xgl you need dapper | 08:37 |
| Biscuitian_Warhe | either way thanks for your help guys, I need to fix this pansy Linux tower. Lol | 08:37 |
| === Biscuitian_Warhe mutters something about stupid slow dialup under linux | ||
| zipper | oh | 08:37 |
| flonesaw_ | insta` -- thanks much. Docs say httpd.conf, but I've never run version 2. | 08:37 |
| === Spudchat [n=Spud@adsl-68-74-146-215.dsl.emhril.ameritech.net] has left #ubuntu [] | ||
| Alex_C | frank23, i'll upgrade to dapper then - I don't use Linux for anything important - mayaswell try it | 08:38 |
| zipper | apache2.conf looks a bit more like what i was looking for in httpd.conf | 08:38 |
| insta` | Ya, it's the only way to do it on 1.3 | 08:38 |
| insta` | Guess that's where the confusion came from :) | 08:38 |
| === [gijoe] [n=[gijoe] @h214n2fls304o1039.telia.com] has joined #ubuntu | ||
| zipper | thanks guys | 08:38 |
| LeeJunFan | anyone use debpartial-mirror? if so - how'd you manage that with no doc's available for it? :) | 08:38 |
| flonesaw_ | zipper -- then what you want is "LoadModule" in that file | 08:38 |
| === ubuntu [n=ubuntu@81-231-118-10-no53.tbcn.telia.com] has joined #ubuntu | ||
| insta` | Does anyone have experience with fixing alsasink ? Mine doesn't work out of the box, and I'm pretty thwarted now. | 08:38 |
| === BlackZun [n=BlackZun@c-289fe255.72-5-64736c10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| frank23 | Alex_C: yeah. I imagine xgl will be smoothed out after dapper is released and will be ready for regular use | 08:39 |
| erikl | if I upgrade to dapper, will it be easy to upgrade all the packages? | 08:39 |
| zipper | flonesaw_, yeah i know, i'm on it | 08:39 |
| === sm [n=simon@pool-71-107-254-16.lsanca.dsl-w.verizon.net] has joined #ubuntu | ||
| flonesaw_ | I have weird problem with dual sound cards... Anybody???? | 08:39 |
| sm | hi all | 08:39 |
| === Den [n=knoppix@dhcp-40-162.EECS.Berkeley.EDU] has left #ubuntu ["Konversation] | ||
| === Silencer [n=Silencer@82.208.215.13] has joined #ubuntu | ||
| odat | anyone able to help me install ffmpeg2theora | 08:40 |
| flonesaw_ | erikl - yes, it's easy. | 08:40 |
| insta` | odat: what's wrong with it? | 08:41 |
| sm | I want to grab a number of screenshots of just part of a bunch of firefox tabs.. any recommendationsn ? | 08:41 |
| insta` | sm: GIMP? | 08:41 |
| sm | insta`: you mean save full-screen snapshot, open in gimp & crop, repeat right | 08:41 |
| === jbritz22 [n=jbritz22@207-195-69-119.sktn.hsdb.sasknet.sk.ca] has joined #ubuntu | ||
| jbritz22 | whats a linux alternative to winrar | 08:42 |
| flonesaw_ | sm - "Take Screenshot" app on Gnome panel. | 08:42 |
| erikl | I'm having problems with .mkv, when I play forward, alla players crash | 08:42 |
| odat | insta`, i just don't know how to install it | 08:42 |
| === raphink [n=raphink@ubuntu/member/raphink] has joined #ubuntu | ||
| === Selucresh [n=Selucres@CPE-65-30-180-7.wi.res.rr.com] has joined #ubuntu | ||
| sm | flonesaw_: thanks.. that seems the same as alt printscreen, snaps the whole screen | 08:43 |
| === Slant_Mobile [n=scott@66.233.97.25] has joined #ubuntu | ||
| sm | I'd like to do this a lot, and I'm looking for a quicker process | 08:43 |
| erikl | what could be wrong, old codecs? | 08:43 |
| sm | eg an x app I can start that lets me select an area on screen | 08:43 |
| === bene_ [n=bene@dialin-145-254-236-119.pools.arcor-ip.net] has joined #ubuntu | ||
| jbritz22 | whats a linux alternative to winrar | 08:43 |
| flonesaw_ | sm - yes, that's true. I think you can snap pic of one window, but it's been a while since I've done that. Can't remember how. | 08:43 |
| === monteiro [n=monteiro@84.90.112.58] has joined #ubuntu | ||
| === sYs`afk is now known as sYs^ | ||
| flonesaw_ | Who can assist with dual sound card issue? | 08:44 |
| === patrick__ [n=patrick@dsl72bA182.sdtnet.de] has joined #ubuntu | ||
| === patrick__ [n=patrick@dsl72bA182.sdtnet.de] has left #ubuntu ["Verlassend"] | ||
| === _-H22 [n=_-H22@ip-192.net-82-216-66.rev.numericable.fr] has joined #ubuntu | ||
| erikl | How do I update to dapper? | 08:45 |
| Dyna-Work | fileroller? | 08:45 |
| sm | I think gimp has it built in | 08:45 |
| === Davey|Laptop [i=foobar@unaffiliated/davey] has joined #ubuntu | ||
| === balduran [n=balduran@dyndsl-080-228-221-033.ewe-ip-backbone.de] has joined #ubuntu | ||
| === sm tries that | ||
| Dyna-Work | winrar = fileroller i would assume | 08:45 |
| === Yoric [n=ElYoric@cpc1-brig7-3-0-cust74.brig.cable.ntl.com] has joined #ubuntu | ||
| spine | yea i cant sudo apt-get update && apt-get dist-upgrade | 08:45 |
| === balduran [n=balduran@dyndsl-080-228-221-033.ewe-ip-backbone.de] has left #ubuntu ["...] | ||
| spine | it doesnt do anything | 08:46 |
| === dpm_ [n=dpm@p54A11650.dip0.t-ipconnect.de] has joined #ubuntu | ||
| === Alex_C [n=alex@host86-128-102-21.range86-128.btcentralplus.com] has joined #ubuntu | ||
| Alex_C | !upgrade | 08:46 |
| ubotu | Upgrading to Ubuntu 5.10 breezy -> http://wiki.ubuntu.com/BreezyUpgrade. Upgrading to dapper (remember it may break). Please test the dist-upgrader -> https://lists.ubuntu.com/archives/ubuntu-devel/2006-January/014700.html. | 08:46 |
| spine | cant sudo apt-get update && apt-get dist-upgrade | 08:46 |
| odat | insta`, wow thats helpful | 08:46 |
| spine | no to dapper | 08:46 |
| Zoroaster | of the Motherboard Manufacturers out there, who would you say is the most linux friendly | 08:46 |
| monteiro | how can i execute one script in ubuntu's boot ? | 08:47 |
| insta` | odat: 'scuze me? | 08:47 |
| flonesaw_ | Zoroaster -- I've had extremely good luck with ASIS | 08:47 |
| spine | monteiro: u can set in | 08:47 |
| sm | yes that seems a good approach.. I have to run gimp, but then I get full control | 08:47 |
| flonesaw_ | zoroaster -- er, ASUS | 08:47 |
| === linuxboyfriend [n=linuxboy@202.134.132.16] has joined #ubuntu | ||
| === WiFi_Warri0r [n=roy@adsl-70-136-54-247.dsl.hstntx.swbell.net] has joined #ubuntu | ||
| monteiro | spine : is there a file like rc.local in other distros ? | 08:47 |
| WiFi_Warri0r | any help with file shares and samba? | 08:47 |
| erikl | Is there a new vlc version in dapper? | 08:47 |
| spine | montero: start menu >system>preferences>sessions | 08:47 |
| sm | I had an idea there was a firefox extension to make tab thumbnails, but this is probably the way to go | 08:48 |
| spine | monteiro: kool? | 08:48 |
| WiFi_Warri0r | i got it set up to share files i bleieve, but it asks for user/pass and i didnt set up a user/pass and local accounts dont work | 08:48 |
| === bhagabhi [n=bhagabhi@h113n4c1o269.bredband.skanova.com] has joined #ubuntu | ||
| WiFi_Warri0r | any help? | 08:48 |
| WiFi_Warri0r | greatly appreciated | 08:48 |
| flonesaw_ | *** Still trying to get dual sound card problem resolved here. | 08:48 |
| === s0ciopath [n=user@net34-155.netkaster.ca] has joined #ubuntu | ||
| Dyna-Work | why have dual soundcards anyway, just curious | 08:48 |
| === gamma [n=gamma@192.237.33.65.cfl.res.rr.com] has joined #ubuntu | ||
| === nekostar [n=nekostar@unaffiliated/starscalling] has joined #ubuntu | ||
| === jlhenry [n=jlhenry@142.213.254.2] has joined #ubuntu | ||
| flonesaw_ | dyna-work -- One is Delta 44 pro card. | 08:49 |
| nekostar | 11221 | 08:49 |
| Dyna-Work | i see | 08:49 |
| spine | monteiro: i set up bash scripts from there 2 | 08:49 |
| Zoroaster | how about cpu and chipsets? which is most friendly to Linux? amd, intel, via, nvidia? | 08:49 |
| insta` | amd + nvidia | 08:49 |
| trappist | intel vs. nvidia doesn't matter much as far as linux-friendly cpus | 08:49 |
| flonesaw_ | Zoroaster -- I agree. nVidia and AMD. VIA isn't bad, either. | 08:50 |
| === timt [n=timt@M448P007.adsl.highway.telekom.at] has joined #ubuntu | ||
| trappist | but most geeks prefer amd :) | 08:50 |
| monteiro | spine : i didn't understand | 08:50 |
| sm | now, let's see if I can save directly from gimp to zope | 08:50 |
| monteiro | spine : where can i set that scripts ? | 08:50 |
| === Yoric [n=ElYoric@cpc1-brig7-3-0-cust74.brig.cable.ntl.com] has joined #ubuntu | ||
| flonesaw_ | Zoroaster -- AMD is much better for Linux.... Dual core lives. | 08:50 |
| === budluva [n=budluva@d209-89-216-221.abhsia.telus.net] has joined #ubuntu | ||
| === sYs^ is now known as sYs`afk | ||
| spine | #!/bin/sh | 08:50 |
| spine | echo "Tunning Logitech mouse..." | 08:50 |
| spine | lmctl -8 --sms | 08:50 |
| WiFi_Warri0r | can anyone here help with file sharing troubles? | 08:50 |
| WiFi_Warri0r | please pm me | 08:50 |
| trappist | flonesaw_: intel makes dual core chips too | 08:51 |
| erikl | How do I update to dapper? | 08:51 |
| erikl | from breezy | 08:51 |
| _jason | !upgrade | 08:51 |
| ubotu | Upgrading to Ubuntu 5.10 breezy -> http://wiki.ubuntu.com/BreezyUpgrade. Upgrading to dapper (remember it may break). Please test the dist-upgrader -> https://lists.ubuntu.com/archives/ubuntu-devel/2006-January/014700.html. | 08:51 |
| WiFi_Warri0r | dapper is out? | 08:51 |
| === concept10 [n=concept1@c-67-166-167-125.hsd1.tx.comcast.net] has joined #ubuntu | ||
| === Breezy-CA [i=0ff5d077@c-24-4-249-124.hsd1.ca.comcast.net] has joined #ubuntu | ||
| flonesaw_ | trappist -- but anybody who buys Intel dual over AMD didn't read the benchmarks. | 08:51 |
| _jason | !dapper | 08:51 |
| ubotu | Dapper Drake will be the next release of Ubuntu - due June 1 (see: http://tinyurl.com/qyrkq). Join channel #ubuntu+1 for discussion :) | 08:51 |
| trappist | WiFi_Warri0r: no | 08:51 |
| === igoutsou [n=igoutsou@ppp52-adsl-15.ath.forthnet.gr] has joined #ubuntu | ||
| === slack_prad [n=slack_pr@59.92.35.159] has joined #ubuntu | ||
| spine | erikl: code: sudo apt-get update && apt-get dist-upgrade | 08:51 |
| WiFi_Warri0r | flonesaw: hats not true | 08:52 |
| spine | sudo apt-get update && apt-get dist-upgrade | 08:52 |
| spine | thats the command | 08:52 |
| spine | well its 2 | 08:52 |
| === Coni18 [n=Coni18@3-135-222-201.adsl.terra.cl] has joined #ubuntu | ||
| === Coni18 [n=Coni18@3-135-222-201.adsl.terra.cl] has left #ubuntu ["Leaving"] | ||
| WiFi_Warri0r | intel makes good chips too, amd is just cheaper and can be overclocked to beat most faster intel's, but for reliability you should choose intel any day | 08:52 |
| === slack_prad [n=slack_pr@59.92.35.159] has left #ubuntu [] | ||
| trappist | spine: that by itself won't do it | 08:52 |
| flonesaw_ | WiFi_Warri0r -- Well, yes it is. But YMMV depending on what you're doing. | 08:52 |
| WiFi_Warri0r | yeah | 08:52 |
| Breezy-CA | Good day all ... my usb mouse has suddenly slowed down to a crawl, and the System Preferences Mouse menu won't let me boost it back up. Only thing that's changed hardware-wise is I dropped in a PCI SCSI card. Can smne help me? It's bugging me. | 08:52 |
| WiFi_Warri0r | yeah, im having touble with file sharing on a samba network, any help pleae! thnx | 08:53 |
| trappist | Breezy-CA: I hate to say it, but you might try a reboot | 08:53 |
| Breezy-CA | Did that, trappist - should have said so, though. | 08:53 |
| === thoffmeyer [n=tim@unaffiliated/hoffy] has joined #ubuntu | ||
| trappist | doh | 08:53 |
| lillpelle | Hi, I am running firestarter. My logs (typically /var/log/messages) and so get spammed with entries of the form "Mar 30 20:49:28 localhost kernel: [4302888.052000] Inbound IN=eth1 OUT= MAC=00:...". Is there a way to get rid of it from the logs? | 08:53 |
| === dang`r`us [n=eismann@zwiebel.inf.tu-dresden.de] has joined #ubuntu | ||
| insta` | lillpelle: do you need to be running it in the first place? | 08:54 |
| === CryoTox [n=Prophet@165.154.14.201] has joined #ubuntu | ||
| hatake_kakashi | lillpelle: change the log type | 08:54 |
| monteiro | anyone knows where can i put commands to be executed at boot ? | 08:54 |
| === pk2317 [n=pk2317@cpe-24-33-236-216.insight.res.rr.com] has joined #ubuntu | ||
| WiFi_Warri0r | i cant even connect to my shares locally w/o a user/pass and ive tried all my local accounts | 08:54 |
| WiFi_Warri0r | :? | 08:54 |
| flonesaw_ | Repost -- I cannot get Breezy to recognize two sound cards. lspci doesn't see both | 08:54 |
| Breezy-CA | The preferences menu must write to a config file ... anyone know what that file would be? I'd be happier editing it directly anyhow | 08:54 |
| === seth|away is now known as seth | ||
| === Jhair [n=user@p54A3E22E.dip.t-dialin.net] has joined #ubuntu | ||
| lillpelle | insta`: I am not sure, but why not? | 08:54 |
| insta` | lillpelle: it's a firewall, right? | 08:55 |
| pk2317 | hello, Is there anyone who can help with an Ubuntu 5.10 Breezy screen resolution issue? | 08:55 |
| CryoTox | Is there a program similar to HyprTerminal for linux, or is there a terminal command for dialing to a bbs? | 08:55 |
| === Stork [n=alex@storkey.plus.com] has joined #ubuntu | ||
| Stork | !nvidia | 08:55 |
| ubotu | [nvidia] at https://wiki.ubuntu.com/BinaryDriverHowto/Nvidia or http://ubuntuforums.org/showthread.php?t=57368 | 08:55 |
| _jason | pk2317: what issue? | 08:55 |
| lillpelle | hatake_kakashi: ok, so in the conf file, there is now "LOG_LEVEL=info". You know what to set it to? | 08:55 |
| WiFi_Warri0r | pk2317: what's the issue | 08:55 |
| === Yoric [n=ElYoric@cpc1-brig7-3-0-cust74.brig.cable.ntl.com] has joined #ubuntu | ||
| lillpelle | insta`: yes, it is a graphical interface to iptables (if I have understood it right) | 08:55 |
| === mumbles is now known as mumbles-out | ||
| === gabrieltomate [n=gabriel@201009066216.user.veloxzone.com.br] has joined #ubuntu | ||
| dang`r`us | I'm having quite some trouble with the xfonts-artwiz package. The fonts contained get installed to /usr/X11R6/lib/X11/fonts/misc - so I added that to my xorg.conf as a FontPath. Next, X was complaining about a missing fonts.dir, so I created it in the way the log told me. But I still don't get the fonts in any font selector. What am I missing here? | 08:55 |
| WiFi_Warri0r | pk2317: what video card u have? | 08:55 |
| erikl | When I play forward in players (in mplayer) i get http://pastebin.com/631255 | 08:56 |
| insta` | lillpelle: do you need any iptables rules at all, is what I'm saying | 08:56 |
| insta` | Why not just disable the services that you're worried about? | 08:56 |
| pk2317 | wifi: wife's computer crashed last night, and now the screen resolution is set at 640x480 @ 60 Hz with no options to change it | 08:56 |
| erikl | I really wan't .mkv to work | 08:56 |
| pk2317 | it worked fine at 1024x768 | 08:56 |
| WiFi_Warri0r | pk2317: did u check ur hardware profiles? | 08:56 |
| pk2317 | where is that? (linux newbies here) | 08:56 |
| flonesaw_ | pk2317 -- Specifics???? | 08:56 |
| === Exposure [n=Exposure@a196215.upc-a.chello.nl] has joined #ubuntu | ||
| tristanmike | erikl: mplayer works for mkv | 08:57 |
| WiFi_Warri0r | same here, click on main menu | 08:57 |
| CryoTox | Is there a program similar to HyprTerminal(Windows) for linux, or is there a terminal command for dialing to a bbs? | 08:57 |
| === sebastien_ [n=sebastie@81.56.230.50] has joined #ubuntu | ||
| hatake_kakashi | lillpelle: change it to some other one, I forgot which one it was | 08:57 |
| WiFi_Warri0r | system>administration>device manager | 08:57 |
| erikl | tristanmike: when I try to jump forward, it crash | 08:57 |
| WiFi_Warri0r | ;) | 08:57 |
| WiFi_Warri0r | make sure video card is right | 08:57 |
| dang`r`us | CryoTox, try minicom | 08:57 |
| === sebastien_ is now known as seb0uil | ||
| tristanmike | erikl: what if you pause it first ? | 08:57 |
| === lucaas [n=lucas@h29n11c1o1124.bredband.skanova.com] has joined #ubuntu | ||
| pk2317 | wifi: looked in there, didn't see a video driver listed | 08:57 |
| CryoTox | dang`r`us: can I just apt-get that? | 08:57 |
| _jason | ubotu: tell pk2317 about fixres | 08:57 |
| dang`r`us | CryoTox, yes you can | 08:57 |
| LathropWells | nvidia-glx enables GL but not video acceleration. - how do i fix that? | 08:58 |
| CryoTox | thanks | 08:58 |
| erikl | tristanmike: also crash | 08:58 |
| lillpelle | insta`: hehe, well, maybe you have a point... | 08:58 |
| trappist | WiFi_Warri0r: try with -idx | 08:58 |
| lillpelle | hatake_kakashi: ok | 08:58 |
| === Phazeman [n=mishka@mandriva/channel-support/Phazeman] has joined #ubuntu | ||
| === telematica [n=telemati@201.249.21.181] has joined #ubuntu | ||
| trappist | WiFi_Warri0r: if that doesn't work try with -vo=x11 | 08:58 |
| pk2317 | there was a graphics memory controller hub, and chipset grapics controller | 08:58 |
| === Pratico [n=csvteles@200.141.116.120] has joined #ubuntu | ||
| === Pratico [n=csvteles@200.141.116.120] has left #ubuntu ["Fui] | ||
| trappist | err -vo x11 | 08:59 |
| pk2317 | someone just sent me a link that might be helpful, let me try it out | 08:59 |
| flonesaw_ | CryoTox - Minicom | 08:59 |
| === NoNo_231 [n=NoNo_231@ppp52-adsl-15.ath.forthnet.gr] has joined #ubuntu | ||
| tristanmike | erikl: are you sure totem doesn't play it ? | 08:59 |
| === buzzc1 [n=buzzetti@bi-02pt1.bluebird.ibm.com] has joined #ubuntu | ||
| === NoNo_231 [n=NoNo_231@ppp52-adsl-15.ath.forthnet.gr] has left #ubuntu [""] | ||
| flonesaw_ | Repeat Q: I need assistance with dual sound card issue. | 09:00 |
| trappist | flonesaw_: that's not a Q | 09:00 |
| erikl | tristanmike: it plays it, but crash when I move jump forward | 09:00 |
| === newbuntie [n=irc@chello084010156151.chello.pl] has joined #ubuntu | ||
| Jhair | erikl: are you using totem with gstreamer? | 09:00 |
| tristanmike | erikl: both totem and mplayer crash when you try to jump forward ? | 09:00 |
| WiFi_Warri0r | -idx? | 09:00 |
| WiFi_Warri0r | what is -idx? | 09:00 |
| === sfar [n=sfar@c-70f3e253.18-2-64736c10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| erikl | tristanmike: yes | 09:01 |
| WiFi_Warri0r | sorry was on the phone with my agent | 09:01 |
| trappist | WiFi_Warri0r: some videos need an index to seek and don't have one - -idx builds one before playing it | 09:01 |
| === takedown [n=takedown@hst10.nkosino.ru] has joined #ubuntu | ||
| tristanmike | erikl: and what about Jhair 's question ? | 09:01 |
| === aneef [n=aneef@85.130.92.197] has joined #ubuntu | ||
| === TemplatesForAll [n=scott@ip68-0-140-152.tc.ph.cox.net] has joined #ubuntu | ||
| wold | is anyone here with problems about module "MRV8K" ??? | 09:01 |
| === freakyferret [n=robert@ACB041CB.ipt.aol.com] has joined #ubuntu | ||
| Jhair | ? | 09:01 |
| WiFi_Warri0r | trappist: im not having video problems, im having trouble with my sm\amba file shares | 09:01 |
| newbuntie | is there a good timer program in the repositories, something kind of like a stop watch? | 09:01 |
| Kezzer | how do you find out if you've got a 32-bit or 64-bit version of the JVM? | 09:01 |
| flonesaw_ | Repeat Q: With two sound cards, why would only one is be seen in "lspci" | 09:01 |
| WiFi_Warri0r | samba* | 09:01 |
| Kezzer | I'm using 64-bit edition of Ubuntu | 09:01 |
| trappist | oops who was it with mplayer problems | 09:01 |
| Kezzer | just need to know 'cause I need to get eclipse =) | 09:01 |
| trappist | flonesaw_: are they both pci cards? | 09:01 |
| erikl | Jhair: I don't know | 09:02 |
| Breezy-CA | Suddenly the Mouse prefs I set in System Preferences won't save. Anyone help? | 09:02 |
| trappist | flonesaw_: is one onboard and disabled in the bios? | 09:02 |
| flonesaw_ | trappist - One onboard, the other is Delta 44 PCI card | 09:02 |
| LathropWells | does lspci depend on what the bios tells it? | 09:02 |
| trappist | flonesaw_: which one shows | 09:02 |
| erikl | Jhair: totem-gstreamer is installed | 09:02 |
| === cmvo [n=cmvo@62.225.11.174] has left #ubuntu [] | ||
| tristanmike | erikl: "sudo apt-get install totem'xine" | 09:02 |
| flonesaw_ | trappist -- When Delta 44 is pulled "lspci" sees onboard. | 09:02 |
| tristanmike | erikl: "sudo apt-get install totem-xine" rather | 09:02 |
| === we2by_ [n=we2by@h8441153081.dsl.speedlinq.nl] has joined #ubuntu | ||
| trappist | LathropWells: I could be wrong, but I don't think the bios "tells" it anything. I think it just shuts down hardware when configured to do so. | 09:03 |
| flonesaw_ | trappist -- when Delta 44 is inserted, onboard card disappears. | 09:03 |
| === Amaranth [n=amaranth@ubuntu/member/amaranth] has joined #ubuntu | ||
| trappist | flonesaw_: oh, that may be a resource conflict then - like an irq conflict | 09:03 |
| Jhair | erikl: every day, every week users complain about problems with that version of totem. The stuff is buggy and bloated. Please try to use totem-xine instead | 09:03 |
| flonesaw_ | trappist - onboard card is via8237 | 09:03 |
| trappist | flonesaw_: you may be able to resolve that in your bios settings | 09:03 |
| === Ven] n^ [i=shagst@217-188-119.5001.adsl.tele2.no] has joined #ubuntu | ||
| === spine [n=spine@c-66-176-98-9.hsd1.fl.comcast.net] has joined #ubuntu | ||
| flonesaw_ | trappist -- IRQ, possibly? | 09:03 |
| erikl | Jhair: I have tried with xine | 09:04 |
| trappist | flonesaw_: yeah, that's what I said :) | 09:04 |
| === TemplatesForAll [n=scott@ip68-0-140-152.tc.ph.cox.net] has left #ubuntu [] | ||
| Ven] n^ | anyone gotten cpu scaling to work with centrino? | 09:04 |
| flonesaw_ | trappist -- We've put the Delta 44 in different PCI slots. No resolution. | 09:04 |
