vulcanmummie | can someone help me? I downloaded ubuntu and was running it for a week or so and then it just wouldn't boot, so I started running windows again and had problems with that, now I think my harddrive just crashed, help!? | 00:00 |
---|---|---|
AndyOpie150 | I'll have to jump to the Ubuntu 12.04 as I'm on Ultimate Edition right now. Then I double check things out and see if I can live without Intel-hide | 00:00 |
ActionParsnip | Pedrolito: not updated recently, so couldn't say | 00:00 |
boof | and the resolution options are limited and so are other graphics related things | 00:00 |
Pedrolito | ActionParsnip, by the update, I mean the distribution upgrade to 12.10 | 00:00 |
vulcanmummie | or is there a different room I should go to? | 00:00 |
boof | l3top with hotkeys, and ive tried going into system settings/power settings too and adjusting it that way but the screen shows no difference | 00:01 |
PatrickDickey | vulcanmummie, when you say it wouldn't boot, would it at least try to boot? Or would it go directly to Windows? | 00:01 |
=== Fike_ is now known as Fike | ||
L3top | vulcanmummie: it sounds like you have a bad drive. You can boot live and check it with fsck /dev/sdXY where x is the drive and y is the partition | 00:01 |
vulcanmummie | PatrickDickey, it would boot to a purple screen then go black witha prompt | 00:02 |
vulcanmummie | now all I see is disk read error | 00:02 |
L3top | vulcanmummie: for the ubuntu side that is... but... I now think that is silly advice and you should check with some other utility... | 00:02 |
boof | l3top and when i check for additional drivers it says no proprietary drivers are in use on this system. i don't know if that has to do with it or not | 00:03 |
vulcanmummie | I actually have no idea what I'm doing | 00:03 |
vulcanmummie | guess I have to send it back to my computer guy for him to have it for a damn month | 00:03 |
vulcanmummie | I see, disk read error press ctrl alt del to restart | 00:04 |
L3top | boof did you install the i965 package and reload desktop? | 00:04 |
rwlyonsjr | Hello, I am having a wireless issue with a fresh install of Ubuntu. Can anyone assist me with this? | 00:04 |
WeThePeople | rwlyonsjr, what is the issue | 00:05 |
boof | yes didn't reload the desktop though | 00:05 |
L3top | vulcanmummie: you need to check the drive for physical problems. | 00:05 |
L3top | boof: either do that or reboot please. | 00:05 |
vulcanmummie | L3top, I don't know what I'm doing | 00:05 |
boof | ok im gonna reboot | 00:05 |
rwlyonsjr | @WeThePeople i am getting little to no signal using my asus zenbook | 00:05 |
WeThePeople | rwlyonsjr, can you access the internet | 00:06 |
goddard | can i remove the ubuntu icon | 00:06 |
goddard | or the message icon? | 00:07 |
rwlyonsjr | @WeThePeople yes, I can access the internet | 00:07 |
vulcanmummie | wth, I just restarted now it's letting me p;ick between ubuntu and windows again...I know ubuntu is having problems tho | 00:07 |
WeThePeople | rwlyonsjr, are you right next to your router? | 00:07 |
WeThePeople | or is it far away | 00:08 |
L3top | vulcanmummie: the first thing you need to do is boot to a live cd. | 00:08 |
rwlyonsjr | @WeThePeople right now I am not, but when I am, I still have poor signal... | 00:08 |
L3top | http://www.howtogeek.com/howto/37659/the-beginners-guide-to-linux-disk-utilities/ take a look at this vulcanmummie | 00:08 |
WeThePeople | rwlyonsjr, idk what to tell you.. | 00:08 |
vulcanmummie | I didn't put ubuntu on a cd | 00:08 |
PatrickDickey | vulcanmummie, did you install ubuntu from a Live CD, or using wubi? | 00:09 |
rwlyonsjr | @WeThePeople I saw some stuff on line about adding a 1 to the file disable_ani, but I have not been able to edit the file | 00:09 |
josy1982 | what is better unity or gnome shell? | 00:09 |
vulcanmummie | umm, I'm not sure, I didn't burn it to a cd tho PatrickDickey | 00:09 |
boof | l3top: i don't think anything has changed | 00:10 |