| === max_ [n=max@p549F85B1.dip0.t-ipconnect.de] has joined #ubuntu | ||
| Jhair | erikl: oh, I thought your problem was totem-gstreamer specific, if it's not please ignore my advice | 09:04 |
| === jason [n=jason@user-12-37-87-092.tvscable.com] has joined #ubuntu | ||
| erikl | Jhair: now there's just a vizulation thingie | 09:04 |
| jason | hi i need help | 09:04 |
| === BlackZun [n=BlackZun@c-289fe255.72-5-64736c10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| flonesaw_ | trappist -- wouldn't different PCI slot change IRQ, too? | 09:05 |
| Breezy-CA | Suddenly the Mouse prefs I set in System Preferences won't save. Anyone help? | 09:05 |
| _jason | jason: just ask you question | 09:05 |
| trappist | flonesaw_: your bios may be configured to assign a specific irq to a sound card, in which case the first one it sees will get it. it could also be that your mobo, having a builtin card, doesn't expect you to install another one and just can't deal with it | 09:05 |
| jason | how do i get a web cam to install in ubuntu | 09:05 |
| === zorin-home [n=zorin@host86-134-206-116.range86-134.btcentralplus.com] has joined #ubuntu | ||
| === scav- [n=larsj@216-34-96.0102.adsl.tele2.no] has joined #ubuntu | ||
| === rcaskey_ [n=rcaskey@cai17.music.uga.edu] has joined #ubuntu | ||
| === fd [n=johnson@rbgs-ip-nas-1-p45.telkom-ipnet.co.za] has joined #ubuntu | ||
| tristanmike | erikl: part of the problem is that the "mkv" codec is rather obscure, I personally don't even have the foggiest on why the trend seems to be moving from ogg to mkv, but that aside, the only way that I got 95% happy with my mkv playback was compiling vlc from source | 09:06 |
| flonesaw_ | trappist -- I've never see that b4. MoBo is ASUS A7V880. I"m running similar BIOS in my A8N and have two sound cards working (intel8x0 onboard and a similar pro card to Delta 44) | 09:06 |
| === fd is now known as j^son | ||
| === bretzel [n=bretzel@MTL-HSE-ppp190404.qc.sympatico.ca] has joined #ubuntu | ||
| === Col [n=alex@corb088027.halls.colostate.edu] has joined #ubuntu | ||
| === insta` [n=bboettch@rrcs-67-53-25-242.west.biz.rr.com] has left #ubuntu [] | ||
| === nick|here [n=boran@unaffiliated/nickhere/x-000000001] has joined #ubuntu | ||
| jason | how can i install my web cam | 09:07 |
| nick|here | how can i install motif? | 09:07 |
| tristanmike | erikl: just for fun try searching with synatpic "matroska" and see what pops up | 09:07 |
| trappist | flonesaw_: I haven't either, but it seems reasonable and would explain what you're seeing. you might look into how lspci gets its info and see if something higher level (in linux) could explain it. | 09:07 |
| j^son | yo people im struggling | 09:07 |
| j^son | with gcj | 09:07 |
| max_ | l | 09:08 |
| j^son | anyone have a page that explains exactly how to install it | 09:08 |
| WiFi_Warri0r | trouble with file sharing using samba, it asks for a user/pass but i didnt set one up during the file sharing process and none of my local account passwords and usernames work, any hjelp will be greatly appreciated! | 09:08 |
| erikl | tristanmike: I'll have to live with the problem as long as I can watch the movie | 09:08 |
| erikl | series* | 09:08 |
| WiFi_Warri0r | help* | 09:09 |
| flonesaw_ | trappist -- Or I can boot a liveCD (Knoppix, etc.) and see if it might be an Ubuntu issue. | 09:09 |
| Breezy-CA | Suddenly the Mouse prefs I set in System Preferences won't save. Can anyone give me a hand with this? Mouse has suddenly decided its acceleration will be slowest possible setting; this is not good :( | 09:09 |
| === FliesLikeALap [n=Ryan@toxophilite-18.dynamic2.rpi.edu] has joined #ubuntu | ||
| === qas [n=q@chelmsystem.futuro.pl] has joined #ubuntu | ||
| dang`r`us | WiFi_Warri0r, you need to use the "smbpasswd" program to set up a samba password file | 09:09 |
| tristanmike | erikl: I assume it will be better in dapper due to newer libs | 09:09 |
| Col | hey all, i tried to install the linux restrcted packages package, and im getting this error FATAL: Error inserting ath_pci (/lib/modules/2.6.12-10-386/net/ath_pci.ko): Unknown symbol in module, or unknown parameter (see dmesg) | 09:09 |
| === daria [n=daria@cot180.neoplus.adsl.tpnet.pl] has joined #ubuntu | ||
| flonesaw_ | trappist -- thank you very much for your ideas! Much appreciated. | 09:10 |
| === Spudchat [n=Spud@adsl-68-74-146-215.dsl.emhril.ameritech.net] has joined #ubuntu | ||
| pk2317 | question: used Ubunto Wiki's page on FixVideoResolutionHowto, ran the autodetect script, and it looked like it might have worked. The page asked us to close programs, and Ctrl-Alt-Bksp to restart X, and then log in again. Did that, and now we're at a command line. How do we get the Ubuntu GUI back? | 09:10 |
| flonesaw_ | will lurk and help some ppl | 09:10 |
| WiFi_Warri0r | dang'r'us: thnx alot now i know what to google for! ur the best! | 09:10 |
| trappist | flonesaw_: worth a shot | 09:10 |
| === gabbah [n=gabbah@82.99.36.8] has joined #ubuntu | ||
| elsvent | uhm i am confused now | 09:10 |
| LathropWells | ctrl+F7? | 09:10 |
| === richard [n=richard@rrcs-70-60-52-29.central.biz.rr.com] has joined #ubuntu | ||
| dang`r`us | WiFi_Warri0r, no problem | 09:10 |
| elsvent | i think i am using the newest driver | 09:11 |
| erikl | tristanmike: yeah, but I can't update to the flight version | 09:11 |
| tristanmike | erikl: did you search for "matroska" ? | 09:11 |
| erikl | tristanmike: I found nothing | 09:11 |
| WiFi_Warri0r | roy@ubuntu:~$ smbpasswd | 09:11 |
| WiFi_Warri0r | Old SMB password: | 09:11 |
| WiFi_Warri0r | New SMB password: | 09:11 |
| WiFi_Warri0r | Retype new SMB password: | 09:11 |
| WiFi_Warri0r | machine 127.0.0.1 rejected the (anonymous) password change: Error was : Account disabled. | 09:11 |
| WiFi_Warri0r | Failed to change password for roy | 09:11 |
| WiFi_Warri0r | roy@ubuntu:~$ | 09:11 |
| WiFi_Warri0r | ?? | 09:11 |
| WiFi_Warri0r | how do i enable my account? | 09:11 |
| === isilzha [n=isilzha@155.69.163.149] has joined #ubuntu | ||
| elsvent | but when i use "fglrx" i can not use any resolution that higher than 1024x 768 | 09:11 |
| LathropWells | sudo /etc/init.d/gdm restart ? | 09:11 |
| Breezy-CA | The Mouse prefs I set in System Preferences won't save. Can anyone give me a hand with this? Mouse has suddenly decided its acceleration will be slowest possible setting and I can change it but not save the change. Weird. | 09:12 |
| tristanmike | erikl: so you didn't find "libmatroska-dev" ? | 09:12 |
| === geargolem [n=geargole@pool-72-72-128-72.hrbgpa.dsl-w.verizon.net] has joined #ubuntu | ||
| elsvent | but if i switch to "radeon" it's got a blank screen | 09:12 |
| === LOQUiLLO_ [i=LOQUILLO@201.240.61.213] has joined #Ubuntu | ||
| trappist | WiFi_Warri0r: a) don't paste here. b) smbpasswd -e | 09:12 |
| elsvent | anyone experencied abot ATI driver? | 09:12 |
| WiFi_Warri0r | trappist: sorry and thnx | 09:12 |
| === cliebow [n=cliebow@sme2.ellsworth.k12.me.us] has joined #ubuntu | ||
| pk2317 | question: used Ubuntu Wiki's page on FixVideoResolutionHowto, ran the autodetect script, and it looked like it might have worked. The page asked us to close programs, and Ctrl-Alt-Bksp to restart X, and then log in again. Did that, and now we're at a command line. How do we get the Ubuntu GUI back? | 09:13 |
| sfar | ubotu, tell WiFi_Warri0r about paste | 09:13 |
| === Tomcat_ [n=Tomcat@p54A18B7C.dip0.t-ipconnect.de] has joined #ubuntu | ||
| swab79 | I'm trying to get my scsi tape drive working (hp C1537A), dmesg shows all my scsi devices, but /proc/scsi/scsi shows no devices, and there are no tape devices in /dev .. any ideas? | 09:13 |
| tristanmike | pk2317: "startx" | 09:13 |
| pk2317 | thanks | 09:13 |
| flonesaw_ | pk2317 - Well you can reboot. | 09:13 |
| === Yoric [n=ElYoric@cpc1-brig7-3-0-cust74.brig.cable.ntl.com] has joined #ubuntu | ||
| === dang`r`us [n=eismann@zwiebel.inf.tu-dresden.de] has left #ubuntu [] | ||
| flonesaw_ | pk2317 - startx will bring up X, but not the gui login. | 09:14 |
| erikl | tristanmike: I hade allready installed it | 09:14 |
| pk2317 | yay! monitor resolution is fixed! | 09:14 |
| pk2317 | wife thanks you all profusely | 09:14 |
| pk2317 | we had already logged in | 09:14 |
| === raich [n=raich@host137-43.pool8256.interbusiness.it] has joined #ubuntu | ||
| tristanmike | erikl: ok, just curious | 09:14 |
| pk2317 | but it was sitting at a command line | 09:14 |
| pk2317 | now we have another question | 09:14 |
| === raich is now known as x-up | ||
| pk2317 | that might be a bit more in-depth | 09:14 |
| WiFi_Warri0r | trappist: i typed in "smbpasswd -e roy -n" and it still shows me switches, any help? | 09:15 |
| Init5 | is Caconical ltd. or any developers working on making a 'portage' system as it is known from Gentoo linux, FreeBSD etc...? | 09:15 |
| elsvent | pk2317, could u give me ur xorg.conf? | 09:15 |
| Ven] n^ | if i installed ubuntu without acpi support.. do i need to reinstall or recompile kernel to get power management? | 09:15 |
| pk2317 | the computer is running extremely slowly for a week or two | 09:15 |
| IamEthos | how to I get rid of this damned touchpad | 09:15 |
| IamEthos | it's killing me | 09:15 |
| elsvent | pk2317, i am fixing the resolution problem too | 09:15 |
| pk2317 | @ elsvent: um, gimme a minute, im on a different computer | 09:15 |
| we2by_ | where do I get the non-free codecs for ubuntu amd 64? | 09:15 |
| _jason | IamEthos: disable it in bios, that's what I do | 09:15 |
| flonesaw_ | pk2317 -- difficult to diagnose w/o more info | 09:15 |
| IamEthos | I tried following the instructions, but nothing happened | 09:15 |
| elsvent | pk2317, ok | 09:15 |
| IamEthos | _jason: will that still allow me to use my USB mouse? | 09:15 |
| === nick|here [n=boran@unaffiliated/nickhere/x-000000001] has left #ubuntu ["Leaving"] | ||
| _jason | IamEthos: I do | 09:15 |
| === pierre- [n=pierre@ip73.168.adsl.wplus.ru] has joined #ubuntu | ||
| === ubuntu [n=ubuntu@red-corp-201.130.137.214.telnor.net] has joined #ubuntu | ||
| ubuntu | njlnlmk | 09:16 |
| === DeMo_BR [n=The@201-0-54-149.dsl.telesp.net.br] has joined #ubuntu | ||
| trappist | WiFi_Warri0r: maybe your smbpasswd file is in the old format. man smbpasswd and search for 'enable' | 09:16 |
| === jonshea___ [n=jonshea@129.170.202.3] has joined #ubuntu | ||
| trappist | WiFi_Warri0r: oh, and you have to run it as root (i.e. with sudo) | 09:16 |
| === din_lunch is now known as din | ||
| ubuntu | hola | 09:16 |
| WiFi_Warri0r | what is root passwd by default? | 09:17 |
| WiFi_Warri0r | i never set it | 09:17 |
| tristanmike | you "sudo" password | 09:17 |
| trappist | WiFi_Warri0r: there is none. sudo takes *your* password. | 09:17 |
| tristanmike | s/you/your | 09:17 |
| === holycow [n=holycow@d209-89-245-197.abhsia.telus.net] has joined #ubuntu | ||
| WiFi_Warri0r | ohh ok | 09:17 |
| pk2317 | @flonesaw - is there any more info I can easily give? | 09:17 |
| === Atlas95 [n=atlas@84.5.39.52] has joined #ubuntu | ||
| _jason | WiFi_Warri0r: root password is locked | 09:17 |
| === Guita [n=domien@86.104.29.218] has joined #ubuntu | ||
| === MetaMorfoziS [n=sajt@3e44a606.adsl.enternet.hu] has joined #ubuntu | ||
| WiFi_Warri0r | su is not working | 09:18 |
| === mr_lampe [n=tho@dslb-084-056-154-032.pools.arcor-ip.net] has joined #ubuntu | ||
| === kyral_ [n=Chris@ubuntu/member/kyral] has joined #ubuntu | ||
| WiFi_Warri0r | says authentication failure | 09:18 |
| _jason | ubotu: tell WiFi_Warri0r about sudo | 09:18 |
| WiFi_Warri0r | :O | 09:18 |
| we2by_ | where do I get the non-free codecs for ubuntu amd 64? | 09:18 |
| === DBO [n=jason@cpe-24-208-229-160.twmi.res.rr.com] has joined #ubuntu | ||
| === criminy [n=criminy@c-24-99-60-117.hsd1.ga.comcast.net] has joined #ubuntu | ||
| flonesaw_ | pk2317 -- Let's start with what progs and functions are slow. | 09:18 |
| === peterotool [n=otool@202.88.190.176] has joined #ubuntu | ||
| tristanmike | !tell we2by_ about restricted | 09:18 |
| trappist | WiFi_Warri0r: not su. sudo. | 09:18 |
| trappist | !tell WiFi_Warri0r about root | 09:18 |
| === fantito [n=fantito@193.Red-83-44-236.dynamicIP.rima-tde.net] has joined #ubuntu | ||
| tristanmike | we2by_: check you're pm from ubotu :) | 09:19 |
| swab79 | !tell swab79 about scsi | 09:19 |
| trappist | swab79: it's /msg ubotu scsi if you want it for yourself | 09:19 |
| swab79 | trappist: thanks | 09:19 |
| sfar | My sound is not working.. The device is installed, the codecs are installed.. it even worked before i reinstalled ubuntu.. where to begin? | 09:19 |
| flonesaw_ | sfar -- "sudo lspci | grep audio" | 09:20 |
| === joachim-n [n=joachim@ACCAF628.ipt.aol.com] has joined #ubuntu | ||
| _jason | j^son: why do you need jcg? | 09:20 |
| WiFi_Warri0r | ty trappist and jason!! u guys rock! | 09:20 |
| _jason | j^son: erm gcj | 09:20 |
| pk2317 | @elsvent: I can't seem to get the file onto this computer | 09:20 |
| === Spudchat [n=Spud@adsl-68-74-146-215.dsl.emhril.ameritech.net] has left #ubuntu [] | ||
| === PlutoPrime [n=farhad@c-67-164-97-225.hsd1.or.comcast.net] has joined #ubuntu | ||
| tristanmike | !tell pk2317 about pastebin | 09:21 |
| sfar | flonesaw_, got 2 lines.. Multimedia audio controller: VIA Technologies, Inc. VT82C686 AC97 Audio Controller (rev 50) | 09:21 |
| erikl | I don't wan't mplayer to crash :( | 09:21 |
| === valentinos [n=valentin@dsl-68-143.netway.com.cy] has joined #ubuntu | ||
| sfar | and Multimedia audio controller: Ensoniq 5880 AudioPCI (rev 02) | 09:21 |
| tristanmike | pk2317: you can use pastebin and paste it for him ;) | 09:21 |
| pk2317 | network isn't finding my (windows) computer, and tried copying it onto USB stick | 09:21 |
| peterotool | hello ubuntu brothers>>> i was downloading dapper drake through>>> wget http://cdimage.ubuntu.com/releases/dapper/flight-5/dapper-install-amd64.iso>>> then the internet conection was down and i try to download agin i fuck doesnt work any clue??? | 09:21 |
| elsvent | pk2317, are u using laptop? | 09:21 |
| pk2317 | no I can't, it's on a different computer | 09:21 |
| flonesaw_ | sfar -- that's the via82xx driver | 09:21 |
| pk2317 | I have 2 desktops | 09:21 |
| === richard [n=richard@rrcs-70-60-52-29.central.biz.rr.com] has joined #ubuntu | ||
| WiFi_Warri0r | i got my file sharing online! | 09:21 |
| valentinos | hello all | 09:21 |
| WiFi_Warri0r | perfect! | 09:21 |
| WiFi_Warri0r | thnx #ubuntu | 09:21 |
| pk2317 | one with linux, the other with windows, im chatting on the windows one right now | 09:21 |
| sfar | flonesaw_, hm, what about it? | 09:22 |
| Breezy-CA | The Mouse prefs I set in System Preferences won't save. Can anyone give me a hand with this? Mouse has suddenly decided its acceleration will be slowest possible setting and I can change it but not save the change. Weird. | 09:22 |
| tristanmike | pk2317: see you're pm from ubotu, you can paste the file on pastebin for him, does that computer have internet ? | 09:22 |
| flonesaw_ | sfar -- just a sec | 09:22 |
| sfar | right | 09:22 |
| pk2317 | yeah, hang on just a second, I didn't get a PM | 09:22 |
| tristanmike | !tell pk2317 about pastebin | 09:22 |
| pk2317 | I saw the !tell, but it didn't pop up anything | 09:22 |
| pk2317 | and again | 09:22 |
| odat | how do i fix this error please update PKG_CONFIG_PATH to point to ffmpegs source | 09:22 |
| tristanmike | !pastebin | 09:22 |
| ubotu | well, pastebin is a site where you can post large texts and screenshots so you don't flood the channel. You can find it at http://paste.ubuntu-nl.org - You can install webboard for easy pasting from the gnome taskbar | 09:22 |
| _jason | j^son: how are you trying to install gcj? | 09:22 |
| valentinos | how can i upgrade firefox to 1.5 on 64bit ubuntu system | 09:22 |
| richard | Is there a way to install the Ubuntu disc without installing all the software on it? I want to install more than just the server but I dont care if I get all the audio apps ect. | 09:23 |
| j^son | sudo apt-get install gcj | 09:23 |
| sfar | ubotu, tell valentinos about firefox1.5 | 09:23 |
| _jason | j^son: and what happens? | 09:23 |
| flonesaw_ | sfar -- The ALSA driver you load should be the one "snd_via82xx" | 09:23 |
| j^son | Reading package lists... Done | 09:23 |
| j^son | Building dependency tree... Done | 09:23 |
| j^son | Package gcj is not available, but is referred to by another package. | 09:23 |
| j^son | This may mean that the package is missing, has been obsoleted, or | 09:23 |
| j^son | is only available from another source | 09:23 |
| PlutoPrime | richard: not with breezy as far as I know.. with the dapper OEM installer you should be able to configure more stuff | 09:23 |
| === Manny [n=chris@p54969407.dip0.t-ipconnect.de] has joined #ubuntu | ||
| flonesaw_ | sfar -- do a "sudo lsmod" and look for "snd_via82xx" | 09:23 |
| _jason | j^son: can you paste the contents of /etc/apt/sources.list on http://paste.ubuntu-nl.org/ please and give us a link? | 09:24 |
| Breezy-CA | How stable is dapper so far? | 09:24 |
| PlutoPrime | very | 09:24 |
| Init5 | . | 09:24 |
| === Init5 [n=DHA@3E6B6BD2.rev.stofanet.dk] has left #ubuntu [] | ||
| richard | nice. I Think I will have to get Dapper. | 09:24 |
| PlutoPrime | it works better for me than breezy right now :) | 09:24 |
| === even [n=even@ti311110a080-8515.bb.online.no] has joined #ubuntu | ||
| pk2317 | how do I use pastebin? | 09:24 |
| valentinos | thanks sfar , reading | 09:24 |
| sfar | flonesaw, snd_via82xx 25792 2 | 09:24 |
| j^son | ill try | 09:24 |
| Breezy-CA | I went to Breezy about a month before official and had some issues | 09:24 |
| pk2317 | do I put in my name or the name im sending it to? | 09:24 |
| tristanmike | pk2317: sure, makes it easier | 09:25 |
| Breezy-CA | <--- still have some issues though | 09:25 |
| tristanmike | pk2317: yours | 09:25 |
| Breezy-CA | Maybe it's me ;p | 09:25 |
| flonesaw_ | sfar - ok. So the correct sound module is loaded. | 09:25 |
| tristanmike | !dapper | 09:25 |
| ubotu | Dapper Drake will be the next release of Ubuntu - due June 1 (see: http://tinyurl.com/qyrkq). Join channel #ubuntu+1 for discussion :) | 09:25 |
| odat | how do i fix this error please update PKG_CONFIG_PATH to point to ffmpegs source | 09:25 |
| flonesaw_ | sfar - just a sec | 09:25 |
| Breezy-CA | Back to my Breezy problem | 09:25 |
| Breezy-CA | The Mouse prefs I set in System Preferences won't save. Can anyone give me a hand with this? Mouse has suddenly decided its acceleration will be slowest possible setting and I can change it but not save the change. Weird. | 09:25 |
| erikl | tristanmie: could it be because I'm using the nvida drivers that came with ubuntu? | 09:25 |
| === xjonex [n=jone@dsl-roigw1-fe8ede00-5.dhcp.inet.fi] has joined #ubuntu | ||
| tristanmike | pk2317: when you hit send, copy the url and put it here for him to see it | 09:26 |
| tristanmike | erikl: well, i'm nVidia all the way, and I had quirky issues like that too and well, I told you what I ended up doing | 09:26 |
| pk2317 | http://paste.ubuntu-nl.org/11111 | 09:26 |
| pk2317 | is that what you needed? | 09:26 |
| _jason | 11111 there should be a prize for that one | 09:26 |
| === spiritz [n=spiritz@61.12.41.143] has joined #ubuntu | ||
| j^son | _jason: http://paste.ubuntu-nl.org/11112 | 09:26 |
| swab79 | Breezy-CA : I sometimes have the same problem, a reboot fixes it for me.. i submitted it as a bug, but nobody ever verified it | 09:26 |
| pk2317 | yay! a prize! | 09:26 |
| pk2317 | :-) | 09:27 |
| pk2317 | is flonesaw_ still here? | 09:27 |
| flonesaw_ | sfar - do a "cat /proc/asound/cards" | 09:27 |
| flonesaw_ | pk2317 - I'm here. | 09:27 |
| _jason | j^son: you need to enable the online repositories. Do you want instructions for editing the file manually or would you prefer to use synaptic? | 09:27 |
| === sistema [n=sistema@201.248.245.155] has joined #ubuntu | ||
| pk2317 | or someone else that wants to spend a lot of time trying to figure out why our ubuntu machine is running slowly? :-) | 09:27 |
| === midama [n=midama@ip-57-31.sn1.eutelia.it] has joined #ubuntu | ||
| pk2317 | basically we can't multitask, like, at all | 09:28 |
| === Auratus [n=alex@corb088027.halls.colostate.edu] has joined #ubuntu | ||
| odat | how do i fix this error please update PKG_CONFIG_PATH to point to ffmpegs source | 09:28 |
| === peterotool [n=otool@202.88.190.176] has left #ubuntu [] | ||
| Kezzer | how do you install the 64-bit version of the JDK5? | 09:28 |
| === GnarusLeo [n=gnaleo@33.80-203-115.nextgentel.com] has joined #ubuntu | ||
| sistema | como es que se llama | 09:28 |
| sistema | shadesqui | 09:28 |
| j^son | whatever floats your boat | 09:28 |
| sistema | squidshade | 09:28 |
| _jason | !es | 09:28 |
| Kezzer | I downloaded a .bin file but have no idea how to install it, I thought it was self-extracting =( | 09:28 |
| ubotu | Hispanohablantes: Por favor usen #ubuntu-es, #kubuntu-es o #edubuntu-es, alli obtendran mas ayuda. | 09:28 |
| sfar | flonesaw_, done. http://pastebin.com/631303 | 09:28 |
| Breezy-CA | swab79 - have rebooted 2x now, problem persists. There must be a way to directly edit whatever file holds the config settings, but I don't know what file that is | 09:28 |
| flonesaw_ | pk2317 - how much sdram, which CPU? | 09:28 |
| === sistema [n=sistema@201.248.245.155] has left #ubuntu ["Leaving"] | ||
| === bruce_ [n=bruce@i05m-87-91-131-225.d4.club-internet.fr] has joined #ubuntu | ||
| pk2317 | firefox (mainly Java), GAIM, Xine | 09:29 |
| === Yoric [n=ElYoric@cpc1-brig7-3-0-cust74.brig.cable.ntl.com] has joined #ubuntu | ||
| GnarusLeo | Just installed linux on my ipod nano .. that was fun :D Pointless, but fun! | 09:29 |
| pk2317 | I think 256MB of ram, is there a place to check? | 09:29 |
| === bimberi [n=bimberi@pdpc/supporter/active/bimberi] has joined #ubuntu | ||
| === nestquick [n=nestoyeu@83-158-134-39.dsl.tiscali.fr] has joined #ubuntu | ||
| clever | cat /proc/meminfo | 09:29 |
| flonesaw_ | sfar -- okay, you've got two sound cards. | 09:29 |
| pk2317 | CPU should be in the lower 1 GHz range | 09:29 |
| === nestquick [n=nestoyeu@83-158-134-39.dsl.tiscali.fr] has left #ubuntu ["Quitte"] | ||
| clever | run that in a console for the ram info | 09:29 |
| j^son | the easier one i guess | 09:29 |
| flonesaw_ | sfar -- just a sec | 09:29 |
| pk2317 | used to have Win2K on here, and ran just fine | 09:29 |
| clever | cat /proc/cpuinfo | 09:29 |
| clever | for the cpu | 09:29 |
| _jason | ubotu: tell j^son about repos | 09:29 |
| sfar | flonesaw_, i gess one of them is built in to the mb | 09:30 |
| sfar | +u | 09:30 |
| Auratus | hey all, I'm having some issues installing my madwifi driver, I installed the restricted packages package, and i get this error when i try sudo modprobe ath_pci, and this is the error i get | 09:30 |
| Auratus | FATAL: Error inserting ath_pci (/lib/modules/2.6.12-10-386/net/ath_pci.ko): Unknown symbol in module, or unknown parameter (see dmesg) | 09:30 |
| flonesaw_ | sfar -- which sound device do you want to use as your master card | 09:30 |
| Breezy-CA | swab79 - Thx for responding though. I had begun to think no one could see me ;p | 09:30 |
| _jason | j^son: for gcj you only need ``main'' but enabling the other repositories on the wiki page will give you access to a lot of programs | 09:30 |
| Breezy-CA | Will try rebooting *again* | 09:30 |
| flonesaw_ | sfar - I presume the SB AudioPCI | 09:30 |
| swab79 | Breezy-CA Sorry I can't actually help :) | 09:30 |
| === Bluekuja [n=bluekuja@host123-174.pool8250.interbusiness.it] has joined #ubuntu | ||
| sfar | flonesaw_, yes sir :) | 09:30 |
| flonesaw_ | sfar - not a bad card for the money ~$30 | 09:31 |
| === NoNo_231 [n=NoNo_231@ppp52-adsl-15.ath.forthnet.gr] has joined #ubuntu | ||
| flonesaw_ | sfar - just a sec | 09:31 |
| sfar | i actually found this computer at the dump | 09:31 |
| === takedown [n=takedown@hst10.nkosino.ru] has joined #ubuntu | ||
| === D1 [n=damian@pool-71-104-105-237.lsanca.dsl-w.verizon.net] has joined #ubuntu | ||
| === guerra [n=guerra@201008139249.user.veloxzone.com.br] has joined #ubuntu | ||
| === Be1 [n=Benjamin@82.31.46.1] has joined #ubuntu | ||
| sfar | complete 750mhz, 256mb ram, 30gb hdd :) ... | 09:31 |
| PlutoPrime | HAHA | 09:31 |
| === bhagabhi [n=bhagabhi@h113n4c1o269.bredband.skanova.com] has left #ubuntu [] | ||
| PlutoPrime | that's kinda funny | 09:32 |
| h0nus | what package is ld ("/usr/bin/ld: cannot find -lpq")? | 09:32 |
| _jason | h0nus: build-essential will give it to you | 09:32 |
| h0nus | no | 09:32 |
| h0nus | it didn't | 09:32 |
| h0nus | =( | 09:32 |
| flonesaw_ | sfar - let me see your /etc/modutils/alsa-base | 09:32 |
| elsvent | pk2317, could u just give me ur monitor section of xorg.conf? | 09:32 |
| _jason | h0nus: it should have, install binutils | 09:32 |
| === NoNo_231 [n=NoNo_231@ppp52-adsl-15.ath.forthnet.gr] has left #ubuntu [""] | ||
| pk2317 | @flonesaw - here is the pastebin for the memory and cpuinfo | 09:32 |
| === j_ack [n=nico@p508D8E51.dip0.t-ipconnect.de] has joined #ubuntu | ||
| swab79 | I'm trying to get my scsi tape drive working (hp C1537A), dmesg shows all my scsi devices, but /proc/scsi/scsi shows no devices, and there are no tape devices in /dev .. any ideas? | 09:32 |
| pk2317 | http://paste.ubuntu-nl.org/11113 | 09:32 |
| h0nus | "sudo apt-get install binutils" ? | 09:32 |
| _jason | h0nus: sure | 09:33 |
| === mizery [n=Mizery@applwibas04-pool11-a124.applwi.tds.net] has joined #ubuntu | ||
| pk2317 | @elsvent: how do I separate that out? | 09:33 |
| flonesaw_ | pk2317 - don't put @ in front of my name. It doesn't highlight that way | 09:33 |
| Kezzer | Anyone know how to install the 64-bit JDK on 64-bit Ubuntu, no? | 09:33 |
| pk2317 | sorry, just do your name? | 09:33 |
| sfar | flonesaw_, http://pastebin.com/631309 | 09:33 |
| === whitynz [n=whity@60-234-132-74.bitstream.orcon.net.nz] has joined #ubuntu | ||
| elsvent | pk2317, ok sorry | 09:33 |
| === TSCHAK3 [n=thomas@24-53-91-155.clspco.adelphia.net] has joined #ubuntu | ||
| === WiFi_Warri0r [n=roy@adsl-70-136-54-247.dsl.hstntx.swbell.net] has joined #ubuntu | ||
| TSCHAK3 | what do i need to install to get beagle to index my gaim conversations and email messages? | 09:34 |
| === snowblink [n=snowblin@82-35-40-121.cable.ubr02.camd.blueyonder.co.uk] has joined #ubuntu | ||
| flonesaw_ | sfar - Do you want to use *both* cards, or just one of them. | 09:34 |
| === Stormx2 [n=Stormx2@host-87-240-137-127.hi-velocity.net] has joined #ubuntu | ||
| sfar | one of them will do fine | 09:34 |
| === sorsis [n=sorsis@81.31.122.198] has joined #ubuntu | ||
| h0nus | _jason, will i need to reboot? | 09:34 |
| sorsis | can ubuntu live disk handle ntfs partitions? | 09:34 |
| _jason | h0nus: shouldn't | 09:35 |
| h0nus | i still get that error | 09:35 |
| flonesaw_ | sfar -- your problem is that Ubuntu is loading onboard audio as first card. | 09:35 |
| tristanmike | sorsis: reading is fine, writing is sketchy | 09:35 |
| flonesaw_ | sfar - two resolutions.... | 09:35 |
| _jason | h0nus: what error? | 09:35 |
| tristanmike | sorsis: you will have to mount it accordinglyl | 09:35 |
| === madewokherd [n=urk@VRP5000.rhbd.psu.edu] has joined #ubuntu | ||
| === xai [n=pasta@about/networking/0.0.0.0/xai] has left #ubuntu ["Zneet] | ||
| flonesaw_ | sfar - easiest, disable onboard audio in BIOS. | 09:35 |
| flonesaw_ | sfar - then Ubuntu will load only AudioPCI | 09:36 |
| h0nus | _jason, "/usr/bin/ld: cannot find -lpq" | 09:36 |
| h0nus | _jason, i'm trying to install hydra | 09:36 |
| sfar | flonesaw_, okay, i will try that and hold my thumbs :) be right back | 09:36 |
| flonesaw_ | sfar -- Other way -- add module options to /etc/modutils/alsa | 09:36 |
| _jason | h0nus: oh, I thought you didn't have ld | 09:37 |
| === pier [n=pier@host223-217.pool80104.interbusiness.it] has joined #ubuntu | ||
| sorsis | tristanmike, i was thinking to delete some files from ntfs partition because windows claims that those files are in use and windows can't delete those | 09:37 |
| sfar | Ok, ill try the bios first | 09:37 |
| sfar | brb | 09:37 |
| h0nus | _jason, it's saying i don't | 09:37 |
| === joachim-n [n=joachim@ACCAF628.ipt.aol.com] has joined #ubuntu | ||
| sorsis | tristanmike, could it do that? | 09:37 |
| flonesaw_ | pk2317 - Did you have a paste for me? | 09:37 |
| h0nus | _jason, or that i don't have lpq | 09:37 |
| tristanmike | sorsis: I wouldn't suggest it | 09:37 |
| h0nus | what is lpq | 09:37 |
| === eduardo [n=eduardo@201.153.243.190] has joined #ubuntu | ||
| tristanmike | sorsis: have you tried "safe mode" ? | 09:37 |
| Deep6 | Sorsis it's difficult to have NTFS mounted read write | 09:37 |
| flonesaw_ | pk2317 - Or just tell me which cpu you have and how much memory | 09:38 |
| === redir [n=robrien@mail.westover-group.com] has joined #ubuntu | ||
| === medication- [n=jeff@ool-43539cbb.dyn.optonline.net] has joined #ubuntu | ||
| === foile [n=joe@p549FD2C8.dip.t-dialin.net] has joined #ubuntu | ||
| _jason | h0nus: did you read the README and INSTALL files to make sure you got all the depends? | 09:38 |
| === radiodog [n=ivar@65-100-2-72.eugn.qwest.net] has joined #ubuntu | ||
| === foile [n=joe@p549FD2C8.dip.t-dialin.net] has left #ubuntu ["...] | ||
| === fredrik [n=fredrik@host-83-166-19-203.hernonet.se] has joined #ubuntu | ||
| j^son | can anybody help me with playing mp3s and other formats in breezy badger | 09:39 |
| h0nus | _jason, i did read them, and the first instruction is to type "./configure" | 09:39 |
| fredrik | Hur delar jag ut en mapp i ett windows ntverk | 09:39 |
| === rappo [n=ozma@cpe-24-193-239-76.ucwphilly.res.rr.com] has joined #ubuntu | ||
| === pk2317_ [n=pk2317@cpe-24-33-236-216.insight.res.rr.com] has joined #ubuntu | ||
| _jason | h0nus: they should list dependencies somewhere, that | 09:39 |
| _jason | h0nus: is the first thing you need to do | 09:39 |
| GnarusLeo | !tell fredrik about samba | 09:39 |
| h0nus | _jason, when i do that, it tells me i'm missing 2 dependencies | 09:39 |
| pk2317_ | im back, my computer randomly decided to lose power | 09:40 |
| h0nus | _jason, but i can't find them to install | 09:40 |
| _jason | h0nus: yes, you need to get them | 09:40 |
| pk2317_ | did anyone say anything to me in the last 5 minutes or so? | 09:40 |
| _jason | h0nus: what are they? | 09:40 |
| _jason | ubotu: tell j^son about mp3 | 09:40 |
| h0nus | _jason, can i pastebin this for better help? | 09:40 |
| flonesaw_ | pk2317 - What CPU do you have? How much memory? | 09:40 |
| _jason | h0nus: of course | 09:40 |
| === GGS [n=gunne@h203n1fls31o834.telia.com] has joined #ubuntu | ||
| h0nus | one sec | 09:40 |
| === Be1 is now known as benj1 | ||
| pk2317_ | flonesaw_, http://paste.ubuntu-nl.org/11113 | 09:41 |
| pk2317_ | thats the meminfo and the cpu info from my wife | 09:41 |
| === benj1 is now known as be1 | ||
| === sm [n=simon@pool-71-107-254-16.lsanca.dsl-w.verizon.net] has left #ubuntu [] | ||
| === TSCHAK3 [n=thomas@24-53-91-155.clspco.adelphia.net] has joined #ubuntu | ||
| h0nus | _jason, http://paste.ubuntu-nl.org/11115 | 09:41 |
| guerra | Hail all! Anyone knows what repositories i use to get flash stuff? i could only install the mozilla player one! Thanks | 09:41 |
| === be1 is now known as benjamin_joseph | ||
| flonesaw_ | pk2317_ - Okay, you've got a pretty slow (by today's standards) machine. | 09:42 |
| === foile [n=joe@p549FD2C8.dip.t-dialin.net] has joined #ubuntu | ||
| === raphink [n=raphink@ubuntu/member/raphink] has joined #ubuntu | ||
| pk2317_ | somewhat, but it ran windows 2K fine, I didn't think Linux should give it *that* much of a problem | 09:42 |
| flonesaw_ | pk2317_ - Also, you have 384MB of ram, which is okay, but not great. | 09:42 |
| === sylvain [n=sylvain@bur91-1-82-227-4-2.fbx.proxad.net] has joined #ubuntu | ||
| === duelboot [n=duelboot@72-255-77-65.client.stsn.net] has joined #ubuntu | ||
| h0nus | _jason, when i goto the first recommended site, all i see are orderable cd's | 09:43 |
| clever | i have 256mb ram and 700mhz-1ghz pc | 09:43 |
| flonesaw_ | pk2317_ - Do you have a swap partition? If so, how big? | 09:43 |
| rappo | So i installed dapper yesterday... i had like 200 packages to update... updated and then when I rebooted it's telling me no OS found | 09:43 |
| clever | with ubuntu | 09:43 |
| GnarusLeo | I was wondering .. if I connect my ipid (without mounting it) ... can VMware (winxp) read/write to it? | 09:43 |
| clever | and it runs just fine | 09:43 |
| === foile [n=joe@p549FD2C8.dip.t-dialin.net] has left #ubuntu ["...] | ||
| pk2317_ | i dont know, I don't think so | 09:43 |
| rappo | but if i use a boot cd to look at the hdd, the files are still there | 09:43 |
| pk2317_ | I can, if you tell me how to | 09:43 |
| swab79 | Breezy-CA Sorry, I don't know the answer | 09:43 |
| CNAP | trappist: just successfully ran the script. however my other box still can't see the internet. will i have to configure the gateway to be the ip of the nic on here? i don't exactly have a configured lan setup, just a hub with an internet connection and 2 computers | 09:43 |
| flonesaw_ | pk2317_ - do a "sudo fdisk -l" and paste it. | 09:43 |
| === batman [n=tyler@grnl-01-1048.dsl.iowatelecom.net] has joined #ubuntu | ||
| === we2by_ [n=we2by@h8441153081.dsl.speedlinq.nl] has left #ubuntu ["Leaving"] | ||
| === brendan [n=brendan@albatross.kublai.com] has joined #ubuntu | ||
| batman | hey can someone tell me how to install xmms themes? | 09:43 |
| === Ogg`u [n=kamil@80.51.6.6] has joined #ubuntu | ||
| === redir [n=robrien@mail.westover-group.com] has joined #ubuntu | ||
| batman | i copied the files into my home .xmms/Skins dir but its not changing the skin | 09:44 |
| trappist | CNAP: that's exactly what you need to do. and set your dns servers to be the same as you have there. | 09:44 |
| brendan | hola, here's a quickie: what's the command to get firefox to open an URL from the command line? I thought there was a gnome-moz-remote but it seems to have disappeared... | 09:44 |
| flonesaw_ | pk2317_ - Nevermind. It's in your "free" output | 09:44 |
| _jason | batman: you have to select it in preferences | 09:44 |
| GnarusLeo | batman, right click -> smething -> skins | 09:44 |
| === sfar [n=sfar@c-70f3e253.18-2-64736c10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| batman | alright | 09:44 |
| LathropWells | rappo - use your install disk in 'rescue mode' to reinstall grub? | 09:44 |
| === theskunk_ [n=theskunk@ip-152010149234.acs.appstate.edu] has joined #ubuntu | ||
| flonesaw_ | pk2317_ - You have 1Gb of swap | 09:44 |
| CNAP | trappist: ohhh, ok let me set the DNS servers and i'll get back to you | 09:45 |
| pk2317_ | is that good? | 09:45 |
| GnarusLeo | and batman .. kinda stupid question ... :P | 09:45 |
| === nacho_ [n=nacho@134.Red-80-34-92.staticIP.rima-tde.net] has joined #ubuntu | ||
| === TSCHAK3 [n=thomas@24-53-91-155.clspco.adelphia.net] has joined #ubuntu | ||
| rappo | LathropWells I'm trying to but i can't figure out what to put for the harddrive | 09:45 |
| clever | CNAP, without dns servers set you wont be able to use dns names | 09:45 |
| h0nus | _jason, and the libssh-0.11 that i downloaded doesn't give any instructions in the README | 09:45 |
| batman | GnarusLeo no ! | 09:45 |
| rappo | LathropWells It's a sata hdd.. but (hd0,1) gives a failure with "Exit code 20" | 09:45 |
| === foile [n=joe@p549FD2C8.dip.t-dialin.net] has joined #ubuntu | ||
| === benjamin_joseph [n=Benjamin@82.31.46.1] has left #ubuntu [] | ||
| LathropWells | rappo - yes, i have had the same problem. - being new i was forced to reinstall - ugh | 09:46 |
| flonesaw_ | pk2317_ - What I would do is scale down the eye-candy on that machine. It's really not a super fast machine. Adding some more memory to it will benefit you greatly. | 09:46 |
| sfar | flonesaw_, it totally works now.. thank you very much for the help.. btw, do you know what "OnBoard Sound" vs "OnBoard Legacy Audio" is? I disabled them both :) | 09:46 |
| _jason | h0nus: install libpq-dev, I don't know about those sapr3 and ssh2 modules. You may need to compile that | 09:46 |
| clever | from the command line in grub you can search for files | 09:46 |
| pk2317_ | how do I do that? | 09:46 |
| === larsj__ [n=larsj@216-34-96.0102.adsl.tele2.no] has joined #ubuntu | ||
| rappo | LathropWells :( how did you figure out the proper sytax for the harddrive? | 09:46 |
| === invitado [n=usuario4@201.247.94.159] has joined #ubuntu | ||
| === Enthusiast78 [n=diogo@200-203-54-19.nhoce7001.e.brasiltelecom.net.br] has joined #ubuntu | ||
| pk2317_ | we don't need a lot of "flashy stuff" | 09:47 |
| clever | rappo, i read the entire info manual on grub | 09:47 |
| === atollena [n=antoine@acces1368.res.insa-lyon.fr] has joined #ubuntu | ||
| h0nus | _jason, libpq isn't found | 09:47 |
| === redir [n=robrien@mail.westover-group.com] has joined #ubuntu | ||
| flonesaw_ | sfar - good. Don't know what legacy audio is, unless it's an ISA interface to the sound. | 09:47 |
| Auratus | anyone have any idea what the uudecode package is called? | 09:47 |
| _jason | h0nus: huh? | 09:47 |
| === pillye [n=pillye@adsl-ull-209-95.50-151.net24.it] has joined #ubuntu | ||
| === ara [n=ara@c-360de353.01-94-7673741.cust.bredbandsbolaget.se] has left #ubuntu ["Lmnar"] | ||
| === [SEAWOLF] [n=seawolf@host166-57.pool8261.interbusiness.it] has joined #ubuntu | ||
| === s_g [i=s_g@toronto-HSE-ppp4038907.sympatico.ca] has left #ubuntu [] | ||
| h0nus | # apt-get install libpq-dev | 09:47 |
| h0nus | Reading package lists... Done | 09:47 |
| h0nus | Building dependency tree... Done | 09:47 |
| h0nus | E: Couldn't find package libpq-dev | 09:47 |
| === NCLife_ is now known as NCLife | ||
| h0nus | sry! | 09:47 |
| === woodwizzle [n=corey@user-0cej715.cable.mindspring.com] has joined #ubuntu | ||
| bwlang | apt-cache search uudecode | 09:47 |
| _jason | !info libpq-dev | 09:47 |
| ubotu | libpq-dev: (header files for libpq4 (PostgreSQL library)), section libdevel, is optional. Version: 8.0.3-15ubuntu2 (breezy), Packaged size: 147 kB, Installed size: 764 kB | 09:47 |
| _jason | h0nus: you are using breezy? | 09:48 |
| h0nus | hoary =( | 09:48 |
| _jason | !info libpq-dev hoary | 09:48 |
| === budluva [n=budluva@d209-89-216-221.abhsia.telus.net] has joined #ubuntu | ||
| === foile [n=joe@p549FD2C8.dip.t-dialin.net] has left #ubuntu ["...] | ||
| flonesaw_ | pk2317_ - Please use my name so your responses are highlighted. Eye-candy is stuff like animated window opening, etc. | 09:48 |
| === torque [n=torque@unaffiliated/sgrgc] has joined #ubuntu | ||
| === Zdra [n=zdra@81.247.172.23] has joined #ubuntu | ||
| LathropWells | nvidia-glx enables GL but not video acceleration. - how do i fix that? | 09:49 |
| _jason | !info libpqxx-dev hoary | 09:49 |
| ubotu | libpqxx-dev: (C++ library to connect to PostgreSQL (development files)), section universe/libdevel, is optional. Version: 2.4.1-2 (hoary), Packaged size: 586 kB, Installed size: 4828 kB | 09:49 |
| theD3viL | when i wanna stream with mozilla-plugin (mplayer-plguin) mplayer opens twice! Why? | 09:49 |
| _jason | h0nus: try that | 09:49 |
| flonesaw_ | pk2317_ - you can disable that stuff in Gnome Settings Desktop | 09:49 |
| pk2317_ | flonesaw_, where would I find that kind of stuff to turn it off? | 09:49 |
| torque | do you know that you can use gmail as a remote hd | 09:49 |
| h0nus | _jason, would that be an "apt-get"? | 09:49 |
| _jason | h0nus: yes | 09:49 |
| === raphink [n=raphink@ubuntu/member/raphink] has joined #ubuntu | ||
| === brendan [n=brendan@albatross.kublai.com] has left #ubuntu [] | ||
| flonesaw_ | pk2317_ - Well, there doesn't seem to be too many settings that will help you there. | 09:50 |
| === kubuntu [n=admin@m815f36d0.tmodns.net] has joined #ubuntu | ||
| flonesaw_ | pk2317_ - What brand of machine is it? | 09:50 |
| h0nus | _jason, how do i tell the exact name of the package ("apt-get install libdevel" doesn't work) | 09:51 |
| === ac3 [n=how@dD5770E73.access.telenet.be] has joined #ubuntu | ||
| _jason | h0nus: libpqxx-dev | 09:51 |
| pk2317_ | flonesaw_ an emachine (I know, I know, I apologize in advance :-P ) | 09:51 |
| === sebastien_ [n=sebastie@81.56.230.50] has joined #ubuntu | ||
| swab79 | I'm trying to get my scsi tape drive working (hp C1537A), dmesg shows all my scsi devices, but /proc/scsi/scsi shows no devices, and there are no tape devices in /dev .. any ideas? | 09:51 |
| flonesaw_ | pk2317_ - eMachine is fairly generic. | 09:51 |
| Ogg`u | Jest tu kto z polski ? | 09:51 |
| _jason | !pl | 09:51 |
| ubotu | Mozesz uzyskac pomoc w jezyku polskim na #ubuntu.pl | 09:51 |
| ac3 | Hi | 09:52 |
| h0nus | _jason, lol now i get an error: "Package libpqxx-dev has no installation candidate" | 09:52 |
| _jason | ubotu: tell h0nus about universe | 09:52 |
| === bartel [n=bartel@osuosl/staff/bartel] has joined #ubuntu | ||
| === mian1ak [n=mianiak@211.27.163.51] has joined #ubuntu | ||
| flonesaw_ | pk2317_ - Paste "sudo lspci" | 09:52 |
| clever | pastebin might be better | 09:52 |
| LathropWells | have you enabled "Universe community supported" in repositories? | 09:52 |
| kubuntu | having problems playing audio on kubuntu can anyone help | 09:52 |
| bartel | hi, I can't play dvds with Breezy 5.10 on a fujitsu lifebook. I've been up and down the forums and google and can't figure it out... Any ideas?? | 09:53 |
| GnarusLeo | !tell bartel about dvd | 09:53 |
| === awelynant [n=awelynan@black.renesys.com] has joined #ubuntu | ||
| CNAP | trappist: ok, here's the deal and you might be able to tell me what i'm doing wrong here. my ISP will only allow 1 MAC address per port. right now i'm trying to circumvent that by creating a gateway to the internet so that it still looks like 1 MAC address. my client machine is picking up a 192.168.1.* IP address but not picking up any IP packets | 09:53 |
| ac3 | Im do export DISPLAY=0:0 and then xhost +127.0.0.1 but tha hangs | 09:53 |
| GnarusLeo | kubuntu, audio? or just mp3? | 09:53 |
| ac3 | what could that be? | 09:53 |
| ac3 | running dapper | 09:54 |
| sfar | ubotu tell ac3 about dapper | 09:54 |
| bartel | GnarusLeo: yep, I have libdvdcss2 | 09:54 |
| pk2317_ | flonesaw_ it's an emachines desktop from a couple years ago, that I've done a few modifications on (more RAM, extra HD), lspci is http://paste.ubuntu-nl.org/11116 | 09:54 |