PatrickDickey | josy1982, that's a matter of opinion. | 00:10 |
WeThePeople | rwlyonsjr, type in terminal, gksudo nautilus and find the file you want edit | 00:10 |
PatrickDickey | vulcanmummie, did you install it from inside Windows? | 00:10 |
vulcanmummie | yes PatrickDickey | 00:10 |
rwlyonsjr | @WeThePeople ok, I will try that | 00:10 |
vulcanmummie | I promise I'm not stupid just ignorant | 00:10 |
L3top | boof lsmod | grep i9 | 00:11 |
PatrickDickey | lol I never said (or thought that) vulcanmummie. But, it might change things a bit. | 00:11 |
goddard | vulcanmummie: whats ignorant mean | 00:11 |
delinquentme | where might I go to find help on upgrading the ram in my laptop? | 00:11 |
WeThePeople | rwlyonsjr, it open up a program called nautilus to edit files and such with root priv. | 00:11 |
willdabeast | delinquentme newegg.com | 00:12 |
boof | l3top i915 419110 0 | 00:12 |
boof | drm_kms_helper 45466 1 i915 | 00:12 |
boof | drm 197599 2 i915,drm_kms_helper | 00:12 |
boof | i2c_algo_bit 13199 1 i915 | 00:12 |
boof | video 19068 1 i915 | 00:12 |
FloodBot1 | boof: Please don't flood; use http://paste.ubuntu.com to paste; don't use Enter as punctuation. | 00:12 |
PatrickDickey | delinquentme, you'll probably get more help for that on Google. Search for something like upgrade memory in <insert laptop model> | 00:12 |
L3top | sorry... I just wanted to know that it was using the intel driver... didn't need teh output | 00:12 |
boof | sorry I'm new to this | 00:12 |
vulcanmummie | lacking information goddard | 00:12 |
L3top | !pastebin | boof give me a pastebin of the output of xrandr -q | 00:12 |
ubottu | boof give me a pastebin of the output of xrandr -q: For posting multi-line texts into the channel, please use http://paste.ubuntu.com | To post !screenshots use http://imagebin.org/?page=add | !pastebinit to paste directly from command line | Make sure you give us the URL for your paste - see also the channel topic. | 00:12 |
vulcanmummie | I just got my computer back from my computer guy so i would hope my harddisk was in good shape, pretty shitty if he gave it back to me messed up | 00:13 |
=== marsha_ is now known as mdg2 | ||
rwlyonsjr | @WeThePeople I was able to see the file, but it will not allow me to edit it... | 00:13 |
WeThePeople | rwlyonsjr, what is the file ext? | 00:13 |
=== jen is now known as knickknack | ||
pngl | Hi. I cannot install the ATI graphics drivers on Ubuntu 12.04 (from a 10.10 upgrade) : I get 'aticonfig: command not found'. I used the info provided here: http://askubuntu.com/questions/124292/what-is-the-correct-way-to-install-ati-catalyst-video-drivers | 00:14 |
vulcanmummie | I don't want to send it back to him because he had it for a month last time | 00:14 |
mdg2 | anyone seen yourfriendisaac? | 00:14 |
L3top | pngl: lspci -nn | grep VGA | 00:14 |
L3top | find a new computer guy vulcanmummie. | 00:14 |
rwlyonsjr | WeThePeople, it is a plain text file. It opens in gedit. When I attempt to save, it will not allow that | 00:14 |
boof | l3top thank you, http://paste.ubuntu.com/1296490/ | 00:14 |
MiningMarsh | rwlyonsjr, do you know the path to it? | 00:15 |
vulcanmummie | L3top, he's all I can afford, he is a friend of mine | 00:15 |
pngl | L3top: 1:00.0 VGA compatible controller [0300]: Advanced Micro Devices [AMD] nee ATI RV635 [Mobility Radeon HD 3650] [1002:9591] | 00:15 |
WeThePeople | rwlyonsjr, is their a error msg | 00:15 |
rwlyonsjr | MiningMarsh yes | 00:15 |
L3top | rwlyonsjr: it is likely a permissions error. you can run in a terminal gksudo gedit /path/to/file | 00:15 |
MiningMarsh | sudo gedit <path> | 00:15 |
knickknack | heyyy I have a question, could someone teach me how to install a windows 7 thing on a virtualbox? | 00:15 |
boof | ubottu http://paste.ubuntu.com/1296490/ | 00:16 |
L3top | vulcanmummie: doesn't sound like you can afford him afterall. | 00:16 |
MiningMarsh | that way it will spit errors to the console | 00:16 |