| kubuntu | gnarusleo - i gives me an error - Error Initializing Audio | 09:54 |
| kubuntu | There was an error initializing the audio i/o layer. You will not be able to play or record audio. | 09:54 |
| kubuntu | Error: host error. | 09:54 |
| GnarusLeo | kubuntu, check that alsa is loaded | 09:54 |
| === yaaar [n=chatzill@12-216-224-35.client.mchsi.com] has joined #ubuntu | ||
| kubuntu | gnarusleo - but i can hear systems sounds | 09:54 |
| Jhair | ac3: what are you trying to do? (if possible don't set DISPLAY, but use ssh -X instead) | 09:55 |
| === R_engel [n=vladimir@85.249.72.80] has joined #ubuntu | ||
| === torque [n=torque@unaffiliated/sgrgc] has left #ubuntu [] | ||
| kubuntu | gnarusleo - i have loaded all the stuff listed in the Wiki | 09:55 |
| Enthusiast78 | has anyone compiled kqemu? | 09:55 |
| GnarusLeo | kubuntu, then its a progrma error ... wich program are you trying to use? | 09:55 |
| === leagris [n=leagris_@mama.noiraude.net] has joined #ubuntu | ||
| Jhair | Enthusiast78: I've compiled qemu, but not kqemu | 09:55 |
| ac3 | i run a command from a terminal | 09:55 |
| kubuntu | i have tried audacity, amarok and kafeine | 09:55 |
| bartel | libdvdcss2 is already the newest version | 09:55 |
| Jhair | ac3: fine | 09:55 |
| === bigmoe [n=bigmoe@82.205.157.2] has joined #ubuntu | ||
| ac3 | wine ~/.wine/drive_c/Program\ Files/Exact\ Audio\ Copy/EAC.exe | 09:56 |
| kubuntu | gnarusleo - how do i check if its loaded correctly? | 09:56 |
| Enthusiast78 | Jhair, I have got qemu installed from the package, but I'd like to get the kqemu module to improve emulation a bit... | 09:56 |
| GnarusLeo | kubuntu, it is when you hear system sounds ... have tried the amarok-xine engine? | 09:56 |
| === sq3htu [n=sq3htu@213.199.207.3] has joined #ubuntu | ||
| LathropWells | Enthus, - from everything i have read kqemu works but very slowly. - wine, crossover office, vmware or even cedega might be a better alternative. | 09:56 |
| kubuntu | gnarusleo - nope | 09:56 |
| kubuntu | gnarusleo - should i add it? | 09:57 |
| bigmoe | i have 2 network cards and they are configured but no connection would pass through them | 09:57 |
| === sambagirl [i=leftist@c-67-191-245-116.hsd1.ga.comcast.net] has joined #ubuntu | ||
| === Agrajag_ [n=zaphod@cpe-72-130-83-97.socal.res.rr.com] has joined #ubuntu | ||
| Auratus | trappist, still workin on those madwifi drivers, for some reason im havin trouble getting these ones to compile -=/ | 09:57 |
| bigmoe | and when i remove the netcable and plug it in again they appear as disconnected | 09:57 |
| GnarusLeo | kubuntu, its worth a try! "sudo apt-get install amarok-xine" | 09:57 |
| bigmoe | can someone tell me what to do?? | 09:57 |
| Enthusiast78 | LathropWells, All I want is to have a 'virtual' breezy so I can test things on it without messing my running installation. | 09:57 |
| === hunk [n=hunk@dsl-201-129-235-104.prod-infinitum.com.mx] has joined #ubuntu | ||
| === michael [n=michael@host-74.216-16-13.iw.net] has joined #ubuntu | ||
| kubuntu | gnarusleo - its installed and i still cant play | 09:58 |
| GnarusLeo | kubuntu, have you enabled it in amarok as well? in settings -> engine | 09:58 |
| ac3 | clever: im not registered | 09:58 |
| kubuntu | gnarusleo - will check | 09:59 |
| === arrinmurr [n=arrinmur@MCDXL.tun.saunalahti.fi] has joined #ubuntu | ||
| === dzonni [n=dzonni@217-159-219-166-dsl.est.estpak.ee] has joined #ubuntu | ||
| R_engel | ubotu, | 09:59 |
| ubotu | I don't know, try searching at http://ubuntu.cc.com.au/, R_engel | 09:59 |
| LathropWells | Enthusiast78, then you definetly want vmware - there was a free "browser appliance" available and by happy coincidence it is Ubuntu. download the vmware disk image player. | 09:59 |
| flonesaw_ | pk2317_ - Well, it's a pretty old chipset. I'd add more memory. | 09:59 |
| R_engel | ubotu, repository | 09:59 |
| ubotu | My cat's name is Mittens! Try searching at http://ubuntu.cc.com.au/, R_engel | 09:59 |
| === mattw_ [n=mattw@216.138.174.2] has joined #ubuntu | ||
| GnarusLeo | !tell R_engel about repos | 09:59 |
| rappo | LathropWells, thanks... all I had to do was (hd0) | 10:00 |
| rappo | i was getting too fancy with the parameters, heh | 10:00 |
| R_engel | !tell about repos | 10:00 |
| bartel | !tell /me how to play dvds | 10:00 |
| _jason | !msg the bot | 10:00 |
| ubotu | Please message the bot (me) in private, more info about the bot: http://wiki.ubuntu.com/UbotuUsage | 10:00 |
| bartel | heh | 10:00 |
| GnarusLeo | give it a rest allready .. | 10:00 |
| pk2317_ | flonesaw_ is there any other option? like maybe an older version of ubuntu? because windows 2000 works great with that much memory, and if it's going to be this slow then we might be forced to switch back (and we'd rather not do that) | 10:00 |
| clever | ahhh ops ac3 | 10:00 |
| clever | ac3, whats Exact\ Audio\ Copy/EAC.exe do? | 10:00 |
| flonesaw_ | pk2317_ - Also, check your log files for problems. Don't know precisely what to look for, but anything that looks out of normal | 10:00 |
| LathropWells | rappo - oh sure now you tell me it is easy and i didn't need to reinstall. - lol - good luck ;) | 10:01 |
| flonesaw_ | pk2317_ - A custom kernel compile will help, too. Don't know if you've ever done that before. | 10:01 |
| pk2317_ | flonesaw_ looked through some of them, but I don't really know what we're looking for, and didn't notice anything extremely odd | 10:01 |
| === theD3viL [n=geel@BSN-77-90-27.dsl.siol.net] has left #ubuntu ["Leaving"] | ||
| kingspawn | pk2317_: sure all memory has been detected? | 10:01 |
| pk2317_ | flonesaw_ hahaha :-P Linux newbies here | 10:01 |
| === bartel [n=bartel@osuosl/staff/bartel] has left #ubuntu [] | ||
| flonesaw_ | pk2317_ - I guess that's all you can do with the logs, then. | 10:01 |
| mattw_ | has anyone set up driftnet successfully? | 10:01 |
| pk2317_ | flonesaw_ | 10:01 |
| === djk_ [n=djk@p54A2E4ED.dip.t-dialin.net] has joined #ubuntu | ||
| === clever pokes ac3 | ||
| pk2317_ | flonesaw_ that's how much physical memory ive put into the system, a 128 MB stick and a 256 MB stick | 10:02 |
| flonesaw_ | pk2317_ - It's not difficult to compile kernel. It's only a matter of knowing your hardware. | 10:02 |
| h0nus | _jason, are you still around? | 10:02 |
| ac3 | install eac | 10:02 |
| _jason | h0nus: yes | 10:02 |
| clever | what will eac do ac3 ? | 10:02 |
| pk2317_ | flonesaw_ this is the one computer i *didn't* build myself, so I don't know it as well as I'd like | 10:02 |
| j^son | _jason: i installed gcj but when i run it it says libgcj.spec: No such file or directory | 10:02 |
| h0nus | _jason, how would i go about compiling those other two prerequisites? | 10:02 |
| === caglar_ is now known as caglar | ||
| flonesaw_ | pk2317_ - That's why I asked for the lspci output. | 10:03 |
| pk2317_ | flonesaw_ is that all we would need? | 10:03 |
| _jason | h0nus: google for their main site and download a source tarball | 10:03 |
| === TSCHAK2 [n=thomas@24-53-91-155.clspco.adelphia.net] has joined #ubuntu | ||
| _jason | !find libgcj.spec | 10:03 |
| flonesaw_ | pk2317_ - well, maybe you ought to have output of "lspci -v" which gives all the info. | 10:03 |
| ubotu | Ubuntu Search of 'libgcj.spec' (2 shown): (/usr/lib/libgcj.spec) in libdevel/libgcj6-dev ;; (/usr/lib/gcc-snapshot/lib/libgcj.spec) in universe/devel/gcc-snapshot. | 10:03 |
| odat | ok where do i put a bin file | 10:04 |
| clever | flonesaw_, -v alone wont give all of it | 10:04 |
| clever | you need maybe -vvvv | 10:04 |
| clever | each v causes it to give out a bit more info on each dev | 10:04 |
| flonesaw_ | I want to go to DCC chat. | 10:04 |
| h0nus | _jason, that worked for the libssh-0.11 (though the INSTALL file had no actual install instructions) but not for sap3r | 10:04 |
| pk2317_ | flonesaw_ is there a Ubuntu Wiki or something that would help us with this? | 10:04 |
| === lwelyn [n=lwelyn@p549A57CE.dip.t-dialin.net] has joined #ubuntu | ||
| pk2317_ | flonesaw_ we really just want the computer for web browsing and playing online game (i.e. java-based ones, not like doom and stuff) | 10:04 |
| odat | where do i put a bin file | 10:05 |
| _jason | j^son: install libgcj6-dev, it's one of the recommends for gcj. | 10:05 |
| flonesaw_ | pk2317_ - Accept my DCC chat request | 10:05 |
| _jason | odat: anywhere you want it? | 10:05 |
| pk2317_ | flonesaw_ as soon as it pops up | 10:05 |
| rappo | anyone having a problem with the ps/2 keyboard not working after booting to the login manager? | 10:05 |
| === theine [n=theine@fw2.nbi.dk] has joined #ubuntu | ||
| === Rdde [n=Rdde_@c-efa8e455.53-0004-74657210.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| pk2317_ | flonesaw_ im using IRC in trillian | 10:05 |
| flonesaw_ | pk2317_ - Hmmmm. I'll abort. Pls initiate DCC chat w/ me. | 10:06 |
| Kezzer | Does ANYONE know ANYTHING about installing a JDK on Ubuntu 5.10 (64-bit edition)? =( | 10:06 |
| bigmoe | please i have 2 netcards but no connection and they are configured and everything | 10:06 |
| _jason | Kezzer: does sun's site have a .bin? | 10:06 |
| bigmoe | can someone tell me what the problem could be?? | 10:06 |
| pk2317_ | flonesaw_ what's the IRC command for that, your name isn't showing up in my userlist | 10:06 |
| odat | _jason, i am trying to get ffmpeg2theora working i installed all the proper lib and downloaded the ffmpeg2theora binary and can't figure out where to put it | 10:07 |
| === Arnald [n=Arnald@81-86-116-102.dsl.pipex.com] has joined #ubuntu | ||
| Ven] n^ | guys, im trying to get scaling_governor to ondemand with boot.. how do i do that? | 10:07 |
| Kezzer | _jason, yes | 10:07 |
| Rdde | i think i have accedentely have change workgroup... my windows comp cant connect to the sambaserver... =( how can i change workgroup? | 10:07 |
| Kezzer | but I don't know how to install it as my *nix knowledge is next to none | 10:07 |
| _jason | odat: /opt sounds like a good place or /usr/local | 10:07 |
| flonesaw_ | pk2317_ - nevermind re: Chat. One thing you can do is to just run one app at a time. | 10:07 |
| _jason | ubotu: tell Kezzer about java | 10:07 |
| === Gyuszk [n=hangcsap@cm-222-135.kabelnet.hu] has joined #ubuntu | ||
| _jason | Kezzer: those same instructions /should/ work afaik | 10:07 |
| odat | _jason, not in /usr/bin ? | 10:08 |
| === kubuntu_ [n=admin@m815f36d0.tmodns.net] has joined #ubuntu | ||
| === syndicate [n=syndicat@dsl-145-196-122.telkomadsl.co.za] has joined #ubuntu | ||
| _jason | odat: well I would symlink to it in /usr/local/bin | 10:08 |
| pk2317_ | flonesaw_ it's mainly running different tabs in firefox, trying to play java games and say, email | 10:08 |
| === flohwer [n=flohwer@dslb-084-057-081-174.pools.arcor-ip.net] has joined #ubuntu | ||
| flonesaw_ | pk2317_ - Java is slow on *fast* machines. java is just plain inefficient. | 10:08 |
| pk2317_ | flonesaw_ it worked just fine on that computer with Win2K | 10:09 |
| h0nus | !gtk | 10:09 |
| Rdde | How do i change workgroup?? | 10:09 |
| ubotu | h0nus: parse error: Try searching at http://ubuntu.cc.com.au/ | 10:09 |
| nickrud | Kezzer, the latest stuff about java on amd64 is at https://wiki.ubuntu.com/JavaAMD64 | 10:09 |
| flonesaw_ | pk2317_ - E-mail should not be slow. | 10:09 |
| pk2317_ | flonesaw_ we're just trying to understand why linux is less effecient than windows | 10:09 |
| Auratus | what should my $KERNELPATH be set to? /usr/src/linux-`uname -r`? | 10:09 |
| flonesaw_ | pk2317_ - It shouldn't be. | 10:09 |
| kubuntu_ | i forgot to say thanks to whoever it was that helped me with my audio question. it works now! TX! =) | 10:09 |
| pk2317_ | flonesaw_ i agree, that's why we're confused | 10:09 |
| === ufo [n=ufo@dsl-hkigw2-fe1dde00-73.dhcp.inet.fi] has joined #ubuntu | ||
| === Stork [n=alex@storkey.plus.com] has joined #ubuntu | ||
| pk2317_ | flonesaw_ email isn't slow, but it slows down (to the point of non-functionality) the java game | 10:10 |
| === sxs [n=sxs1101@ip68-226-249-7.lf.br.cox.net] has joined #ubuntu | ||
| Stork | what's the difference between alsa and oss? | 10:10 |
| pk2317_ | flonesaw_ so we can't multitask | 10:10 |
| === noirequu1 [n=nalioth@cpe-24-28-118-174.houston.res.rr.com] has joined #ubuntu | ||
| nickrud | Stork, oss is the old, depreciated kernel sound system, alsa is it's replacement | 10:10 |
| flonesaw_ | pk2317_ - I suggest that you start a thread in the Ubuntu forums and see if you can get some help there. It'll take longer, but might serve you better. | 10:10 |
| pk2317_ | flonesaw_ ok, thanks a lot | 10:10 |
| Stork | nickrud, okay, thanks. | 10:11 |
| max_ | alsa is newer than OSS | 10:11 |
| LathropWells | alsa is better at sharing sound multip[le inputs with devices | 10:11 |
| pk2317_ | flonesaw_ we need to go get dinner anyways | 10:11 |
| flonesaw_ | pk2317_ - Y R most welcome | 10:11 |
| pk2317_ | flonesaw_ thank you SO MUCH for all your help! | 10:11 |
| === djm62 [n=djm62@82-40-136-135.cable.ubr08.uddi.blueyonder.co.uk] has joined #ubuntu | ||
| odat | _jason, y? | 10:11 |
| h0nus | !gtk+-2.0 | 10:11 |
| ubotu | h0nus: Syntax error in line 1. Try searching at http://ubuntu.cc.com.au/ | 10:11 |
| === pk2317_ [n=pk2317@cpe-24-33-236-216.insight.res.rr.com] has left #ubuntu [] | ||
| nickrud | Stork, oss emulation is available from alsa, sudo modprobe snd-pcm-oss (if it isn't already installed) | 10:11 |
| Enthusiast78 | LathropWells, Do you mean I can get VMware for free and run Ubuntu on it? | 10:11 |
| Ven] n^ | how to add modprobe speedstep-centrino so it runs with boot | 10:11 |
| === foooo- [n=tho@dslb-084-056-154-032.pools.arcor-ip.net] has joined #ubuntu | ||
| clever | i have a free win32 vmware but it would be horibly slow to wine a vm | 10:12 |
| === soc10path [n=soc10pat@216-177-163-74.block0.gvtc.com] has joined #ubuntu | ||
| === holycow [n=holycow@d209-89-245-197.abhsia.telus.net] has joined #ubuntu | ||
| LathropWells | Enthusiast78, - yes, another company from redmond washington has entered their market and you can try the disk image player for free, - you cannot make a system image without buyiong vmware | 10:13 |
| === kronoz [n=kronoz@ACD6135A.ipt.aol.com] has joined #ubuntu | ||
| === nick123 [n=nick@nat.kollegienet.dk] has joined #ubuntu | ||
| === djm62 [n=djm62@82-40-136-135.cable.ubr08.uddi.blueyonder.co.uk] has left #ubuntu [] | ||
| LathropWells | they provide a few images you can try. | 10:13 |
| syndicate | i need to manually type "sudo /etc/init.d/samba start | 10:13 |
| syndicate | " for my samba server to start. is there anyway i can get it to start on boot? | 10:13 |
| Enthusiast78 | LathropWells, What is this disk image player? | 10:14 |
| soc10path | syndicate check out ntsysv | 10:14 |
| syndicate | thanks soc10path | 10:14 |
| kingspawn | syndicate: you could install bum, or go to system->admin->services, maybe? | 10:14 |
| nick123 | having a problem here with 5.10, firefox 1.0.7 and some internet video streaming. The error I get is: "Totem could not play 'fd://0'." why I don | 10:14 |
| soc10path | not sure if ubuntu has it | 10:14 |
| LathropWells | let me find the link. it has benn a couple of months. | 10:14 |
| Stork | how come my libSDL file is ending with '.so.0.7.1' instead of just '.so' ? | 10:14 |
| === beruic [n=beruic@0x535fef0d.rdnxx4.adsl-dhcp.tele.dk] has joined #ubuntu | ||
| Kezzer | _jason, sudo apt-get install fakeroot java-package java-common that command doesn't work but I have the universe packages enabled in the repo | 10:14 |
| nick123 | dont know so I installed mplayer-plugin, but it seems to be ignored because of totem.. what can I do ? | 10:15 |
| syndicate | kingspawn, cool i'll try that | 10:15 |
| === ravice [n=ravice40@pool-71-241-148-227.nycmny.fios.verizon.net] has joined #ubuntu | ||
| _jason | odat: that's just how I would do it, keeps things cleaner imo | 10:15 |
| WiFi_Warri0r | what does it mean when ur rejected by racker?? | 10:15 |
| WiFi_Warri0r | :O | 10:15 |
| Auratus | where are the kernel sources located in ubuntu? | 10:15 |
| WiFi_Warri0r | first time this has happened | 10:15 |
| === alberto [n=alberto@cable94a180.usuarios.retecal.es] has joined #ubuntu | ||
| bigmoe | Ubugtu: please i have 2 netcards but no connection and they are configured and everything | 10:15 |
| _jason | Kezzer: you need multiverse as well iirc | 10:15 |
| nickrud | Kezzer, for amd64 , you need to use the blackdown java in multiverse to get a firefox plugin, plus java-package is buggy for amd64 | 10:15 |
| holycow | guys ... if i'm sshd in remotely, and wish to change the nic from dhcp to static ... i haveto reboot the machine right? there is no way to tell the nick to reset it self with new network settings? | 10:16 |
| bigmoe | Ubugtu: can someone tell me what the problem could be?? | 10:16 |
| beruic | How do I change tags on OGM-files? | 10:16 |
| === jleino [n=jleino@a84-231-31-184.elisa-laajakaista.fi] has left #ubuntu [] | ||
| soc10path | holycow /etc/init.d/network restart | 10:16 |
| unamerican | ll | 10:16 |
| Dyna-Work | anybody in here have any experience using ubuntu with mythtv and outputting to monitor+1080i tv? | 10:16 |
| WiFi_Warri0r | holycow: that is right | 10:16 |
| soc10path | holycow sudo /etc/init.d/network restart | 10:16 |
| === noteventime [n=tilo@h251n8c1o291.bredband.skanova.com] has joined #ubuntu | ||
| _jason | nickrud: he's trying to get the JDK. Know anything about that? (I don't so I just suggested trying what's on the restricted page) | 10:16 |
| holycow | doh! | 10:16 |
| Kezzer | nickrud, I'm don't need the plugin for firefox | 10:16 |
| noteventime | Does anyone know how to add a video clip to an impress presentation? | 10:16 |
| Kezzer | I'm developing in Java | 10:16 |
| beruic | How do I change tags on OGM-files? | 10:17 |
| noteventime | The official JDK is on the PLF repo | 10:17 |
| === lkd-efs [n=lkd-efs@cpc3-blfs6-0-0-cust45.belf.cable.ntl.com] has left #ubuntu [] | ||
| nickrud | Kezzer, doh, SDK. Don't do the java-package route, it's still buggy. see http://packages.qa.debian.org/j/java-package.html | 10:17 |
| === sublime [n=sublime@190.48.246.98] has joined #ubuntu | ||
| _jason | nickrud: for 64bit? | 10:17 |
| === lkd-efs [n=lkd-efs@cpc3-blfs6-0-0-cust45.belf.cable.ntl.com] has joined #ubuntu | ||
| _jason | that was meant for noteventime | 10:17 |
| === ateves [n=ateves@e176118065.adsl.alicedsl.de] has joined #ubuntu | ||
| === Mamelius [n=paolo@host81-210.pool8249.interbusiness.it] has joined #ubuntu | ||
| === marc_ [n=marc@d64-180-164-56.bchsia.telus.net] has joined #ubuntu | ||
| Kezzer | I'm looking for the 64-bit version of the JDK for the 64-bit edition of Ubuntu | 10:17 |
| soc10path | correct me if i'm wrong, but why bother running in 64 bit mode if you have less than 4gb of ram? (i have a athlon64) | 10:18 |
| Mamelius | hello friends | 10:18 |
| Kezzer | soc10path, no idea =) | 10:18 |
| Stork | soc10path, more bandwidth | 10:18 |
| === dpm_ [n=dpm@p54A10610.dip0.t-ipconnect.de] has joined #ubuntu | ||
| === BlueEagle [n=blueeagl@ti541210a080-1243.bb.online.no] has joined #Ubuntu | ||
| Mamelius | socmel | 10:18 |
| marc_ | I am having a problem with my sound, the drivers seem to have gotten messed up. How do I reload the drivers for a creative soundblaster live card? | 10:18 |
| CNAP | trappist: ok, hate to bother you again. i'm not pinging either 192.168.1.1 or this ip address of this machine. what does it look like that i'm configuring wrong here? | 10:18 |
| noteventime | _jason: I don't know | 10:18 |
| Kezzer | perhaps I can install the 32-bit version of Java? | 10:18 |
| === BlueEagl1 [n=blueeagl@ti541210a080-1243.bb.online.no] has joined #Ubuntu | ||
| Kezzer | It doesn't matter really | 10:18 |
| noteventime | _jason: I Guess | 10:18 |
| Kezzer | as long as it works =) | 10:18 |
| Stork | Kezzer, that's what i did | 10:18 |
| Stork | Kezzer, 32 bit java works fine for my on amd64-k8-smp | 10:18 |
| beruic | How do I change tags on OGM-files? | 10:18 |
| nickrud | Kezzer, yes, there's still a bug in java-package for 64-bit | 10:19 |
| === samuel [n=samuel@www.dingodile.net] has joined #ubuntu | ||
| Kezzer | Ah ok, I'd prefer to go the 32-bit route then if it's better | 10:19 |
| Kezzer | Stork, mind pointing me in the right direction? =) | 10:19 |
| Kezzer | is it simply a case of apt-get? | 10:19 |
| Stork | afraid not, i'm having enough problems trying to get quake4 working! :( | 10:19 |
| === blackrave [n=fossbab@ti400720a081-0810.bb.online.no] has joined #ubuntu | ||
| beruic | How do I change tags on OGM-files? | 10:19 |
| === xstation [n=xstation@135.196.183.142] has joined #ubuntu | ||
| Kezzer | Stork, do you have to use cedega for that? | 10:20 |
| soc10path | beruic what is an OGM-file | 10:20 |
| Stork | Kezzer, it's supported natively | 10:20 |
| DeMo_BR | I gave up the 64bit version... too much work and some stuff won't work :( | 10:20 |
| Stork | Kezzer, it's not too hard to run on 32-bit, but 64-bit requires some work | 10:20 |
| === HMR [n=ubuntu@hst-2-249.cisbg.com] has joined #ubuntu | ||
| beruic | soc10path: *.ogm = moviefile... | 10:20 |
| xstation | Xenguy: sorted out my problem from today | 10:20 |