ahmad | hi guys | 00:16 |
vulcanmummie | heh, I have no other options tho | 00:16 |
ahmad | can anyone please help me, i have an error in my /etc/sudoers file for ubuntu 12.10 i am aunable to use the sudo command to edit that file | 00:16 |
rwlyonsjr | WeThePeople, even with sudo it says permission denied... I can "open" the file without an issue, I just can't make any changes to it | 00:16 |
L3top | pngl: ATI dropped support for your card. You cannot use the fglrx driver in quantal. | 00:16 |
MiningMarsh | what is the file? | 00:16 |
=== June is now known as Guest43781 | ||
MiningMarsh | ahmad, do you know your root password? | 00:17 |
pngl | L3top: ATI says otherwise. What makes you think it dropped support? | 00:17 |
rwlyonsjr | MiningMarsh, disable_ani | 00:17 |
L3top | boof: Can how is this thing attached? Is there a converter involved? (eg DVI > VGA) | 00:17 |
ahmad | MiningMarsh, yes i get the following errors when i try to use sudo | 00:17 |
ahmad | sudo: parse error in /etc/sudoers near line 32 | 00:17 |
ahmad | sudo: no valid sudoers sources found, quitting | 00:17 |
ahmad | sudo: unable to initialize policy plugin | 00:17 |
WeThePeople | rwlyonsjr, type sudo -i in terminal then type gksudo nautilus | 00:17 |
L3top | ATI does not say otherwise. What they say is that they have provided a legacy driver which does not function under Xorg 1.3, and under quantal. | 00:18 |
DaemonicApathy | WeThePeople: Why not just skip to the second half of that? | 00:18 |
MiningMarsh | ahmad: hit left ctrl + left alt + f1, and log into root from tehre. Then visudo | 00:18 |
vulcanmummie | its trying to boot from a disk and I dont have a disk | 00:18 |
PatrickDickey | vulcanmummie go to https://wiki.ubuntu.com/WubiGuide and look at the troubleshooting guide near the bottom. Specifically the "Cannot Boot into Ubuntu" section. | 00:18 |
boof | l3top how is what attached | 00:18 |
vulcanmummie | it wont boot into windows either PatrickDickey | 00:18 |
ahmad | MiningMarsh, thanks totally forgot about using different tty, let me try | 00:18 |
WeThePeople | daemonicapathy, apparently it doesnt work | 00:18 |
L3top | WeThePeople: that is not what you do... gksudo will be sufficient. Does not make sense to root up first | 00:19 |
vulcanmummie | PatrickDickey, I dont haave a disk for either | 00:19 |
L3top | the monitor boof...d o you have a converter, etc | 00:19 |
ahmad | MiningMarsh, visudo permission denied | 00:19 |
WeThePeople | rwlyonsjr, are you the admin on the machine? | 00:19 |
boof | l3top oh i should have said its a laptop from the beginning | 00:19 |
rwlyonsjr | WeThePeople, yes | 00:20 |
PatrickDickey | vulcanmummie, do you have any blank CD's or DVD's? | 00:20 |
pngl | L3top: So what can I do? | 00:20 |
L3top | boof... strange... yeah I should have picked that up with the backlight issue... just forgot... well it is weird boof... doesn't appear to understand the EDID data from the LVDS display... so it cannot give you more options... by the way... undo the nomodeset boot param and see if it will boot | 00:21 |
MiningMarsh | rwlyonsjr, check the file permissions to make sure its not read only for root | 00:21 |
MiningMarsh | or try sudo chmod +w /path/to/file | 00:21 |
boof | l3top okay. hopefully the screen won't go black again | 00:21 |
rwlyonsjr | MiningMarsh, ok | 00:22 |
L3top | pngl: you can run 1204, or you can run the radeon driver in quantal. You can TRY installing the 12.6 legacy driver from AMD, but nobody I have seen who tried it was able to get gravy. | 00:22 |
boof | l3top thanks for your patience. | 00:22 |
vulcanmummiex | sigh | 00:22 |
pngl | L3top: Wow. Sorry. I AM running 12.04. Didn't realized I had typed 12.10. I apologize for that. | 00:22 |
knickknack | where can I find a working windows7 ISO? | 00:22 |
escott | knickknack, not here | 00:23 |
L3top | lol... then you should be ok installing fglrx | 00:23 |
L3top | pngl: ^ | 00:23 |