| === noteventime [n=tilo@h251n8c1o291.bredband.skanova.com] has left #ubuntu ["Konversation] | ||
| Kezzer | So I may as well install the 32-bit version of Ubuntu? | 10:20 |
| Kezzer | I doubt it'd take me long to setup | 10:20 |
| === jaira [n=estudian@tdev253-216.codetel.net.do] has joined #ubuntu | ||
| LathropWells | nvidia-glx enables GL but not video acceleration. - how do i fix that? | 10:20 |
| === djeck [n=djeck@AStrasbourg-253-1-40-202.w86-213.abo.wanadoo.fr] has joined #ubuntu | ||
| Kezzer | Last install of Ubuntu took me about half an hour =) | 10:21 |
| marc_ | I am about this close to switching back to windows.... | 10:21 |
| Kezzer | and that was getting ATi stuff to work | 10:21 |
| beruic | soc10path: Video: Xvid+ffmpeg, sound: vorbis | 10:21 |
| soc10path | Kezzer less than 1% of the population would recognize the difference in performace of 32bit vs 64bit | 10:21 |
| Kezzer | I know | 10:21 |
| Kezzer | But I thought I'd try it out | 10:21 |
| soc10path | Kezzer 32 is better supported | 10:21 |
| === arrinmurr [n=arrinmur@MCDXL.tun.saunalahti.fi] has joined #ubuntu | ||
| soc10path | Kezzer doesn't hurt | 10:21 |
| Kezzer | Ok, I'll download it then =) | 10:21 |
| === Nolt [n=Nolt@aul190.internetdsl.tpnet.pl] has joined #ubuntu | ||
| beruic | soc10path: U know howto change the tags? | 10:22 |
| marc_ | CAN ANYONE HELP ME? | 10:22 |
| === fredforfaen [n=Morrari@216-132-165.0502.adsl.tele2.no] has joined #ubuntu | ||
| soc10path | beruic sorry, i don't know | 10:22 |
| djeck | hello | 10:22 |
| === shigs [n=shigs@81-179-121-96.dsl.pipex.com] has joined #ubuntu | ||
| soc10path | whatis your question marc_ | 10:22 |
| === NetGeek [n=dbasinge@stffp11-208.staff.library.utah.edu] has joined #ubuntu | ||
| === jowi [n=johan@bgn92-4-82-238-212-88.fbx.proxad.net] has joined #ubuntu | ||
| marc_ | my sound card stopped working, and I want to try reloading the drivers | 10:23 |
| jaira | hola | 10:23 |
| === atlas [n=atlas@84.5.39.52] has joined #ubuntu | ||
| === Ashura [n=Ashutto@adsl-ull-168-220.49-151.net24.it] has joined #ubuntu | ||
| marc_ | do you know how? | 10:23 |
| Ashura | Hello | 10:23 |
| frank23 | marc_: if someone can help you, they will. try dual boot. you don't have to switch to ubuntu instantly | 10:23 |
| atlas | hello | 10:23 |
| marc_ | ive been using ubuntu for months now | 10:23 |
| Nolt | hi | 10:23 |
| === jbaloul [n=jacob@mail.rrtechnologies.net] has left #ubuntu ["Kopete] | ||
| soc10path | marc_ what kind of soundcard | 10:23 |
| marc_ | but its starting to break down | 10:23 |
| xstation | is anyone running vmware or a type of | 10:23 |
| === curlyman [n=jonathan@oh-newphilly-ter1h-228.clvdoh.adelphia.net] has left #ubuntu [] | ||
| marc_ | creative audigy soundblaster 2 platnum ex | 10:24 |
| frank23 | marc_: and for sound problems crimsun is the guy to ask. He is the best for sound. | 10:24 |
| === soc10path [n=soc10pat@216-177-163-74.block0.gvtc.com] has left #ubuntu [] | ||
| === lkd-efs [n=lkd-efs@cpc3-blfs6-0-0-cust45.belf.cable.ntl.com] has left #ubuntu [] | ||
| jowi | * server | 10:24 |
| jowi | oops. sorry for that | 10:24 |
| === simonpca [i=simonpca@ts1-92.f1032.ts.globetrotter.net] has joined #ubuntu | ||
| Ashura | hello. I'm using Fedora core 4, i need to create a local mirror for the breezy packages repository to sync every night... is someone in there that could help me ? | 10:24 |
| === gye [n=gye@5-53-50.adsl.terra.cl] has joined #ubuntu | ||
| === simonpca [i=simonpca@ts1-92.f1032.ts.globetrotter.net] has left #ubuntu ["Je] | ||
| === sublime [n=sublime@190.48.246.98] has joined #ubuntu | ||
| blackrave | Does anyone know the system requirements for Ubuntu? | 10:25 |
| === lwelyn [n=lwelyn@p549A57CE.dip.t-dialin.net] has joined #ubuntu | ||
| === schloob [n=schloob@cpe-72-226-22-6.nycap.res.rr.com] has joined #ubuntu | ||
| beruic | blackrave: i run it on 600 mhz with 256 mb RAM | 10:26 |
| === jtkawa [n=jtkawa@netblock-66-245-215-125.dslextreme.com] has joined #ubuntu | ||
| === nworbnosaj [n=nworbnos@s2-9-rt-bras.ob.centurytel.net] has joined #ubuntu | ||
| === qwerty [n=qwerty@165.Red-81-32-59.dynamicIP.rima-tde.net] has joined #ubuntu | ||
| WiFi_Warri0r | beruic: does it run smoothly? | 10:26 |
| sfar | i ran it on a 300mhz.. | 10:26 |
| === GigaClon [n=gigaclon@68-191-5-012.dhcp.rdfr.va.charter.com] has joined #ubuntu | ||
| void^ | if you want to go below that you'll be better off using bare debian | 10:26 |
| qwerty | hello! | 10:27 |
| jowi | blacknight: well, as far as HDD space goes, 3gb is minimum. I would recommend 5-6gb to have some leverage. i've installed it on a P1 166 with 64 mb RAM (icewm) and it work great | 10:27 |
| schloob | does anyone know why rhythmbox wouldn't recognize mp3s as music files? i'm pretty sure i've got codecs installed.. (although totem doesn't play mp3's either).. it recognizes ogg's.. is there some sort of package i need? | 10:27 |
| Davey | if there any way to boost my volume higher than the Gnome UI allows? :) | 10:27 |
| marc_ | soc10path can you help me? | 10:27 |
| htrp | will it affect my uptime if I logout? | 10:27 |
| WiFi_Warri0r | how do i get the codec to play mp3 files?? | 10:27 |
| _jason | schloob: have you install gstreamer0.8-mad? | 10:27 |
| sfar | ubotu, tell schloob about mp3 | 10:27 |
| Auratus | ugh is anyone any good with the madwifi drivers, been working on this for like 2 days, and im running into nothing but problems. | 10:27 |
| === Avdi_ [n=Avdi@bos-gate3.raytheon.com] has joined #ubuntu | ||
| _jason | ubotu: tell WiFi_Warri0r about mp3 | 10:27 |
| WiFi_Warri0r | ty jason | 10:27 |
| schloob | _jason: yeah | 10:28 |
| htrp | will it affect my uptime if I logout? | 10:28 |
| beruic | WiFi_Warri0r: Well, I have 512 Ram now, and it's better. Now it's the processor that is too slow. I have to wait a little sometimes, but I love it. | 10:28 |
| _jason | schloob: you are using breezy? | 10:28 |
| xstation | anyone want to chat about vmware networking | 10:28 |
| Kezzer | Ok, I'm going to reinstall Ubuntu but the 32-bit version, the problem is that it may screw up my MBR on my Windows partition? Do you think it'd be a problem? | 10:28 |
| === greenacid [n=greenaci@p54994F86.dip.t-dialin.net] has joined #ubuntu | ||
| Auratus | ubotu, tell Auratus about madwifi | 10:28 |
| === me2win [n=Roberto@adsl-69-153-16-10.dsl.snantx.swbell.net] has joined #ubuntu | ||
| GigaClon | !windows | 10:28 |
| ubotu | GigaClon: Syntax error in line 1. Try searching at http://ubuntu.cc.com.au/ | 10:28 |
| void^ | htrp: no, uptime counts .. machine uptime. | 10:28 |
| schloob | _jason: nope, i'm using dapper | 10:28 |
| === HedgeMage [i=me@freenode/staff/HedgeMage] has joined #ubuntu | ||
| espresso | !suexec | 10:28 |
| ubotu | espresso: Wish I knew. Try searching at http://ubuntu.cc.com.au/ | 10:28 |
| holycow | *hmmm* | 10:28 |
| xstation | me2win: hi | 10:28 |
| _jason | schloob: dapper uses gstreamer 10, take a look at the wiki page that ubotu /msg'd you | 10:28 |
| me2win | sup xstation | 10:28 |
| === greenacid [n=greenaci@p54994F86.dip.t-dialin.net] has joined #ubuntu | ||
| blackrave | I have AMD K&-2 450 Mhz, 256 MB RAM, but only 4 GB hard drive and 8 MB video memory. | 10:29 |
| htrp | so if i logout, it still counts my machine uptime? | 10:29 |
| espresso | Where can I find suexec? | 10:29 |
| htrp | just don't reboot right? | 10:29 |
| _jason | schloob: also, if you have further problems with dapper, you should go to #ubuntu+1 | 10:29 |
| xstation | me2win kepping cool | 10:29 |
| beruic | WiFi_Warri0r: I used a 366 mhz 128 Ram Win 98SE before :P | 10:29 |
| === lkd-efs [n=lkd-efs@cpc3-blfs6-0-0-cust45.belf.cable.ntl.com] has joined #ubuntu | ||
| === painkiler [n=levi@203-206-113-4.dyn.iinet.net.au] has joined #ubuntu | ||
| sfar | Kezzer, it will "screw" the MBR.. but GRUB will take care of it | 10:29 |
| painkiler | how do i install deb packages? | 10:29 |
| schloob | _jason: yeah i'm looking at that page from the bot, this looks like what i need | 10:29 |
| espresso | .oO(please don't make me do a find!! I only have so many hours in the day!) | 10:29 |
| painkiler | ubotu: deb | 10:29 |
| holycow | do the ehternet interfaces when set on dhcp poll to renew their dhcp settings, say to make sure everything is fine when one reboots a router or changes some settings? | 10:29 |
| ubotu | To install a .deb file: sudo dpkg -i filename.deb (but note that the program you want might be installable using !apt from the !repos) | 10:29 |
| sfar | ubotu, tell Kezzer about grub | 10:29 |
| me2win | xstation, nice | 10:29 |
| marc_ | Anyone, please | 10:29 |
| nickrud | hey xstation you ever get anywhere with your boot issue? | 10:29 |
| xstation | mw2win: just installed a version of quem | 10:30 |
| marc_ | I need information on fixing a sound problem? | 10:30 |
| h0nus | !bz2 | 10:30 |
| ubotu | Wish I knew. Try searching at http://ubuntu.cc.com.au/, h0nus | 10:30 |
| jowi | Kezzer: it might. if you somehow want the windows MBR back you would need to correct it from the win-install CD (or the rescue tools). | 10:30 |
| === Ox0000 is now known as _eins | ||
| h0nus | what is the command to unpack a .bz2 file? | 10:30 |
| schloob | h0nus: bzip2? | 10:30 |
| nickrud | h0nus, tar xf <file> | 10:30 |
| h0nus | yes | 10:30 |
| h0nus | ty! | 10:30 |
| trappist | tar jxf filename.tar.bz2 if it'a a tarball. bunzip2 otherwise. | 10:31 |
| sfar | Kezzer, after i installed ubuntu.. grub came up when i booted and there i could select between win or ubuntu.. only thing is if you want to remove ubuntu later.. then you will need xp/2000-cd to fix mbr :) | 10:31 |
| schloob | h0nus: bzip2 -d blah, but if it's a tar file, tar -jxf blah | 10:31 |
| nickrud | h0nus, assuming there's a tar in there somewhere :) | 10:31 |
| trappist | nickrud: no | 10:31 |
| trappist | nickrud: you'd still need tar jxf | 10:31 |
| xstation | me2win: any networking experience | 10:31 |
| sfar | Kezzer, there is also software with wich you can backup your mbr | 10:31 |
| swab79 | I'm trying to get my scsi tape drive working (hp C1537A), dmesg shows all my scsi devices, but /proc/scsi/scsi shows no devices, and there are no tape devices in /dev .. any ideas? | 10:31 |
| me2win | xstation, basic | 10:31 |
| Kezzer | sfar, in either case, the MBR will still be present and the windows option should still be there | 10:32 |
| xstation | me2win: its like being in a hot place cant move in here | 10:32 |
| nickrud | trappist, last I looked, tar was smarter now | 10:32 |
| me2win | xstation, lol | 10:32 |
| schloob | _jason: i got it working now, thanks (and thanks to the bot too :)) | 10:32 |
| === schloob [n=schloob@cpe-72-226-22-6.nycap.res.rr.com] has left #ubuntu ["Bye"] | ||
| xstation | nickrud; hi solved my problem | 10:32 |
| sfar | Kezzer, grub will be in your MBR.. and in grub you can select OS yes :) | 10:32 |
| === harisund [n=harisund@ip24-255-87-152.br.br.cox.net] has joined #ubuntu | ||
| nickrud | xstation, what was it, wrong kernel reference from debian? | 10:32 |
| h0nus | what if it's a .tar without the .gz extension? | 10:32 |
| h0nus | <<<n00b | 10:33 |
| h0nus | =) | 10:33 |
| trappist | nickrud: by golly you're right! | 10:33 |
| === harisund [n=harisund@204.90.50.252] has joined #ubuntu | ||
| WiFi_Warri0r | anyone here willing to help me with mp3 problems goto #flood | 10:33 |
| trappist | h0nus: apparently you can just say tar xf whether it's a .tar, .tar.gz or .tar.bz2 | 10:33 |
| WiFi_Warri0r | ty | 10:33 |
| trappist | or presumable even .tar.Z | 10:33 |
| === suyog [n=suyog@58.65.221.239] has joined #ubuntu | ||
| blackrave | Is it impossible to get viruses or get hacked when using a UNIX OS? | 10:33 |
| === nestquick [n=nestoyeu@83-158-134-39.dsl.tiscali.fr] has joined #ubuntu | ||
| === merhojt [n=Jimmy@194-16-251-86.customer.telia.com] has joined #ubuntu | ||
| nickrud | trappist, found out by accident, another typo ;P | 10:33 |
| === nestquick [n=nestoyeu@83-158-134-39.dsl.tiscali.fr] has left #ubuntu ["Quitte"] | ||
| h0nus | trappist: o alright thx =) | 10:33 |
| trappist | blackrave: yes, but it's very unlikely to get a virus | 10:34 |
| WiFi_Warri0r | blackware: u can be hacked with any os, and their are very very few virii for nix | 10:34 |
| === thoffmeyer` [n=tim@unaffiliated/hoffy] has joined #ubuntu | ||
| xstation | nickrud: no idea heres what my plan is AS you know I Ahave quem and kuem installed bit like vmware well I am going to make ubuntu as big as possible and install sarge inside | 10:34 |
| Vspirit | I have 5.10 here, english qwerty keyboard layout, but I need to enter some Danish characters. is it possible to set it up so a special shortcut will result in a Danish character ? | 10:34 |
| nickrud | xstation, you must truly have a large X workstation ;) | 10:35 |
| xstation | nickrud: sorrey for being a little off colour | 10:35 |
| === thoffmeyer` is now known as thoffmeyer | ||
| harisund | blackrave, from what I have read and understood, in any Unix OS based OS, there is a heavy emphasis on users and root users, which typically means if you do get a virus, there is no way it can harm the system in any general way.. | 10:35 |
| xstation | nickrud only 40gigs to play with why not | 10:35 |
| === bigmoe [n=bigmoe@82.205.157.2] has joined #ubuntu | ||
| blackrave | Thanks for the answers. | 10:36 |
| beruic | Vspirit: Har du ikkke indstillet keyboardet til dansk? | 10:36 |
| xstation | nickrud: I will give gpatred a run for its money but its free | 10:36 |
| nickrud | xstation, sure, I was thinking memory. Those emulators are hogs: I experimented with qemu a while back on a 256M machine, I figure I'd need about 1.5G to be truly functional | 10:36 |
| === Profichilla [n=jakob@p548DAB91.dip0.t-ipconnect.de] has joined #ubuntu | ||
| xstation | nickrud: i have 780mb but yes I never though of that | 10:37 |
| harisund | Time for some humour I think, anybody here are system admins? Heard of BOFH? | 10:38 |
| xstation | nickrud; its the only way forward linux witnin linux sound ok sarge 3.1r | 10:38 |
| trappist | harisund: in #ubuntu-offtopic please | 10:38 |
| === Atlas [n=atlas@84.5.39.52] has joined #ubuntu | ||
| harisund | Oops sorry.. | 10:39 |
| harisund | Thought I was in that channel :-( | 10:39 |
| trappist | heh | 10:39 |
| === harisund [n=harisund@204.90.50.252] has left #ubuntu [] | ||
| nickrud | xstation, look at xen for running debian inside ubuntu, seems like the best bet | 10:39 |
| === berui1 [n=beruic@0x535fef0d.rdnxx4.adsl-dhcp.tele.dk] has joined #ubuntu | ||
| h0nus | question... if i'm downloading packages to my desktop and unpacking them there, then compiling them, do i need to save what i downloaded to the desktop? | 10:39 |
| xstation | nickrud: any other ideas that come to mind please? | 10:39 |
| trappist | xstation: usermode linux | 10:39 |
| nickrud | xstation, yeah, experiment & enjoy :) | 10:39 |
| === rsprio [n=rspiro@80.84.157.78] has joined #ubuntu | ||
| === geargolem [n=geargole@pool-72-72-128-72.hrbgpa.dsl-w.verizon.net] has joined #ubuntu | ||
| rsprio | Hello.. I've got a slight problem that stops me from using the dongle for more than 15mins or so or WPA. using the drivers ubuntu loads for it by default, I can't use wpa-supplicant and I have to do it all manually (that's just not practical) | 10:40 |
| xstation | nickrud; give me a bit more on xen please | 10:40 |
| rsprio | nd loading the windows drivers with ndiswrapper causes the dongle to die every so often | 10:40 |
| berui1 | Vspirit: Fandt du ud af det? | 10:40 |
| === kahn [n=kahn@bzq-88-153-104-33.red.bezeqint.net] has joined #ubuntu | ||
| === aramil [n=aramil@ppp69-adsl-150.ath.forthnet.gr] has joined #ubuntu | ||
| === Ogg`u [n=kamil@80.51.6.6] has joined #ubuntu | ||
| rsprio | any ideas please? | 10:41 |
| xstation | nickrud: only have three disks ubuntu sare and wait for it win xp on resue disk | 10:41 |
| rsprio | oh yea, and using wpa supplicant with wext doesn't work either | 10:41 |
| === `blink [n=blink@klik28.klik.bydgoszcz.pl] has joined #ubuntu | ||
| === SilverSpace_ [n=SilverSp@83-131-66-54.adsl.net.t-com.hr] has joined #ubuntu | ||
| xstation | sarge | 10:41 |
| === berui1 [n=beruic@0x535fef0d.rdnxx4.adsl-dhcp.tele.dk] has left #ubuntu [] | ||
| === jairavaldes [n=estudian@tdev253-216.codetel.net.do] has joined #ubuntu | ||
| === thoffmeyer [n=tim@unaffiliated/hoffy] has joined #ubuntu | ||
| === thingfish [n=mark@dialup-4.245.41.1.Dial1.StLouis1.Level3.net] has joined #ubuntu | ||
| === holobyted [i=holobyte@200.95.155.64.cableonline.com.mx] has joined #ubuntu | ||
| h0nus | is x11 compatible with gnome at all? | 10:43 |
| === soc10path [n=soc10pat@216-177-163-74.block0.gvtc.com] has joined #ubuntu | ||
| === flohwer [n=flohwer@dslb-084-057-081-174.pools.arcor-ip.net] has left #ubuntu ["...] | ||
| === evian [n=pat@6532190hfc198.tampabay.res.rr.com] has joined #ubuntu | ||
| aramil | hi | 10:44 |
| nickrud | xstation, wow, xen isn't in my dapper repos! there's https://wiki.ubuntu.com/XenVirtualMachine/XenOnUbuntuBreezy , the little I did with xen was in debian unstable | 10:44 |
| aramil | jesus it has never happened to me before..... | 10:44 |
| === bic [n=bic@byw66.internetdsl.tpnet.pl] has joined #ubuntu | ||
| aramil | Ubuntu went wild and started to open whatever i had my mouse one | 10:44 |
| aramil | on* | 10:44 |
| trappist | aramil: that's happened to me twice | 10:44 |
| stocksy | h0nus: gnome runs on top of X | 10:44 |
| stocksy | so yes | 10:44 |
| aramil | and when there was an adress bar or somewhere to write text it started to write tttttttttttttttttt | 10:45 |
| h0nus | hmmm | 10:45 |
| kahn | Hey, how can i set ubuntu to change language groups with LEFT alt+shift ? | 10:45 |
| xstation | nickrud: woo cant wait to grt there unstable smells real goood | 10:45 |
| h0nus | stocksy: i'm getting an error while compiling a program that says it cannot find FreeType, X11, or Win32 | 10:45 |
| nickrud | kahn, your options are in System-Preferenced-Keyboard tab Layout Optins | 10:46 |
| stocksy | what program? | 10:46 |
| h0nus | hydra | 10:46 |
| h0nus | the gtk | 10:46 |
| Stork | you know why i like linux the most? | 10:46 |
| kahn | nickrud, i could only set it to change on right alt+shift | 10:46 |
| Stork | because it's a challenge | 10:46 |
| h0nus | ^^^ | 10:46 |
| Nolt | =] | 10:46 |
| aramil | ^^ | 10:46 |
| aramil | yes it is | 10:46 |
| Stork | i just love trying to hack together quake4 working on 32-bit | 10:46 |
| Stork | it's a weird sort of thrill | 10:47 |
| Vspirit | beruic: ahh, jeg var lige ovre paa den anden maskine. | 10:47 |
| stocksy | h0nus: ok, I don't know what that is, but you probably just need the headers for X11 | 10:47 |
| === Gyuszk is away: Almos lettem, vagy mittom. :) | ||
| nickrud | kahn, you could do some research on xkb (that's where the keyboard defs are) but it seems like latin to me :) | 10:47 |
| Stork | installing i386 packages on my 64-bit kernel :D | 10:47 |
| === ic56 [n=ic@CPE0080c6e96fe2-CM000a73a108f3.cpe.net.cable.rogers.com] has joined #ubuntu | ||
| kahn | ok, thank you | 10:47 |
| === Laney [n=laish@81-179-198-219.dsl.pipex.com] has joined #ubuntu | ||
| xstation | nickrud must go thanks for info | 10:47 |
| h0nus | stocksy: do you know if i can get them with a simple apt-get? | 10:47 |
| === casey [n=casey@68.191.32.128] has joined #ubuntu | ||
| nickrud | xstation, yw, see you around | 10:47 |
| === ombromanto81 [n=guido@host156-232.pool80183.interbusiness.it] has joined #ubuntu | ||
| Nolt | Stork: and its your challange ? | 10:47 |
| Nolt | lol | 10:47 |
| === xstation [n=xstation@135.196.183.142] has left #ubuntu [] | ||
| stocksy | i think so, I'll check... | 10:47 |
| casey | Hey hey. | 10:48 |
| h0nus | stocksy: thanks man | 10:48 |
| Stork | Nolt, hm? | 10:48 |
| Gyuszk | Gy|off jo ejt | 10:48 |
| Gyuszk | Gy|off mostmar alszok | 10:48 |
| Gyuszk | Gy|off csacs | 10:48 |
| === aciidboot3r [n=aciidboo@217-60-38.0509.adsl.tele2.no] has joined #ubuntu | ||
| Vspirit | beruic: det er en maskine der er koebt i england, saa der er ikke danske taster. men jo hvis jeg saetter det til dansk tastatur faar jeg ae oe aa, men saa er resten af keyboardet forskellig fra hvad der staar paa tasterne. | 10:48 |
| === aciidboot3r [n=aciidboo@217-60-38.0509.adsl.tele2.no] has left #ubuntu ["Forlater] | ||
| Nolt | Stork: bout your challanges ^^ instaling i386 on 64 platform lol whata challange | 10:48 |
| Stork | yeah, true | 10:48 |
| blackrave | 10:48 | |
| Nolt | try compile some programs by yourself good programs or write somthin from 0 | 10:49 |
| Nolt | this is challange | 10:49 |
| Storkme | Nolt, i have, i'm a pretty good java developer | 10:49 |
| Vspirit | beruic: so I'm looking for instructions on how to specify my own shortcuts to write special characters such as the special danish letters. | 10:49 |
| stocksy | h0nus: a slight shot in the dark here, but try apt-get install libx11-dev | 10:49 |
| === _harm [n=harm@82-171-74-86.dsl.ip.tiscali.nl] has joined #ubuntu | ||
| Keleksi | how i can download the newest GNOME? | 10:49 |
| Nolt | show me if u have some your presentations | 10:49 |
| === karl_ [n=travis@207.53.228.63] has joined #ubuntu | ||