vulcanmummiex | PatrickDickey, I have some dvd's should I try to burn ubuntu using my cousinns laptop? my computer is dead in the water | 00:23 |
AndyOpie150 | Which Ubuntu version had the Intel-hide option for the Unity application dock? Was it 11.10? | 00:23 |
knickknack | escott, you're so helpful -.- | 00:23 |
boof | l3top and btw i clearly didn't install ubuntu myself but watched another guy do it for me | 00:23 |
pngl | L3top: But it does not work. aticonfig gives 'command not found', and glxinfo gives 'Xlib: extension "GLX" missing on display ":0.0".' | 00:24 |
wilee-nilee | knickknack, If you can prove to MS you have a key and are legal you can get one for free. | 00:24 |
ahmad | MiningMarsh, visudo keeps giving me permission denied message, any ideas? | 00:24 |
PatrickDickey | vulcanmummie, yes you should. Get the same version of Ubuntu as you installed via wubi (although that's not really a requirement). Then follow the link that L3top gave you earlier about disk checking for beginners. | 00:24 |
TheRiceKing | Hi everyone | 00:25 |
MiningMarsh | ahmad, try "chmod +rw /etc/sudoers" while logged in as root, then "visudo". | 00:25 |
L3top | pngl: I am not sure why you are dealing with aticonfig... I just want you to sudo apt-get install fglrx and reboot. | 00:25 |
wilee-nilee | ahmad, Are you in a admin account? | 00:25 |
knickknack | wilee-nilee, my mom has windows7 on her computer, how do go about getting the same thing she has | 00:25 |
vulcanmummiex | I can't use my computer tho PatrickDickey | 00:25 |
TheRiceKing | I need help making the "Dash Home" window bigger. | 00:25 |
wilee-nilee | knickknack, buy a release. | 00:25 |
WeThePeople | knickknack, see ##windows | 00:25 |
pngl | L3top: Sorry. I'll do that and come back. | 00:25 |
OerHeks | AndyOpie150, what is "Intel-hide option" ? | 00:26 |
PatrickDickey | You'll have to use your cousin's then vulcanmummie. Once you've burned the LiveCD, you should be able to boot your computer using it. | 00:26 |
j4jacckj | Hello? | 00:26 |
boof | actually btw l3top, he just told me its set to GRUB_CMDLINE_LINUX DEFAULT quiet splash nomodeset acpi_osi=\"Linux\" | 00:26 |
pngl | L3top: it says fglrx is already installed and up-to-date. | 00:26 |
TheRiceKing | CAn someone please tell me how to make the Dash Home window that displays the apps bigger? | 00:26 |
AndyOpie150 | nicknack: It depends on your computer, if it's an older computer like mine it won't work properly. | 00:26 |
PatrickDickey | TheRiceKing, when you click on the dash button, in the upper left-hand corner, it should have the maximize and close buttons. | 00:27 |
L3top | boof I want you to remoeve nomodeset... might just drop quiet splash for now too | 00:27 |
ahmad | MiningMarsh, this is a brand new installation i haven't had the chance to enable the root account and i can't since i cant use any sudo commonads | 00:27 |
TheRiceKing | OH I LOVE YOU!!!!! | 00:27 |
L3top | acpi_osi might help with the backlighting... dunno... | 00:27 |
TheRiceKing | That did it. Thank you so much | 00:27 |
wilee-nilee | ahmad, A fresh install the account should be a admin account | 00:27 |
j4jacckj | My issue regards Asterisk. I wish to set up G722 wideband MOH but it always comes out as 8kHz upsampled to 16kHz | 00:28 |
PatrickDickey | TheRiceKing, no problem. I ran into that myself on a small screen. ;-) | 00:28 |
OerHeks | AndyOpie150, never heard and can't find any "Intel-hide option", maybe someone else ? | 00:28 |
ahmad | wilee-nilee, yes it is labeled as an administrator however i am not the owner of sudoers file 'root' is and i can not change anything inside the file | 00:28 |
MiningMarsh | ahmad: I do you ahve a live cd handy? | 00:28 |
TheRiceKing | I got rid of the Amazon advertisement on the Dash Home but how do I also get rid of Ubuntu App suggestions as well? | 00:28 |
MiningMarsh | *have | 00:28 |
ahmad | MiningMarsh, yes i do have that with me | 00:29 |
rwlyonsjr | MiningMarsh, that did not do it.... Still can not make changes to the file | 00:29 |