| _harm | where is konqeuror installed /usr/lib/? or where? | 10:49 |
| h0nus | apt-get install libx11-dev | 10:50 |
| h0nus | kk | 10:50 |
| _harm | Keleksi go to synapatic and update | 10:50 |
| Keleksi | ok | 10:50 |
| Nolt | Stork ? | 10:50 |
| === usuario4 [n=usuario4@201.247.94.159] has joined #ubuntu | ||
| === stove [n=stove@ip70-177-210-60.hr.hr.cox.net] has joined #ubuntu | ||
| Storkme | Nolt, i don't make presentations :) i just hack it all together :) | 10:51 |
| Nolt | hack it ;] | 10:51 |
| === silvaran [n=silvaran@131.202.90.23] has joined #ubuntu | ||
| Nolt | so show me your arts or somghin what u made by yourself in java | 10:51 |
| Stork | i don't care, as long as it works & is without mem leaks, etc | 10:51 |
| Stork | okay | 10:51 |
| === Karina17 [n=Karina17@3-135-222-201.adsl.terra.cl] has joined #ubuntu | ||
| h0nus | stocksy: that worked thx! | 10:52 |
| nickrud | _harm, dpkg -L konqueror | grep bin | 10:52 |
| Stork | Nolt, http://storkey.plus.com:5120/ the server is 100% java, and all of it done by me, based on a servlet system. | 10:52 |
| === Marvolo_ [i=1000@80.50.253.90] has joined #ubuntu | ||
| stocksy | no probs :) | 10:52 |
| === noirequu1 is now known as noirequus | ||
| === david_ [n=david@reserve-64-79-114-137.wiline.com] has joined #ubuntu | ||
| _harm | nickrud.. that does what -L for list location and grep bin = ? | 10:53 |
| === Marvolo_ [i=1000@80.50.253.90] has left #ubuntu [] | ||
| Dyna-Work | Stork, your page doesnt seem to want to load for me :P | 10:53 |
| WiFi_Warri0r | There were no decoders found to handle the stream, you might need to install the corresponding plugins | 10:53 |
| WiFi_Warri0r | what is that? | 10:53 |
| WiFi_Warri0r | why cant i play mp3's i followed all the instruction abotu gave me | 10:54 |
| _harm | u need codecs WiFi_Warri0r | 10:54 |
| Nolt | Stork: nothing loads | 10:54 |
| WiFi_Warri0r | for the repositroies | 10:54 |
| nickrud | _harm, the -L lists all the files in the package, and the grep limits the display to any files in a bin directory (where executables are found) | 10:54 |
| === unlear [n=unlear@58.82.162.55] has joined #ubuntu | ||
| Nolt | k nvm :) | 10:54 |
| WiFi_Warri0r | i asked where to get codedc earlier and they told me to fix repositories | 10:54 |
| _harm | nickrud ill try now :D | 10:54 |
| WiFi_Warri0r | where do i get codecs? | 10:54 |
| === Josh43 [n=ubuntu@S0106000c419e9f0d.ed.shawcable.net] has joined #ubuntu | ||
| Nolt | lil bit lazy this your java serwer | 10:54 |
| GigaClon | !repos | 10:54 |
| ubotu | To enable Universe and Multiverse see http://wiki.ubuntu.com/AddingRepositoriesHowto - Official sources.lists here: http://paste.ubuntu-nl.org/6047 (Breezy) or http://paste.ubuntu-nl.org/6666 (Dapper) see also !easysource | 10:54 |
| Nolt | server* | 10:54 |
| unlear | 10:54 | |
| === sociopath [n=user@net34-155.netkaster.ca] has joined #ubuntu | ||
| GigaClon | !jp | 10:55 |
| ubotu | GigaClon: I haven't a clue, try searching at http://ubuntu.cc.com.au/ | 10:55 |
| _jason | ubotu: tell WiFi_Warri0r about mp3 | 10:55 |
| david_ | can somebody help me with azureus | 10:55 |
| WiFi_Warri0r | jason: i folowed those instruction already | 10:55 |
| WiFi_Warri0r | the repo's are fixed | 10:55 |
| _jason | ubotu: tell david_ about azureus | 10:55 |
| redguy | !tell david_ about azureus | 10:55 |
| WiFi_Warri0r | i added them to multiverse | 10:55 |
| redguy | darn | 10:55 |
| Stork | sorry Nolt, Dyna-Work, the port forwarding is wrong. it works now :) | 10:55 |
| === noirequus is now known as nalioth | ||
| _jason | WiFi_Warri0r: do you have dapper or breezy? | 10:55 |
| h0nus | how do i remove an older version of glib? | 10:55 |
| Josh43 | Can anyone please help with my ubuntu install: I increased the home partition (moving /boot back), and now all I get when I boot is "GRUB" | 10:55 |
| === marc_ [n=marc@d64-180-164-56.bchsia.telus.net] has joined #ubuntu | ||
| WiFi_Warri0r | breezy | 10:55 |
| === marc_ [n=marc@d64-180-164-56.bchsia.telus.net] has left #ubuntu ["Leaving"] | ||
| _jason | WiFi_Warri0r: and you installed gstreamer0.8-mad then? | 10:55 |
| GigaClon | !restricted | 10:56 |
| ubotu | well, restricted is https://wiki.ubuntu.com/RestrictedFormats Most of the formats listed here can be replaced by !FreeFormats | 10:56 |
| === marc__ [n=marc@d64-180-164-56.bchsia.telus.net] has joined #ubuntu | ||
| Dyna-Work | Stork, where can i get this man? | 10:56 |
| === Toadstool is now known as ToadZzZztool | ||
| WiFi_Warri0r | it couldnt find it at the spot the instructions said | 10:56 |
| _harm | nickrud didnt work iam trying to install flas and its asking me the installation path | 10:56 |
| Dyna-Work | is this for playing mp3s over the network? | 10:56 |
| WiFi_Warri0r | root@ubuntu:~# sudo apt-get install gstreamer0.8-mad | 10:56 |
| WiFi_Warri0r | Reading package lists... Done | 10:56 |
| WiFi_Warri0r | Building dependency tree... Done | 10:56 |
| WiFi_Warri0r | Package gstreamer0.8-mad is not available, but is referred to by another package. | 10:56 |
| WiFi_Warri0r | This may mean that the package is missing, has been obsoleted, or | 10:56 |
| WiFi_Warri0r | is only available from another source | 10:56 |
| WiFi_Warri0r | E: Package gstreamer0.8-mad has no installation candidate | 10:56 |
| WiFi_Warri0r | root@ubuntu:~# | 10:56 |
| WiFi_Warri0r | yeah mp3's over a network | 10:56 |
| GigaClon | !paste | 10:56 |
| ubotu | Don't flood the channel! Please use the pastebin at http://paste.ubuntu-nl.org/ or the channel #flood to paste large amount of text. | 10:56 |
| WiFi_Warri0r | yes | 10:56 |
| === Mystery47_newbie [n=janne@213.130.238.141] has joined #ubuntu | ||
| david_ | k thanks | 10:56 |
| Ven] n^ | my cpu dynamic scaling is resetting itself back to "performance" if i unplug the power cable and insert it again.. any ideas? | 10:56 |
| Mystery47_newbie | Hi all.... | 10:56 |
| _jason | WiFi_Warri0r: then repositories are not fixed... please don't paste here, use http://paste.ubuntu-nl.org/ . Can you paste /etc/apt/sources.list and give us a url? | 10:56 |
| Nolt | Stork:not bad nice one :) | 10:57 |
| Stork | Dyna-Work, i wrote it myself. it's exactly for playing mp3's over the internet, LAN, etc. | 10:57 |
| Dyna-Work | Stork: can i download your app somewhere? | 10:57 |
| Stork | Dyna-Work, Nolt, it's a work in progress | 10:57 |
| nickrud | _harm, I'm not sure what flas is, for one, and 'installation dir' is very amorphous | 10:57 |
| Mystery47_newbie | Can someone help me with fonts?(truetype or else) | 10:57 |
| Dyna-Work | none the less, i'd like to try it out :) | 10:57 |
| Stork | Dyna-Work, if you're looking for something like this, check out gnump3d. it's basically the same thing | 10:57 |
| Dyna-Work | it looks like exactly what ive been looking for for a while | 10:57 |
| Mystery47_newbie | how can i install more fonts on machine...? | 10:57 |
| _jason | ubotu: tell Mystery47_newbie about fonts | 10:57 |
| redguy | Stork: do you provide the source? | 10:57 |
| _harm | nickrud flash7 is what iam installing =] and its asking where konqeurer is installed | 10:57 |
| Nolt | redguy: hi man =] | 10:58 |
| WiFi_Warri0r | jason: one sec. ill get u the url | 10:58 |
| Stork | redguy, it's not finished yet :) | 10:58 |
| Mystery47_newbie | i just found directory /usr/share/fonts | 10:58 |
| nickrud | _harm, just install flashplayer-mozilla from the repos, that's 7.0.25 iirc | 10:58 |
| Mystery47_newbie | does it work like in ms? | 10:58 |
| _harm | thank you | 10:58 |
| redguy | Nolt: hi there, anyways, I am starting to thing that this java conversation with Stork and Dyna-Work belongs in #ubuntu-offtopic :-) | 10:58 |
| nickrud | _harm, it's set up to work with konqueror | 10:58 |
| Dyna-Work | Stork: i like the looks of yours better than gnump | 10:58 |
| === anstei_ [n=anstei@adsl-84-226-50-222.adslplus.ch] has joined #ubuntu | ||
| Nolt | hehe | 10:59 |
| === bouvittel [n=bouvitte@dslb-084-056-141-038.pools.arcor-ip.net] has joined #ubuntu | ||
| === a4akb [i=a4akb@ask13-30.qualitynet.net] has joined #ubuntu | ||
| Dyna-Work | gnump looks too....IE 2.0 | 10:59 |
| === TSCHAK2 [n=thomas@24-53-91-155.clspco.adelphia.net] has joined #ubuntu | ||
| === bouvittel [n=bouvitte@dslb-084-056-141-038.pools.arcor-ip.net] has left #ubuntu ["Verlassend"] | ||
| === rappo [n=ozma@cpe-24-193-239-76.ucwphilly.res.rr.com] has left #ubuntu [] | ||
| === a4akb [i=a4akb@ask13-30.qualitynet.net] has left #ubuntu [] | ||
| Nolt | hehe | 10:59 |
| Stork | Dyna-Work, i very much appreciate the compliments but it isn't ready for distribution yet | 10:59 |
| redguy | Stork: yeah, I think it's pretty slick too, that's why I asked about the source | 10:59 |
| Dyna-Work | its ok, im just saying | 10:59 |
| redguy | Stork: but you promise to make it open source? | 10:59 |
| Stork | of course | 11:00 |
| Josh43 | Can anyone please help with my ubuntu install: I increased the home partition (moving /boot back), and now all I get when I boot is "GRUB" | 11:00 |
| Dyna-Work | Stork: given this reaction, you should probably have a devel-list or something | 11:00 |
| Stork | what's a devel list? | 11:00 |
| === pampel [n=pampel@pD95368EA.dip.t-dialin.net] has joined #ubuntu | ||
| caglar | which VoIP software do you use? | 11:00 |
| WiFi_Warri0r | jason: r u in #flood | 11:00 |
| caglar | something better than ekiga? | 11:00 |
| Dyna-Work | like a mailing list for people interested | 11:00 |
| _harm | nickrud thank u | 11:00 |
| Jhair | caglar: skype | 11:00 |
| _jason | WiFi_Warri0r: it's easier to read if you use http://paste.ubuntu-nl.org/ please | 11:00 |
| redguy | Josh43: hmm does that mean that you moved the /boot partition? | 11:01 |
| nickrud | _harm, yw | 11:01 |
| marc__ | Looking for help! | 11:01 |
| WiFi_Warri0r | ok | 11:01 |
| redguy | !tell marc__ about ask | 11:01 |
| Mystery47_newbie | ok....i just got help....thanks ppl..:) | 11:01 |
| caglar | Jhair: skype isn't compatible with other SIP providers, is it? | 11:01 |
| Josh43 | redguy: Yes, moved it back on the disk; didn't resize or change the order of disks | 11:01 |
| Josh43 | caglar: No | 11:01 |
| Jhair | caglar: AFAIK no | 11:02 |
| === jonshea____ [n=jonshea@129.170.234.107] has joined #ubuntu | ||
| Stork | Dyna-Work, sounds good. pm me your email address, i'll make a devel list :) i should be finished with the code this weekend, then i'll work on some documentation | 11:02 |
| redguy | Josh43: doesn't matter. AFAIK GRUB writes the sector of the grub's root partition in it's MBR code | 11:02 |
| marc__ | redguy I need help with my sound card. It stopped working all of a sudden, tried restart, checked hardware-all good, looks like a driver problem. What should I do. | 11:02 |
| Dyna-Work | Stork: if you ever need any help testing, let me know ive got about 370 gb of mp3s | 11:02 |
| === thoffmeyer [n=tim@unaffiliated/hoffy] has joined #ubuntu | ||
| Stork | holy god, really? | 11:02 |
| redguy | marc__: check all of your mixers | 11:03 |
| Josh43 | redguy: Damn - is there any way to repair it from my livecd? | 11:03 |
| === rikai [i=rikai@pool-72-65-106-235.ptldme.east.verizon.net] has joined #ubuntu | ||
| redguy | Josh43: sure | 11:03 |
| _jason | Dyna-Work: 370gb, that is impressive | 11:03 |
| Stork | and i thought my 3.6gb collection was impressive :D | 11:03 |
| marc__ | redguy allready did | 11:03 |
| Dyna-Work | yeah | 11:03 |
| Dyna-Work | 3900 some odd albums | 11:03 |
| Stork | :O | 11:04 |
| redguy | marc__: hmm, nothing else pops into my mind, maybe someone else might have a solution for you | 11:04 |
| redguy | Josh43: wait a sec, gonna check the options for grub-install | 11:04 |
| marc__ | I need help with my sound card. It stopped working all of a sudden, tried restart, checked hardware-all good, looks like a driver problem. What should I do. | 11:04 |
| Dyna-Work | that was the major problem with browsing it over the web interfaces ive tried, they all seem to choke giving a directory listing | 11:04 |
| === TheFuzzball [n=TheFuzzb@212.32.120.168] has joined #ubuntu | ||
| === lwelyn [n=lwelyn@p549A57CE.dip.t-dialin.net] has joined #ubuntu | ||
| === scotty|busy [n=chatzill@70-41-128-25.cust.wildblue.net] has joined #ubuntu | ||
| === Petecakes [i=Pete@unaffiliated/petecakes] has joined #ubuntu | ||
| TheFuzzball | can someone help me with something? | 11:05 |
| nickrud | !someone | 11:05 |
| ubotu | probably 90% of the first questions asked in this channel start with "Does anyone/anybody..." Why not ask your next question (the real one) and find out? <hint> | 11:05 |
| === mrtwister|mobile [n=andrius@cable-10-68.cgates.lt] has joined #ubuntu | ||
| h0nus | lol i need help again | 11:05 |
| h0nus | http://paste.ubuntu-nl.org/11122 | 11:06 |
| redguy | TheFuzzball: you could'n ask a worse question | 11:06 |
| TheFuzzball | :) | 11:06 |
| TheFuzzball | lol | 11:06 |
| trappist | yeah that's gonna be tough to beat | 11:06 |
| === Laney [n=laish@81-178-71-59.dsl.pipex.com] has joined #ubuntu | ||
| h0nus | can't figure out why a newer version of glib is bad | 11:06 |
| Petecakes | Getting an error during boot: "/bin/sh: can't access tty; job control turned off". Any ideas how to fix this? I've already asked in #kubuntu and I was told to try here (I'm running Kubuntu 5.10) | 11:06 |
| === gggg__ [n=kt@84.205.236.101] has joined #ubuntu | ||
| Josh43 | redguy - thank you, I'll wait | 11:06 |
| === serengeti [n=slawek@host-86-63-138-97.pronet.lublin.pl] has joined #ubuntu | ||
| redguy | trappist: hi, something is wrong with something. will anybody help somebody? | 11:07 |
| _jason | WiFi_Warri0r: everything ok? | 11:07 |
| marc__ | figured it out | 11:07 |
| trappist | h0nus: sudo apt-get install libglib2.0-dev | 11:07 |
| trappist | redguy: ooh you win! | 11:07 |
| redguy | \o/ | 11:07 |
| === gabriel [n=gabriel@d54C3467D.access.telenet.be] has joined #ubuntu | ||
| stocksy | Petecakes: what does it complain about before it drops you to a shell? | 11:08 |
| TheFuzzball | ok, I'll ask a better question, when I start my computer the net is down (this is because it is not using ra9 as the default gateway), I have to run sudo network-admin and deactivate the wireless card, and then activate it again, then the net comes up, how do I get it to work when I start my comp? | 11:08 |
| TheFuzzball | ra0* | 11:08 |
| Petecakes | stocksy; 2 seconds, I'll just go check. | 11:08 |
| h0nus | trappist: even though i already have a newer version?? | 11:08 |
| === gabriel [n=gabriel@d54C3467D.access.telenet.be] has left #ubuntu ["Leaving"] | ||
| === LOQUiLLO_ [i=LOQUILLO@201.240.61.213] has left #Ubuntu ["Leaving"] | ||
| === Lane [n=laish@81-178-71-59.dsl.pipex.com] has joined #ubuntu | ||
| h0nus | trappist: i have 2.7.1 installed | 11:09 |
| trappist | h0nus: you probably don't have the headers installed, in which case you need the package I mentioned | 11:09 |
| soc10path | TheFuzzball whatis ra0? your wifi card? | 11:09 |
| h0nus | ahh | 11:09 |
| TheFuzzball | yea | 11:09 |
| h0nus | trappist: thank you =) | 11:09 |
| soc10path | TheFuzzball is this a laptop? | 11:09 |
| === zukero [i=1007@ulysse2.emn.fr] has joined #ubuntu | ||
| TheFuzzball | yes | 11:09 |
| redguy | Josh43: are you running the livecd now? | 11:10 |
| trappist | h0nus: when something fails to compile because something is missing, the package you want is (almost) always a -dev package | 11:10 |
| soc10path | TheFuzzball why not boot w/out the wifi card, insert it after you boot? what does that do? | 11:10 |
| === Njal [n=Njal@cpc5-stkn5-0-0-cust703.midd.cable.ntl.com] has joined #ubuntu | ||
| TheFuzzball | nothing | 11:10 |
| redguy | Josh43: open a terminal, type sudo -i, which makes you root | 11:10 |
| Njal | Does anyone know about the status of broadcom and dapper? | 11:10 |
| RMeist | man sudo | 11:10 |
| soc10path | TheFuzzball the problem is the default gateway is incorrect on boot? | 11:10 |
| === nworbnosaj [n=nworbnos@s2-9-rt-bras.ob.centurytel.net] has joined #ubuntu | ||
| === CallMeAl [n=apuzzuol@68.41.20.163] has joined #ubuntu | ||
| Josh43 | redguy: Yes, livecd on the system | 11:11 |
| trappist | Njal: broadcom what? | 11:11 |
| h0nus | trappist: that will help TONS =P | 11:11 |
| === ploom [n=ploom@84-50-157-3-dsl.est.estpak.ee] has joined #ubuntu | ||
| redguy | Josh43: then mount the partition which holds the root filesystem to /mnt | 11:11 |
| Njal | broadcom wireless driver | 11:11 |
| redguy | Josh43: still with me? | 11:11 |
| Njal | the 43xx | 11:11 |
| Njal | I have the fwcutter | 11:11 |
| TheFuzzball | so how do I make it correct on boot? | 11:12 |
| Josh43 | redguy; yep, one sec while I confirm the right partition ;) | 11:12 |
| redguy | k | 11:12 |
| === CallMeAl [n=apuzzuol@68.41.20.163] has left #ubuntu [] | ||
| Njal | and have tracked down the file with the firm ware in it | 11:12 |
| === _zippy_ [n=zippy@201.21.158.82] has joined #ubuntu | ||
| === anstei_ is now known as anstei | ||
| === redguy is now known as Kacz | ||
| RMeist | echo `uptime | grep days | sed 's/.*up \([0-9] *\) | 11:12 |
| RMeist | day.*/\1\/10+/'; cat /proc/cpuinfo|grep '^cpu MHz'|awk '{print | 11:12 |
| RMeist | $4"/30 +";}';free|grep '^Mem'|awk '{print $3"/1024/3+"}'; df -P | 11:12 |
| RMeist | -k -x nfs | grep -v 1k | awk '{if ($1~ "/dev/(scsi|sd)"){ s+= | 11:12 |
| RMeist | $2} s+= $2;} END {print s/1024/50"/15+70";}'`|bc|sed | 11:12 |
| RMeist | 's/\(.$\)/.\1cm/' | 11:12 |
| h0nus | trappist: that didn't fix my problem though =( | 11:12 |
| === Kacz is now known as redguy | ||
| trappist | RMeist: don't paste here. | 11:12 |
| Njal | would i have the problem of rebooting an finding out i need to install 'make' but can't coz no internet access? | 11:12 |
| === CallMeAl [n=apuzzuol@68.41.20.163] has joined #ubuntu | ||
| soc10path | TheFuzzball so, you have 2 nics, one wifi and one 10/100 and it's trying to use the 10/100 as the default net interface? | 11:12 |
| === loz [n=loz@84.7.77.87] has joined #ubuntu | ||
| CNAP | if i can only register to 1 port with 1 MAC address, does anyone know if doing ICS will bypass this problem? | 11:12 |
| Josh43 | redguy: Done; hda2 | 11:13 |
| loz | hello everbody! | 11:13 |
| redguy | Josh43: ok, is it mounted? | 11:13 |
| === fredrich [n=fredrich@c-b964e155.44-7-64736c10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| Josh43 | redguy: Yes, /mnt/hda2 | 11:13 |
| === SilverSpace_ [n=SilverSp@83-131-66-54.adsl.net.t-com.hr] has joined #ubuntu | ||
| === Tiberian [n=DMT@ppp3-adsl-1-83.the.forthnet.gr] has joined #ubuntu | ||
| === scotty|busy [n=chatzill@70-41-128-25.cust.wildblue.net] has joined #ubuntu | ||
| === HedgeMage is now known as HedgeMag | ||
| CallMeAl | Anyone here using Dapper under VMware for windows and having sound issues? | 11:13 |
| === HedgeMag is now known as HedgeMage | ||
| Njal | i was just reading the forums and it said dapper can't distrobute the firmware, but having a valid OSX installation i can copy this onto a pen drive and move it into the live CD system | 11:14 |
| redguy | Josh43: is the /boot partition mounted as well? If yes unmount it | 11:14 |
| === foooo- is now known as mr_lampe | ||
| === topyli [n=juha@dsl-hkigw3-fe23de00-139.dhcp.inet.fi] has joined #ubuntu | ||
| ab0rted | CallMeAl what sound card do you have? | 11:14 |
| === scotty|busy [n=chatzill@70-41-128-25.cust.wildblue.net] has left #ubuntu [] | ||
| loz | Hello to all, has anybody encoutered this problem: i seem to have los all control on my terminal, i can't even become sudo, any ideas anyody? | 11:14 |
| Tiberian | Hi guys, how do i remove apache/php/mysql ? | 11:14 |
| redguy | Josh43: now do chroot /mnt/hda2 /bin/bash | 11:14 |
| redguy | Josh43: now the hda2 will be the root | 11:15 |
| Josh43 | redguy: I have /boot as a dir (livecd), and the origional /boot is /mnt/hda2 | 11:15 |
| ab0rted | loz what did you do before that problem occur? | 11:15 |
| redguy | Josh43: hmm | 11:15 |
| TheFuzzball | no, when I run sudo network-admin the field that has the deafult gateway in it is empty | 11:15 |
| === Seikima [n=Seikima@cpe-24-28-82-58.austin.res.rr.com] has joined #ubuntu | ||
| loz | i pressed ctrl c | 11:15 |
| redguy | Josh43: so you don't have a separate /boot partition? | 11:15 |
| Njal | so it it possible? | 11:15 |
| loz | inside the terminal | 11:15 |
| === FliesLikeALap [n=Ryan@goldenrod-29.dynamic2.rpi.edu] has joined #ubuntu | ||
| === SilverSpace_ [n=SilverSp@83-131-66-54.adsl.net.t-com.hr] has left #ubuntu [] | ||
| ab0rted | loz ctrl c will only stop the terminal from performing what it was doing | 11:16 |
| redguy | Josh43: or do you have one partition for / and another for /boot ? | 11:16 |
| Josh43 | redguy: Ok, what I should have is / mounted in /mnt and /boot not mounted? | 11:16 |
| loz | yeah i know | 11:16 |
| === na7e [n=na7e@205.213.122.126] has joined #ubuntu | ||
| Josh43 | redguy: Yes, one for each | 11:16 |
| ab0rted | loz have you restarted the terminal? | 11:16 |
| TheFuzzball | can I edit the network-admin config file so it is always using ra0? | 11:16 |
| redguy | Josh43: you are right | 11:16 |
| CNAP | if i my ISP will only allow 1 MAC address per port, does anyone know if using ICS will bypass this and allow more than 1 computer per port? | 11:16 |