MiningMarsh | ahmad: I think your only choice is too chroot into your ubuntu, and add the root user from your live cd. | 00:29 |
MiningMarsh | *to | 00:29 |
systems7 | hello all | 00:29 |
DaemonicApathy | OerHeks: I believe he was referring to the autohide. | 00:29 |
MiningMarsh | ahmad: do you know how to mount something? | 00:29 |
ahmad | MiningMarsh, i think so too I was really trying to avoid that | 00:29 |
AndyOpie150 | It allows the Unity application dock to hide when you need the space when you have something big on your screen like a web page. | 00:29 |
ahmad | MiningMarsh, yes :) umount -o loop file.iso :P | 00:30 |
systems7 | i have a abit bp6 with dual celeron 400 mhz. when i boot from CD the boot cd loads for a senond and they restarts | 00:30 |
systems7 | what ist he problem? | 00:30 |
PatrickDickey | TheRiceKing, the short answer to your question is search for a list of the lenses. And uninstall (sudo apt-get remove) the one that controls the suggestions. | 00:30 |
MiningMarsh | ahmad: nope. I mean mount your hard drive from a live cd. | 00:30 |
systems7 | im trying to instlal xubuntu | 00:30 |
systems7 | 12.10 | 00:30 |
TheRiceKing | Is there a way to get rid of the "More Suggestions" that appears in the Dash Home? | 00:30 |
ahmad | MiningMarsh, yes i do know how | 00:30 |
DaemonicApathy | AndyOpie150: The easiest config I've found for that is within compizconfig-settings-manager | 00:31 |
systems7 | will xununtu 12.10 work on a dual 400 mhz 756mb ram? | 00:31 |
wilee-nilee | systems7, I would try lubuntu | 00:31 |
PatrickDickey | TheRiceKing, make sure that it doesn't break anything that you want to keep though. Otherwise you might have to live with it. | 00:31 |
MiningMarsh | ahmad: Well, mount your hard drive, and then "sudo chroot /path/to/mount/point" from your live cd. Then add a root suer as normal. Do not try to start x or anything. Do you know how to add root from the command line? | 00:31 |
systems7 | thanks for the recomendation | 00:31 |
WeThePeople | rwlyonsjr, what dir is it located in | 00:31 |
vulcanmummiex | PatrickDickey, so I dont have to install the same version? i can go ahead and get the new one? | 00:32 |
ahmad | MiningMarsh, yes I do | 00:32 |
defekt | !requirements | systems7 | 00:32 |
ubottu | systems7: Hardware requirements to install, boot and comfortably use Ubuntu are listed at https://help.ubuntu.com/community/Installation/SystemRequirements - For a !flavor with lower requirements, see !Xubuntu or !Lubuntu | 00:32 |
systems7 | !Lubuntu | 00:32 |
ubottu | lubuntu is Ubuntu with LXDE instead of !GNOME as desktop environment, which makes it extremely lightweight. See https://wiki.ubuntu.com/Lubuntu - /join #lubuntu for lubuntu support. | 00:32 |
PatrickDickey | vulcanmummie, yes you can get the new one. You're not actually "installing" it though. Just use it to do the suggestions that L3top gave you in the earlier link. | 00:32 |
rwlyonsjr | WeThePeople, it is nested under the "sys/kernel/debug/ieee80211/phy0/ath9k" | 00:33 |
vulcanmummiex | crap I already forgot that link, after I boot my computer will you give me that link again PatrickDickey ? | 00:33 |
ahmad | another question please: anyone know how to add a saved profile and load it in ccsm (compiz-settings-manager) via command line for automation purposes rather then manually importing file? | 00:33 |
L3top | http://www.howtogeek.com/howto/37659/the-beginners-guide-to-linux-disk-utilities/ take a look at this vulcanmummie | 00:33 |
AndyOpie150 | Tried that as well. No go, it's still just creates a transparent area and moves the dock out to the right. Then when it hides it goes to the left. It is still taking up the same space. I guess I'll try 11.10 and see if the intel-hide is in it. | 00:34 |
ahmad | also thank you MiningMarsh I will try that soon :) | 00:34 |
ahmad | if it all fails no problem I can just save time and reformat in 5 minutes :P | 00:34 |