| loz | how do i do that | 11:16 |
| === UltraZ [n=subflame@85.204.137.15] has joined #ubuntu | ||
| loz | i've rebooted sevral times | 11:16 |
| ab0rted | loz type exit | 11:16 |
| === metho [n=metho@dsl-217-155-192-10.zen.co.uk] has joined #ubuntu | ||
| === CallMeAl [n=apuzzuol@68.41.20.163] has left #ubuntu [] | ||
| Josh43 | redguy: Ok, one min | 11:16 |
| trappist | CNAP: what do you mean by port | 11:16 |
| ab0rted | loz then start a new terminal setion | 11:16 |
| === paddee [n=paddee28@cpc4-scun4-5-0-cust245.nott.cable.ntl.com] has joined #ubuntu | ||
| redguy | Josh43: we will mount the /boot partition from the chrooted environment | 11:17 |
| loz | ok i'll give it a wizz | 11:17 |
| Petecakes | stocksy; http://ubuntu.pastebin.com/631510 is what I get before the error, if that's any help. | 11:17 |
| Dyna-Work | CNAP: any gateway hides what its doing on the other side | 11:17 |
| Auratus | lol wow i hate madwifi | 11:17 |
| trappist | Dyna-Work: the gateway mangles the source ip address, but not the mac address | 11:17 |
| loz | loz@funbox:~$ exit | 11:17 |
| loz | that's waht i get | 11:17 |
| loz | it does n't repond | 11:17 |
| CNAP | dyna-work: that's what i'm thinking. i finally connected using the ICS that "trappist" gave me, but it's still saying that computer is denied access to the internet | 11:17 |
| Auratus | tried almost every guide on the forums, played around with it, and still no wireless =/ | 11:17 |
| === _zippy_ [n=zippy@201.21.158.82] has joined #ubuntu | ||
| Josh43 | redguy: ok, / is /mnt/hda3. /boot is /mnt/hda2 | 11:17 |
| === cow_2001 [n=username@bzq-88-155-227-36.red.bezeqint.net] has joined #ubuntu | ||
| ab0rted | loz close the terminal manually then, click the X lol | 11:18 |
| stocksy | Petecakes: it looks like grub is trying to use the wrong root partition | 11:18 |
| stocksy | Petecakes: do you dual boot? | 11:18 |
| Josh43 | redguy: Did "chroot /mnt/hda3 /bin/bash" | 11:18 |
| loz | ok | 11:18 |
| Njal | no one knows about setting up dapper on a mac for wireless internet? | 11:18 |
| CNAP | trappist: i mean that the port in my appt will only allow 1 MAC address. i thought if turned my linux box into a gateway i could allow my other computers to access the internet with no problem | 11:18 |
| Petecakes | stocksy; yes. Kubuntu 5.10 and Windows XP Home | 11:18 |
| loz | it'still the same | 11:18 |
| Tiberian | How do i remove apache, php and mysql ? | 11:18 |
| loz | not even responding to sudo | 11:18 |
| === Mazingaro [n=tetsuja@host21-226.pool8710.interbusiness.it] has joined #ubuntu | ||
| CNAP | anybody know how i can masquerade MAC's? | 11:19 |
| Dyna-Work | well, right, the mac address thats seen by whatever is on the other end of the WAN connection is the only one seen i would suspect things on the other end of the gateway "LAN" arent showing their mac addr to WAN. | 11:19 |
| metho | is there a easy to install mysql 4.1.18 cos i downloaded sources in tar.gz format and i am having hard to time to install them, keep getting errors etc | 11:19 |
| === dj-fu [n=deejay@202-169-217-167.worldnet.co.nz] has joined #ubuntu | ||
| === aeolist [n=aeolist@ppp149.dialup.ntua.gr] has joined #ubuntu | ||
| redguy | Josh43: only /mnt/hda3 should be mounted | 11:19 |
| ab0rted | loz what were you doing before hitting ctrl c? | 11:19 |
| na7e | is wpa supposed to be integrated in the networkmanager gui in dapper? | 11:19 |
| trappist | CNAP: as far as I know, and I could be wrong, the mac address of the packet is not altered on its way through a linux gateway | 11:19 |
| === simonpca_ [i=simonpca@ts1-89.f1035.ts.globetrotter.net] has joined #ubuntu | ||
| redguy | Josh43: hit ctrl-d now, you will exit the chroot | 11:19 |
| Njal | dapper broadcom 43XX wirelesss? | 11:19 |
| green_earz | Tiberian: aptitude purge package-name -s or aptitude remove package-name -s the -s is the simulation switch so its dose a dummy run and you can see what it going to remove. after rum the command again with out the -s switch to complete the package removeale. the purge option will remove the package config file and remove leveas the config installed | 11:19 |
| Josh43 | redguy: k, done | 11:20 |
| === zimmz [n=kingroot@c-24-23-87-46.hsd1.tx.comcast.net] has joined #ubuntu | ||
| stocksy | Petecakes: does it work if you choose recovery from the grub menu | 11:20 |
| _jason | metho: well 4.0.24 is in the repository, will that do? | 11:20 |
| Josh43 | redguy: /mnt/hda2 is unmounted | 11:20 |
| loz | i tried rebooting from the terminal | 11:20 |
| ab0rted | could someone else please help out loz? i need to go now | 11:20 |
| Tiberian | thanks green_earz, i'll try that :) | 11:20 |
| redguy | Josh43: ok, now do the chroot again | 11:20 |
| green_earz | np | 11:20 |
| WiFi_Warri0r | jason: ok i posed it where u wanted me too | 11:20 |
| CNAP | trappist: from my experience with the ICS script you sent me, you're right. unfortunately, i need for the mac address to be masked too (spoofed?) so that all the connections behind the gateway look like they're are in fact coming from the actual gateway. if that makes sense? | 11:20 |
| Josh43 | redguy: done | 11:20 |
| _jason | WiFi_Warri0r: url? | 11:21 |
| metho | _jason i need mysql4.1.18 cos i have the sql behcmark for 4.1.18 | 11:21 |
| soc10path | loz, i wasn't paying attention, what are you trying to do? close a terminal window in x? | 11:21 |
| redguy | Josh43: mount /boot | 11:21 |
| metho | _jason i need to use the mysql benchmark as well | 11:21 |
| Dyna-Work | CNAP you mean more like a proxy? | 11:21 |
| === ibrahim [n=ibrahim@soy95-4-82-243-152-23.fbx.proxad.net] has joined #ubuntu | ||
| Petecakes | stocksy; no. I get the same errors. | 11:21 |
| Josh43 | redguy: Done, and the proper files in there | 11:21 |
| === _zippy_ [n=zippy@201.21.158.82] has joined #ubuntu | ||
| ibrahim | hello | 11:21 |
| loz | erm no, i seem to have lost my terminal | 11:21 |
| WiFi_Warri0r | jason: http://paste.ubuntu-nl.org/11124 | 11:21 |
| loz | i can't do anything from it | 11:22 |
| CNAP | dyna-work: i kind of thought proxy and gateways were interchangeable. obviously, i could be wrong? | 11:22 |
| redguy | Josh43: grub-install --no-floppy /dev/hda | 11:22 |
| ibrahim | how unstall plug in manually | 11:22 |
| ibrahim | plz | 11:22 |
| redguy | Josh43: and that should be all, if ther is no error | 11:22 |
| loz | i pressed ctrl c, and it said it was reformatting | 11:22 |
| === robin__ [n=robin@p50826D4D.dip.t-dialin.net] has joined #ubuntu | ||
| soc10path | loz then why not open another one ? is this in x windows? | 11:22 |
| Dyna-Work | well, sorta for some things sorta no for others | 11:22 |
| Seikima | Could anyone give me some tips on getting my internet up and running in Ubuntu? I've got absolutely nothing. | 11:22 |
| loz | i have done | 11:22 |
| loz | many times | 11:22 |
| trappist | CNAP: it makes sense but I don't know that it's possible | 11:22 |
| === WiFi_Warri0r is now known as wifi|cookin | ||
| loz | but still no good | 11:22 |
| soc10path | loz try pressing the letter q i think you're in less | 11:22 |
| === aramil [n=aramil@ppp69-adsl-150.ath.forthnet.gr] has left #ubuntu ["Leaving"] | ||
| Josh43 | redguy: xfs_freeze: specified file ["/boot/grub"] is not on an XFS filesystem | 11:23 |
| Josh43 | Installation finished. No error reported. | 11:23 |
| CNAP | trappist: with all due respect, i'm sure it's possible, i just don't think we know how to do it :-) | 11:23 |
| _jason | wifi|cookin: aptitude update && aptitude install gstreamer0.8-mad | 11:23 |
| Dyna-Work | a gateway is meant to transport packets, like a router...proxy is meant to make connections itself, in order to give the data to another seprate connection | 11:23 |
| === thebrasse [n=brasse@1-1-13-25a.gmt.gbg.bostream.se] has joined #ubuntu | ||
| Josh43 | oops, sorry - didn't realize that would go to 2 lines | 11:23 |
| soc10path | loz anything happen? | 11:23 |
| === Agrajag_ is now known as Agrajag | ||
| loz | no | 11:23 |
| soc10path | loz what did you do to get to this point | 11:24 |
| loz | loz@funbox:~$ q | 11:24 |
| CNAP | dyna-work: obviously linux can act as a proxy, can you point me in the right direction and i'll get back to you on how it comes out? | 11:24 |
| loz | it' so strange | 11:24 |
| soc10path | loz and when you type exit? or press <ctrl>d ? | 11:24 |
| Josh43 | redguy: Is there a way to test it besides a reboot? | 11:24 |
| ibrahim | plz, how install plug in manually, or zip, tar-gz ..... | 11:24 |
| Dyna-Work | well, lemme see | 11:24 |
| loz | i just have the cursor that flashes | 11:24 |
| === Squaredge [n=Squaredg@ALille-151-1-70-29.w86-207.abo.wanadoo.fr] has joined #ubuntu | ||
| redguy | Josh43: hrm well you should be done now. Reboot and check if everything is ok | 11:24 |
| trappist | CNAP: I didn't think of proxy - you want squid | 11:24 |
| redguy | Josh43: none that I know of | 11:24 |
| === raphael [n=rgb@did75-11-82-231-40-223.fbx.proxad.net] has joined #ubuntu | ||
| === aeolist [n=aeolist@ppp149.dialup.ntua.gr] has joined #ubuntu | ||
| CNAP | trappist: YES! SQUID! i knew there was a really pop app out there | 11:24 |
| soc10path | loz is this in x windows? | 11:24 |
| Dyna-Work | hm, apt-proxy | 11:24 |
| Josh43 | redguy: K, I'll save this log just in case and redo if needed - Thank you, wish me luck ;) | 11:24 |
| === knownbad [n=null@69-167-8-113.lmdaca.adelphia.net] has joined #ubuntu | ||
| trappist | Dyna-Work: apt-proxy is for a very specific purpose | 11:25 |
| loz | i don't understand x windows | 11:25 |
| === korben [n=korben@rrcs-24-172-228-94.midsouth.biz.rr.com] has joined #ubuntu | ||
| Dyna-Work | i dunno, im just looking on google to see what i can find here | 11:25 |
| Tiberian | Is there any GUI WebServer for Ubuntu? (Like easyPHP for Windows) | 11:25 |
| wifi|cookin | jason: ok doing it now | 11:25 |
| soc10path | loz x-windows is a graphical environment | 11:25 |
| loz | sorry i'm only on the learning curve with linux | 11:25 |
| loz | yes | 11:25 |
| redguy | Josh43: drop in and say if everything went ok | 11:25 |
| trappist | Dyna-Work: he wants squid | 11:25 |
| loz | sorry i am | 11:25 |
| stocksy | Petecakes: did you upgrade to a new kernel or anything? | 11:25 |
| redguy | Josh43: I'll keep my fingers crossed | 11:25 |
| soc10path | loz is a reboot out of the question? | 11:25 |
| Petecakes | stocksy, no. | 11:25 |
| === bet0x [n=bet0x@200.123.134.161] has joined #ubuntu | ||
| wifi|cookin | jason: ok done, want me to try playing mp3 now? | 11:25 |
| stocksy | hmm | 11:25 |
| bet0x | Hello all | 11:25 |
| === Laney [n=laish@81-178-89-212.dsl.pipex.com] has joined #ubuntu | ||
| CNAP | i'm going to try and get squid. wish me luck on this one | 11:26 |
| === viger [n=viger@62-101-126-222.ip.fastwebnet.it] has joined #ubuntu | ||
| loz | well i've rebootes sevral times | 11:26 |
| bet0x | i chan change my resolution | 11:26 |
| _jason | wifi|cookin: yep, can you try to remember the _ in front of my name so the highlight will work? | 11:26 |
| bet0x | i see all in 640x480 | 11:26 |
| LoCusF | why can't I add my ssh-key in dapper? | 11:26 |
| loz | and i always have a scan disk | 11:26 |
| === didier [n=didier@84.4.205.114] has joined #ubuntu | ||
| Petecakes | stocksy, the only thing I can think of that could have caused the problem is that I used a program, ext2fsd, earlier on to try and read from my linux part while in windows. | 11:26 |
| Josh43 | redguy: Will do, back in a flash | 11:26 |
| LoCusF | I have my passphrase right :S | 11:26 |
| === duelboot [n=duelboot@72-255-77-65.client.stsn.net] has joined #ubuntu | ||
| LoCusF | !ssh | 11:26 |
| ubotu | it has been said that ssh is https://wiki.ubuntu.com/SSHHowto or https://wiki.ubuntu.com/AdvancedOpenSSH | 11:26 |
| Petecakes | I'm presuming that that plays a part in this. | 11:26 |
| wifi|cookin | _jason: ok lol my bad, yeah it still is sayin the same error | 11:26 |
| wifi|cookin | :\ | 11:26 |
| thebrasse | Hello! Can someone here tell me what they think is the best way to get XVID support into my ubuntu installation? Do I need to download and compiile the codec myself or is there a package somewhere that I can use? | 11:26 |
| soc10path | loz scandisk is windows,do you dual boot? | 11:26 |
| _jason | wifi|cookin: did gstreamer0.8-mad install? | 11:26 |
| wifi|cookin | _jason: yes | 11:27 |
| trappist | !tell thebrasse about restricted | 11:27 |
| tonyyarusso | thebrasse: Is it mentioned on wiki/RestrictedFormats? | 11:27 |
| redguy | !tell thebrasse about win32codecs | 11:27 |
| trappist | redguy: you lose | 11:27 |
| _jason | wifi|cookin: close totem/rhyhthmox, run 'gst-register-0.8', and then try again | 11:27 |
| loz | yes all the grub comes ok, and then it says there's files that contain errors | 11:27 |
| wifi|cookin | _jason: ok ill try it, thnx | 11:27 |
| soc10path | loz anything on the last lines that says something like fdisk or fsck? | 11:27 |
| loz | yes | 11:28 |
| loz | that's right | 11:28 |
| redguy | trappist: I already won, this is just for fun... ;) | 11:28 |
| loz | it said something like that | 11:28 |
| === __Ace__ [n=love@kr-lun-162-144-233-83.3.cust.bredband2.com] has joined #ubuntu | ||
| === harisund [n=harisund@204.90.50.252] has joined #ubuntu | ||
| redguy | !enter | 11:28 |
| ubotu | Please don't use the "enter" key as punctuation! It spams the channel and is annoying. | 11:28 |
| soc10path | loz that means your hard drive has some bad sectors... type in your password and get to a prompt | 11:28 |
| soc10path | loz then do "fdisk -l" | 11:28 |
| loz | but i can't do it | 11:28 |
| stocksy | Petecakes: I'm guessing as much too :) | 11:28 |
| soc10path | loz why not | 11:28 |
| === marmysz [n=marmysz@pc-212-191-87-58.p.lodz.pl] has joined #ubuntu | ||
| RMeist | Corrupt label; wrong magic number | 11:28 |
| loz | you mean from a terminal? | 11:29 |
| === rikai [i=rikai@pool-72-65-105-117.ptldme.east.verizon.net] has joined #ubuntu | ||
| === Josh43 [n=Sammi@S0106000c419e9f0d.ed.shawcable.net] has joined #ubuntu | ||
| === epinephrine [i=geek@82-37-152-150.cable.ubr01.wals.blueyonder.co.uk] has joined #ubuntu | ||
| soc10path | loz those errors when you boot up means you have some bad sectors on your hard drive, you need to fix that because it can cause all kinds of other weird problems | 11:29 |
| === maxkelley_ [n=max@cpe-72-228-252-103.rochester.res.rr.com] has joined #ubuntu | ||
| Petecakes | stocksy, another thing: after I mounted my linux part in windows, when I tried to access it, Windows spewed out an error saying that the part was "corrupt and/or unrecognisable"... | 11:29 |
| wifi|cookin | _jason: i ran gst-register-0.8 and it seemed to update the packages or whatever it was doing, then i tied to run totem agsain with the same error =\ | 11:29 |
| loz | ah right | 11:30 |
| === we0 [n=weo@p5499C569.dip0.t-ipconnect.de] has joined #ubuntu | ||
| === dj-fu [n=deejay@202-169-217-167.worldnet.co.nz] has joined #ubuntu | ||
| soc10path | loz so, reboot, when you see the errors about fdisk / fsck and it asks for your password, do this: | 11:30 |
| Dyna-Work | of course it was corrupt, the filesystem is twice as fast. | 11:30 |
| stocksy | Petecakes: i wonder if it was expecting ext2 and didn't like the ext3 journal | 11:30 |
| loz | ok mate | 11:30 |
| === Squaredge [n=Squaredg@ALille-151-1-70-29.w86-207.abo.wanadoo.fr] has left #ubuntu ["Quitte"] | ||
| soc10path | loz enter your password, then type "fsck -y" | 11:30 |
| === buzzc1 [n=buzzetti@ool-4577218b.dyn.optonline.net] has joined #ubuntu | ||
| loz | your a star | 11:30 |
| stocksy | maybe you could boot from a livecd and try to fix it from there? | 11:30 |
| _jason | wifi|cookin: what does the following return: apt-cache policy gstreamer0.8-mad | grep -i Installed | 11:30 |
| harisund | Hello , is it possible to install Ubuntu on a fat partition? | 11:30 |
| === mat [n=mat@igoan/mat] has joined #ubuntu | ||
| Petecakes | stocksy; in the FAQ it stated that it could read from ext3, just not write to it. | 11:31 |
| Josh43 | redguy, Worked like a charm, though I totally forgot and overwrote my other bootloader (xosl), I'll figure it out later :) | 11:31 |
| aeolist | harisund: no | 11:31 |
| tonyyarusso | harisund: I don't think so. You can have files on FAT, but not installation. | 11:31 |
| === jadaz87 [n=jadaz87@pool-70-111-105-18.nwrk.east.verizon.net] has joined #ubuntu | ||
| === rambo3 [n=rambo3@c-bff871d5.027-6-6b73641.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| harisund | Ah ! Thought so .. thanks. | 11:31 |
| CNAP | i just want to say that "apt-get" is wonderful. i just used it for the first time ever, and it worked flawlessly | 11:31 |
| === eliphas_ [n=eliphas_@host-84-9-255-148.bulldogdsl.com] has joined #ubuntu | ||
| aeolist | harisund: you wouldnt want to do that anyway, fat is for losers | 11:31 |
| loz | thanks ever so much, soc10path! | 11:31 |
| aeolist | harisund: (i just love my detailed explanations) | 11:31 |
| soc10path | np, gl loz | 11:31 |
| harisund | Hmm.. aeolist, I think I agree with you there.. | 11:31 |
| tonyyarusso | CNAP: Happy usage! You'll be getting much as you go, isn't that cool? | 11:31 |
| === espresso_ [n=espresso@adsl-69-231-137-15.dsl.irvnca.pacbell.net] has joined #ubuntu | ||
| === Sonderblade [n=meh@c-225ae353.131-1-64736c10.cust.bredbandsbolaget.se] has joined #ubuntu | ||
| === linuxboyfriend [n=linuxboy@202.134.132.16] has joined #ubuntu | ||
| redguy | Josh43: yay! | 11:32 |
| harisund | Is there a way I can format a 256MB usb disk with ext3? | 11:32 |
| soc10path | harisund why would you want to? | 11:32 |
| CNAP | oy, i remember using RPM's and thinking they were great until dependencies bogged me down | 11:32 |
| soc10path | harisund it will just make it unusable for non *nix boxes | 11:32 |
| === xdarCx [n=darc@c-71-196-229-240.hsd1.co.comcast.net] has joined #ubuntu | ||
| harisund | Just wondering, all my USB disks are formatted using FAT under Windows. | 11:32 |
| loz | *loz leaves to reboot and get lost in grub! | 11:32 |
| dj-fu | harisund, plug it in, mkfs -t ext3 /dev/sdaX | 11:32 |
| === Amaranth [n=amaranth@ubuntu/member/amaranth] has joined #ubuntu | ||
| === zenmac [n=zenwhen@h153.202.28.71.ip.alltel.net] has joined #ubuntu | ||
| aeolist | harisund: it's really kinda outdated... cant have files bigger than a couple of gigs, the tree is breaking up all the time etc etc... you are much better off with ext3 | 11:32 |
| redguy | harisund: man mke2fs | 11:32 |
| TheFuzzball | how to change a bootsplash? | 11:32 |
| harisund | oh sure.. thanks.. will try that out next | 11:33 |
| stocksy | Petecakes: i dunno mate, you've got me. ask an easy one. If it were me, I'd try running an fsck on the disk from a livecd | 11:33 |
| === cow_2001 [n=username@bzq-88-155-227-36.red.bezeqint.net] has joined #ubuntu | ||
| redguy | harisund: you can format is as FAT as well | 11:33 |
| stocksy | maybe someone else has a better idea! | 11:33 |
| linuxboyfriend | hi all | 11:33 |
| dj-fu | oh yeah, mke2fs /dev/sdaX | 11:33 |
| dj-fu | use `mount` to find out where it's mounted | 11:33 |
| harisund | Yepp.. thanks guys. . | 11:33 |
| dj-fu | You might wanna use the GUi, for this | 11:34 |
| dj-fu | system > admin > disks | 11:34 |
| linuxboyfriend | i have installed firefox and realplayer but firefox is not recognizing that realplayer is installed, how can i configure realplayer in firefox? | 11:34 |
| Petecakes | stocksy; I have Knoppix, so I'll try fsck from there. Thanks very much mate, been a great help (even though we didn't get far :P) | 11:34 |
| dj-fu | my Ipod shows up and I can format it ;P | 11:34 |
| harisund | dj-fu, I prefer the command line actually . | 11:34 |
| dj-fu | righto ;0 | 11:34 |
| harisund | But yes iPod is kind of recognized by Ubuntu pretty well | 11:34 |
| harisund | linuxboyfriend, what method did you use for installing realplayer? | 11:35 |
| === sociopath [n=user@net34-155.netkaster.ca] has joined #ubuntu | ||
| linuxboyfriend | harisund, sudo dpkg -i realplayer_10.0.6-0.0_i386.deb | 11:35 |
| mizery | What is the default root password for a fresh Ubuntu 5.10 installation? | 11:35 |
| linuxboyfriend | harisund, this method | 11:35 |
| redguy | !tell mizery about root | 11:35 |
| _jason | linuxboyfriend: where did the deb come from? | 11:36 |
| harisund | yes, where did you get that package? | 11:36 |
| === Kezzer [n=Kezzer@88-105-244-13.dynamic.dsl.as9105.com] has joined #ubuntu | ||
| Tiberian | Where do we set the URLs for Please, some1, Check that :) http://paste.ubuntu-nl.org/11126 | 11:36 |
| linuxboyfriend | jason_, sorry? | 11:36 |
| === FliesLikeALap [n=Ryan@copper-69.dynamic2.rpi.edu] has joined #ubuntu | ||
| === JulianoSMM [n=oz@201.14.253.67] has joined #ubuntu | ||
| Tiberian | oops | 11:36 |
| Tiberian | sorry :P | 11:36 |
| _jason | linuxboyfriend: i'm just curious where you got the deb, I've only seen .bin's for realplayer 10 | 11:36 |
| soc10path | linuxboyfriend where did you get that package | 11:36 |
| === ThomS [n=thom@shutt.demon.co.uk] has joined #ubuntu | ||
| === uros [n=chatzill@BSN-77-199-121.dial-up.dsl.siol.net] has joined #ubuntu | ||
| === ThomS [n=thom@shutt.demon.co.uk] has left #ubuntu ["Leaving"] | ||
| Tiberian | Thats what i wanted to write ->> Please, some1, Check that :) http://paste.ubuntu-nl.org/11126 | 11:37 |
| linuxboyfriend | _jason, i will tell u wait a little | 11:37 |
| FlannelKing | jason_: I believe easyubunu installs realplayer. | 11:37 |
| linuxboyfriend | soc10path, i will tell u wait a little | 11:37 |
| linuxboyfriend | harisund, can u help me about that problem? | 11:37 |
| Josh43 | redguy, Thanks again; I'm off to move more stuff around, but on hdb this time ;) | 11:37 |
| harisund | Hmm.. If I am not much mistaken, I believe there is a .deb file hanging out on ftp://ftp.nerim.net/... | 11:37 |
| === LeeJunFan [n=junfan@adsl-69-210-207-5.dsl.klmzmi.ameritech.net] has joined #ubuntu | ||
| kingspawn | of course realplayers isn't recognized, its almost as crap as quicktime is. | 11:38 |
| harisund | I am not sure linuxboyfriend my Realplayer works for most sites, but there are still some sites that I am unable to get RealPLayer to play | 11:38 |
| === weo1 [n=weo@p5499BDB4.dip0.t-ipconnect.de] has joined #ubuntu | ||
| linuxboyfriend | harisund, and what method u used? | 11:38 |
| harisund | I downloaded the .bin file from the RealPlayer website | 11:39 |
| redguy | Tiberian: mirrormax-backports doesn't work anymore | 11:39 |
| redguy | Tiberian: AFAIK | 11:39 |
| harisund | I can atleast play BBC Radio using that. | 11:39 |
| Dyna-Work | you can try this | 11:39 |
| Dyna-Work | wget ftp://ftp.nerim.net/debian-marillat/pool/main/r/realplay/realplayer_10. 0.6-0.0_i386.deb | 11:39 |
| tonyyarusso | Is there a way to make shutdown give a notification in Gnome, rather than just on consoles? | 11:39 |
| Tiberian | redguy, and how do i remove that link? also do you know how do i get the apache2 (cuz as u can see i can't) | 11:40 |
| === Seikima_ [n=Seikima@cpe-24-28-82-58.austin.res.rr.com] has joined #ubuntu | ||
| redguy | tonyyarusso: are you afraid that you won't notice the shutdown when in gnome? ;) | 11:40 |
| linuxboyfriend | _jason, soc10path, https://wiki.ubuntu.com/RestrictedFormats#head-848295cba1b3591a4b4a0dbea5844fd5d2894b6b | 11:40 |
| FlannelKing | Tiberian: apache2 is in the repository | 11:40 |
| tonyyarusso | redguy: It's possible. | 11:40 |
| wifi|cookin | any help getting my sound working plz, it is onboard | 11:40 |
| Storkme | wtf... | 11:40 |
| _jason | linuxboyfriend: thanks | 11:40 |
| === pino [n=pino@214-239-126-200.fibertel.com.ar] has joined #ubuntu | ||
| kingspawn | tonyyarusso: how often does your machine shut down like that? | 11:41 |
| linuxboyfriend | harisund, can u tell me that where the plugins of realplayer locate so i can make a link to my ~/.mozilla/plugins? | 11:41 |
| === mentos [n=mentos@23.25.97-84.rev.gaoland.net] has joined #ubuntu | ||
| kingspawn | heh | 11:41 |
| Kezzer | Can anyone recommend any decent software to burn ISO's to CD? | 11:41 |
| redguy | Tiberian: just remove it or comment it out (with a # at the beginning of the line) from your /etc/apt/sources.list file. Or disable it from synaptic, whichever suits you | 11:41 |
| linuxboyfriend | _jason, np | 11:41 |
| harisund | Hang on linuxboyfriend | 11:41 |
| linuxboyfriend | harisund, ok :) | 11:41 |
| _harm | which options are there for webcam supported MSN? | 11:41 |
| tonyyarusso | kingspawn: When I tell it to. It's sort of a theoretical question, could come into play on my family's computers more than mine. | 11:41 |
| harisund | linuxboyfriend, I simply followed the instructions in http://plugindoc.mozdev.org/linux.html#RealPlayer | 11:41 |
| _jason | linuxboyfriend: by the way I would just recommend mplayer with w32codecs to play all the rm stuff | 11:41 |
| Tiberian | Thanks both ( redguy + FlannelKing ) | 11:41 |
| Kezzer | good good =) | 11:41 |
| === nowotny_ [n=nowotny@aio109.neoplus.adsl.tpnet.pl] has joined #ubuntu | ||
| kingspawn | tonyyarusso: there probably is a way. maybe that gdesklet-stuff can be of help? | 11:42 |
| Storkme | what the hell is wrong with my computer | 11:42 |
| === lappies [i=lappies@dsl-165-227-193.telkomadsl.co.za] has joined #ubuntu | ||
| tonyyarusso | kingspawn: Maybe, although I haven't seen any of those for it. | 11:42 |
| === arrinmurr [n=arrinmur@MMMVIII.tun.saunalahti.fi] has joined #ubuntu | ||
| === deque [n=deque@70.58.177.105] has joined #ubuntu | ||
| linuxboyfriend | _jason, i am using firefox-1.5 so mozilla-mplayer will not work | 11:42 |
| === Atlas [n=atlas@84.5.39.52] has joined #ubuntu | ||
| === _lwelyn [n=lwelyn@p549A57CE.dip.t-dialin.net] has joined #ubuntu | ||
| _jason | linuxboyfriend: why not? just symlink all the plugin files | 11:43 |
| === Gustaf [n=Gustaf@82.183.156.99] has joined #ubuntu | ||
| Gustaf | anyone run ubuntu on a Sony Vaio TX2 or TX1? | 11:43 |
| === alekz [n=alekz@200.38.225.239] has joined #ubuntu | ||
| harisund | _jason, if you look at the ubuntu wiki instructions for installing Firefox 1.5, the instructions specifically ask us to remove certain plugins | 11:44 |
| h0nus | can someone tell me the correct syntax to apt-get the emu10k1 sound drivers? | 11:44 |
| harisund | SInce they are not compatible with 1.5 | 11:44 |
| linuxboyfriend | _jason, where the plugins of realplayer locate like nphelix.so and nphelix.xpt ( t think these will be the correct plugins)? | 11:44 |
| _jason | harisund: which ones? | 11:44 |
| deque | Gustaf: I am running it right now on a Z1. It works basically flawlessly. Don't know how similar they are to the TX though... | 11:44 |
| harisund | hang on | 11:44 |
| === squiddle [n=squiddle@port-195-158-177-21.dynamic.qsc.de] has joined #ubuntu | ||
| _jason | harisund: not mplayer :) | 11:45 |
| _harm | which options are there for webcam supported MSN? | 11:45 |
| soc10path | deque does your vaio have the s1 and s2 buttons? what about the wifi switch? how well supported? | 11:45 |
| === Zoroaster [n=System@70-243-24-226.ded.swbell.net] has joined #ubuntu | ||
| === UltraZ [n=subflame@85.204.137.15] has left #ubuntu [] | ||
| === no_gatez_fan [n=patrick@cpe-069-132-015-252.carolina.res.rr.com] has joined #ubuntu | ||
| harisund | oh srorry _jason :( | 11:45 |
| Zoroaster | good day | 11:45 |
| Gustaf | deque: is the brightness controll controlled by sony software in windows? I cant find out how to change display brightness wihout booting windows.. :( | 11:45 |
| harisund | You are right indeed.. mplayer is what is recommended instead | 11:45 |
| deque | soc10path: It has the s1 and s2 switches, though I don't use them, I seem to recall being surprised that they did stuff.. The wireless switch works fine as it's hardware based | 11:45 |
| harisund | Oopps.. my mistake | 11:45 |
| alekz | hi, can someone help me with my printer? i cant set up my hpoj service, you can check here a paste: http://pastebin.com/631555 | 11:46 |
| Zoroaster | what if I enabled root, but now I forgot the password? can I recover somehow, or override? | 11:46 |
| soc10path | Gustaf check your FN key (blue) | 11:46 |
| Gustaf | soc10path, well thats what Im using | 11:46 |
| soc10path | deque good to know, i have a FE | 11:46 |
| Dyna-Work | anybody know if SB X-FI works yet? | 11:46 |
| deque | Gustaf: I've never used this machine in windows, but a Fn-F5 decrease the brightness and fn-F6 will increase it | 11:46 |
| wifi|cookin | zoroaster: yeah use bootdisk and mount the partition and try running a password crackwer | 11:46 |
| wifi|cookin | ;) | 11:46 |
| soc10path | Gustaf and it doesn't change the brightness? it's hardware based | 11:46 |
| === hyphenated [n=cgilmour@nzns1.eservglobal.co.nz] has joined #ubuntu | ||
| === nicky33 [n=Jedwady@c-24-118-40-167.hsd1.mn.comcast.net] has joined #ubuntu | ||
| zimmz | I need an FTPd to basically follow along with all my user accounts (in respect to their home paths and login info), or really anything friendly to a newb :D any suggestions? | 11:47 |
| Gustaf | soc10path, it doesnt... it seems to be software controlled. | 11:47 |
| Ven] n^ | !resolution | 11:47 |
| ubotu | resolution is probably at https://wiki.ubuntu.com/FixVideoResolutionHowto | 11:47 |
| === edo [n=edo@host178-28.pool873.interbusiness.it] has joined #ubuntu | ||
| Zoroaster | wifi|cookin, dang | 11:47 |
| === lwelyn [n=lwelyn@p549A57CE.dip.t-dialin.net] has joined #ubuntu | ||
| === Petecakes [i=Pete@unaffiliated/petecakes] has left #ubuntu [] | ||
| === trainer [n=dave@65-117-135-105.dia.static.qwest.net] has left #ubuntu [] | ||
| === edo [n=edo@host178-28.pool873.interbusiness.it] has left #ubuntu ["Sto] | ||
| Zoroaster | why did I go off and forget my root password | 11:47 |
| wifi|cookin | zoroaster:it's really pretty simple, it just takes a while to crack the passwd file if u made a good password haha | 11:48 |
| _jason | Zoroaster: I would boot with a livecd, mount the partition, and change the password field of root in /etc/shadow to *, then reboot | 11:48 |
| deque | soc10path: I just tried out my "P1" and "P2" buttons | 11:48 |
| Zoroaster | wifi|cookin, what password cracker should I use | 11:48 |
| wifi|cookin | _jason: that doesnt always work | 11:48 |
| === eladalon [n=eladalon@84.228.35.223] has joined #ubuntu | ||
| wifi|cookin | zoroaster: john the ripper | 11:48 |
| eladalon | Hi. How do I restart the internet-thingie? | 11:48 |
| wifi|cookin | or l0phtcrack | 11:48 |
| _jason | Zoroaster: or if you have sudo, you can just reset it probably | 11:48 |
| wifi|cookin | what os u on? | 11:48 |
| soc10path | Gustaf the backlight of a laptop lcd is just a really bright light, nothing to do with the os, so i can't imagine why FN+Fx doesn't work | 11:48 |
| _jason | wifi|cookin: how come? | 11:48 |
| eladalon | All internet-related services. | 11:48 |
| deque | sociopath: They both create the same mappable keyboard event. I just used the gnome KB shortcut tool and mapped them to "logout". Works fine | 11:48 |
| soc10path | deque good to know | 11:49 |
| Zoroaster | _jason, how would i reset using sudo? | 11:49 |
| wifi|cookin | _jason: becuz on some distro's if u reset shadow file it fucks it up | 11:49 |
| _jason | Zoroaster: same way you set it the first time | 11:49 |
| wifi|cookin | and wont let anyone log on | 11:49 |
| wifi|cookin | =\ | 11:49 |
| === sdasdas [n=sdasdas@200.138.41.23] has joined #ubuntu | ||
| wifi|cookin | sudo might work tho | 11:49 |
| wifi|cookin | ;) | 11:49 |
| _jason | wifi|cookin: oh, I've edited it on ubuntu though | 11:49 |
| soc10path | deque Gustaf's backlight FN+Fx doesn't work, that's hardware based too right? | 11:49 |
| sdasdas | rar in ubuntu? help-me | 11:49 |
| _jason | !rar | 11:49 |
| ubotu | I heard rar is a non-free archive format created by Rarsoft. For instructions on accessing .rar files through the Archive Manager view https://wiki.ubuntu.com/FileCompression | 11:49 |
| === ephesius [n=ephesius@ool-44c11edc.dyn.optonline.net] has joined #ubuntu | ||
| wifi|cookin | _jason: ohh ok well i wasnt sure that why i said it, but if uve tried it then im sure it works | 11:49 |
| wifi|cookin | ;) | 11:49 |
| Dyna-Work | anybody at all in here have a sound blaster x-fi and using ubuntu can tell me if it works or not before i try to install the card? | 11:49 |
| sdasdas | thanks _jason | 11:50 |
| === ricardo [n=anguiano@102.223-93-216-nokia-dsl.static.surewest.net] has joined #ubuntu | ||
| ephesius | has anyone gotten cs 1.6 to work efficiently in ubuntu | 11:50 |
| wifi|cookin | im having problems getting my sound card to work! any help- plz! | 11:50 |
| deque | soc10path: I don't think so, IIRC, you need the sony tools installed. I did when I was running Gentoo at least, presumably Dapper automagically installed them already... | 11:50 |
| Gustaf | soc10path, the backlight level is controlled by windows software in my TX2. I have located the windows system serivce that control this and if this sercvice is stoped the light level can not be changed. | 11:50 |
| harisund | _jason, what was that !rar that you typed? Why did you put an exclamation mark? | 11:50 |
| wifi|cookin | harisund: to speak to the bot | 11:50 |
| _jason | !bot | 11:50 |
| ubotu | Yep, that's me! I'm a bot alright. Read http://wiki.ubuntu.com/UbotuUsage to find out how to use me. Do NOT play with me in any channel except #debian-bots. | 11:50 |
| wifi|cookin | ;) | 11:50 |
| deque | soc10path: hm, nope, they aren't installed. | 11:50 |
| === Snake__ [n=Snake@adsl-65-43-151-48.dsl.bcvloh.ameritech.net] has joined #ubuntu | ||
| harisund | oh bot.. interesting. thanks | 11:51 |
| soc10path | Gustaf deque i'll have a look when i get home... if what you're saying is correct ( i haven't finished installing ubuntu as i've just got the vaio) i'll be writing some software tonight | 11:51 |
| Storkme | !?!?!?!?!?!?!?!?!?!?!?!?!?!?!?!?WHYATAA | 11:51 |
| ubotu | Huh? Try searching at http://ubuntu.cc.com.au/, Storkme | 11:51 |
| Snake__ | Do we have a gnome 2.14 binary I can get from somewhere? | 11:51 |
| davidmcq | hi guys.... can anyone suggest why breezy install hangs "loading additional components" on an IBM r32? | 11:51 |
| Storkme | for NO reason, my kernel just STOPPED working!!!!!! | 11:51 |
| deque | soc10path: I've also noticed some support for sony- specific hardware in recent kernels, that may have something to do with it. | 11:51 |
| Dyna-Work | fire it. | 11:51 |
| Gustaf | soc10path, You also got the TX2? | 11:51 |
| === jenda is now known as jenda-zZz | ||
| soc10path | Gustaf i have an FE | 11:51 |
| soc10path | Gustaf i have an FE550 or so | 11:51 |
| soc10path | Gustaf should be pretty similar i'd imagine | 11:52 |
| soc10path | deque i saw that too, some of it was sound related | 11:52 |
| === slawek [n=slawek@113.63.rev.vline.pl] has joined #ubuntu | ||
| wifi|cookin | help with sound please, it is onboard | 11:52 |
| wifi|cookin | :O | 11:52 |
| === TSCHAK2 [n=thomas@24-53-91-155.clspco.adelphia.net] has joined #ubuntu | ||
| Gustaf | soc10path, ok, cool.. well I'll check with you later then | 11:52 |
| === wifi|cookin doesnt hear shit! | ||
| wifi|cookin | lol | 11:52 |
| === TSCHAK2 is now known as TSCHAK | ||
| Zoroaster | that did work | 11:52 |
| Snake__ | Anyone? | 11:53 |
| Zoroaster | _jason, wifi|cookin, it worked, sudo did | 11:53 |
| === xipa [n=xipa@84.234.110.110] has joined #ubuntu | ||
| deque | soc10path: I'm pretty sure they aren't purely hardware (BIOS) based like the old models were. | 11:53 |
| Gustaf | soc10path, deque, thanks for the help anyway.. | 11:53 |
| Zoroaster | thanks for the help | 11:53 |
| === Pluk [n=Pluk@12-68-dsl.ipact.nl] has joined #ubuntu | ||
| wifi|cookin | zoroaster: right on | 11:53 |
| === sdasdas [n=sdasdas@200.138.41.23] has left #ubuntu ["Fui] | ||
| === weo [n=weo@p549985CC.dip0.t-ipconnect.de] has joined #ubuntu | ||
| wifi|cookin | now if only i could get help! hahahaha | 11:53 |
| deque | Gustaf: NP, do try installing the sonyctl tools, they may be helpful | 11:53 |
| soc10path | deque every other laptop i've ever had (that i can think of) was pure hardware based | 11:53 |
| wifi|cookin | 700 people in here | 11:53 |
| Snake__ | lol | 11:53 |
| soc10path | deque i find it hard to believe, but i wouldn't put it past sony | 11:53 |
| davidmcq | wifi|cookin .. what's your problem.. then maybe y0u can help me with mine! | 11:54 |
| wifi|cookin | david: ill help u first if i can | 11:54 |
| wifi|cookin | what's up? | 11:54 |
| davidmcq | wifi|cookin ... can't pass that up, can i? | 11:54 |
| davidmcq | wifi|cookin ... just bought a ibm r32 and can't even install :( | 11:54 |
| wifi|cookin | ??? | 11:54 |
| deque | soc10path: They didn't work on this machine whne I first got it. Took a lot of fiddling when I was running gentoo to make them cooperate. And on my old 505 they worked with no config | 11:54 |
| wifi|cookin | david: cant install, does it load the cd? | 11:54 |
| Gustaf | deque, I'll give it a try | 11:55 |
| deque | soc10path: sounds good | 11:55 |
| === ddd_ [n=david@85-124-50-167.dynamic.xdsl-line.inode.at] has joined #ubuntu | ||
| davidmcq | wifi|cookin ... it hangs at the "loading additional components" stage | 11:55 |
| === tenshiKur0 [n=tenshiKu@24.84.47.187] has joined #ubuntu | ||
| Storkme | hi, i get an error while trying to boot up kernel: '2.6.12-10-amd-generic'. My error is thus: http://pastebin.com/631580 | 11:55 |
| wifi|cookin | davidmcq: is the cd scrathed? does the cd-rom reader still get activity at that point? | 11:55 |
| Snake__ | Is there a gnome 2.14 build somewhere I can get (Dapper) | 11:55 |
| davidmcq | wifi|cookin ... looks like possibly driver/hardware/bios thing, because DSL won't start up either | 11:55 |
| Snake__ | orrr not | 11:55 |
| Snake__ | Im stupid | 11:55 |
| CNAP | anybody know anything about squid here? | 11:55 |
| === fiendskull9 [n=clayton@12-201-47-48.client.mchsi.com] has joined #ubuntu | ||
| === Snake__ steps out stupidly | ||
| rambo3 | !squid | 11:56 |
| ubotu | Bugger all, I dunno. Try searching at http://ubuntu.cc.com.au/, rambo3 | 11:56 |
| ddd_ | a big THANKS for all you ubuntu people out there for making ubuntu. | 11:56 |
| StarKruzr | can someone tell me whether or not some kind of default firewalling is enabled in Breezy Badger for PowerPC? | 11:56 |
| fiendskull9 | hey, can someone tell me a good C++ enviroment (like dev cpp) that i can apt-get | 11:56 |
| === arrick [n=arrick@pool-71-115-130-42.gdrpmi.dsl-w.verizon.net] has joined #ubuntu | ||
| nickrud | StarKruzr, none | 11:56 |
| wifi|cookin | davidmcq: dsl wont start up? hmmm that prolly is the bios then or hardware | 11:56 |
| davidmcq | StarKruzr .. there is no default firewall in Breezy | 11:56 |
| soc10path | fiendskull9 sudo apt-get install vim | 11:56 |
| deque | Gustaf: look at "spicctrl" and "vaiostat-source" in synaptic. They're both in universe | 11:56 |
| harisund | fiendskull9, are you looking for integrated development environment? | 11:56 |
| rambo3 | fiendskull9: kde has some c++ development packages | 11:56 |
| CNAP | i'm going to copy+paste an error message after running "./squid -z" here. so nobody panic | 11:56 |
| wifi|cookin | doubt its drivers cuz u dont need them to use eth0 | 11:56 |
| Storkme | hi, i get an error while trying to boot up kernel: '2.6.12-10-amd-generic'. My error is thus: http://pastebin.com/631580 | 11:56 |
| StarKruzr | nickrud: okay. so if I can't get in it's the fault of something on the network. | 11:57 |
| davidmcq | wifi|cookin .. eth0? | 11:57 |
| StarKruzr | nickrud: yes? | 11:57 |
| marmysz | thx | 11:57 |
| wifi|cookin | davidmcq: does the cd-rom get activity when it stalls?? | 11:57 |
| davidmcq | wifi|cookin ... i didn't think i was getting that far | 11:57 |
| JulianoSMM | Storkme: what is ur ubuntu version? | 11:57 |
| Gustaf | deque, ok cool. thanks man | 11:57 |
| wifi|cookin | davidmcq: ethernet port | 11:57 |
| harisund | fiendskull9, you could try an environment called Anjunta, but if you are simply going to be trying out some small c++ programs, you could use the command line itself | 11:57 |
| Storkme | JulianoSMM, breezy | 11:57 |
| nickrud | StarKruzr, that's another question, and I tend to run from network questions, sorry :) | 11:57 |
| soc10path | harisund friendskull just left | 11:57 |
| CNAP | 2006/03/30 16:57:19| Creating Swap Directories | 11:57 |
| CNAP | FATAL: Failed to make swap directory /usr/local/squid/var/cache/00: (13) Permission denied | 11:57 |
| CNAP | Squid Cache (Version 2.5.STABLE13): Terminated abnormally. | 11:57 |
| CNAP | CPU Usage: 0.001 seconds = 0.000 user + 0.001 sys | 11:57 |
| CNAP | Maximum Resident Size: 0 KB | 11:57 |
| CNAP | Page faults with physical i/o: 0 | 11:57 |
| davidmcq | wifi|cookin ... i know it's ethernet... but i didn't think it looked there till later | 11:57 |
| deque | Gustaf: np, have fun | 11:58 |
| harisund | Oh. that's funny, I didn't get a message.. oh well.. | 11:58 |
| davidmcq | wifi|cookin ... yes.. sounds likes occassional cdrom up and down... but not getting anywhere :( | 11:58 |
| === LuckXP [i=windows@ip70-160-228-100.hr.hr.cox.net] has joined #ubuntu | ||
| wifi|cookin | davidmcq: ethernet is loaded when u turn to box on, it just doesnt get used till later, and what im asking is does the cdrom stay busy when ur saying it stalls??? | 11:58 |
| wifi|cookin | well, then, how old is ur cdrom? | 11:59 |
| === _zippy_ [n=zippy@201.21.158.82] has joined #ubuntu | ||
| davidmcq | wifi|cookin ... it quietens down.. then about every 60 seconds spins up.. | 11:59 |
| === _zippy_ [n=zippy@201.21.158.82] has left #ubuntu ["Leaving"] | ||
| wifi|cookin | may be dirty cd disc or a dying cdrom | 11:59 |
| arrick | How do I make a iso image of my hard drive? | 11:59 |
| === anatole [n=ZOMG@194.152.153.114] has joined #ubuntu | ||
| === stifo [n=stifo@158.193.83.42] has joined #ubuntu | ||
| CNAP | anbydoy know why i can't make a swap dir for squid? i ran it in SUDO | 12:00 |
| davidmcq | wifi|cookin .. nothing on any terminal... alt.f3 makes me think that it's looking for a module that it doesn't find.. but i don't know much about it | 12:00 |
| === raphink [n=raphink@ubuntu/member/raphink] has joined #ubuntu | ||
Generated by irclog2html.py 2.7 by Marius Gedminas - find it at mg.pov.lt!