MiningMarsh | ahmad: ~/.config/compiz | 00:35 |
MiningMarsh | I think everything is in tehre | 00:35 |
vulcanmummiex | l3top I may come back and ask you again once I get it booted up is that ok? you guys are helping me keep my computer, I didn't want to give it up for a freaking month | 00:35 |
ahmad | MiningMarsh, ahh thank you i tried backing up the .compiz-1 directory before and it didn't work so i will try the ~/.config/compiz | 00:35 |
PatrickDickey | vulcanmummie, I don't think it's a hard drive issue though. I think that the wubi installation messed something up. But, that's way beyond anything I know about. Follow L3top's link first though, just to make sure. | 00:35 |
MiningMarsh | ahmad: also try .gconf/compiz | 00:36 |
n0sq | well this sucks - i just installed ubuntu 12.10 and it formatted my /home directory when i didn't ask it to do it | 00:36 |
vulcanmummiex | ok thank you guys so much | 00:36 |
ahmad | MiningMarsh: yes the .gconf folder includes a lot of configurations i need including keyboard shortcuts so that is already in the backup script :) | 00:36 |
L3top | I tend to think PatrickDickey may be correct. YOu should not do wubi installs for the record... that is a test environment according to the devs... and it is a glitchy one at that. | 00:36 |
L3top | vulcanmummiex: ^ | 00:37 |
ahmad | brb, fixing root issue | 00:37 |
vulcanmummiex | yes, I started having problems after I did it | 00:37 |
ActionParsnip | n0sq: it will only do what you say, it isn't self thinking | 00:37 |
MiningMarsh | anyone know off the top of their head waht the pulseaudio config tool's name is? | 00:37 |
vulcanmummiex | can I uninsstall the ubuntu I installed thru windows earlier? once I'm using the dvd to boot I mean? | 00:37 |
vivid | vulcanmummiex, you can uninstall it from Add/Remove Software in Windows | 00:38 |
WeThePeople | rwlyonsjr, right click on the file and select properties then select the permissions tab and tell me what the owner dropdown menu is currently at. | 00:38 |
PatrickDickey | vulcanmummie, do you have anything in the ubuntu drive that you absolutely need to save? If not, I would say try to boot into Windows, and uninstall "Ubuntu" through the Add/Remove Programs. | 00:38 |
vulcanmummiex | oh nice, thanks vivid | 00:38 |
L3top | vulcanmummiex: I think PatrickDickey does not understand that you cannot boot windows... no that cannot be done from the live disk... we are just using the live disk to rule out a bad drive | 00:39 |
WeThePeople | rwlyonsjr, is currently set at. | 00:39 |
vulcanmummiex | when I boot using this dvd will i still be able to use windows later? I am starting to prefer ubuntu but there are others in the house that use my computer sometimes | 00:39 |
vulcanmummiex | ok gothca | 00:39 |
rwlyonsjr | WeThePeople, root - I did try and change that to me, but i still could not edit it | 00:39 |
vulcanmummiex | gotcha | 00:39 |
L3top | vulcanmummiex: you are going to probably have to boot into a windows disk and fixmbr/fixboot from the recovery console ONCE a bad drive is ruled out. | 00:40 |
WeThePeople | rwlyonsjr, root is good, so gksudo nautilus should work then.. what distro you on? | 00:40 |
L3top | WeThePeople: Stop giving people terrible advice. You should NOT run nautilus as root. | 00:41 |
L3top | almost no condition where that is advisable | 00:41 |
rwlyonsjr | WeThePeople, Ubuntu 12.10 - I had the same issue with 12.04 | 00:41 |
vulcanmummiex | I dont think I have a windows disk | 00:42 |
wilee-nilee | vulcanmummiex, You seeing a grub error now looks like grub> | 00:42 |
WeThePeople | l3top, then tell rwlyonsjr, instead of complain what i tell him..ok | 00:42 |
L3top | I did, before you took over. | 00:42 |
rwlyonsjr | L3top, do you have any solution to my issue, I did not see your response. | 00:43 |
L3top | WeThePeople: I do not correct you to try and humiliate you, but to make it clear to all in channel that that is a very bad idea. | 00:43 |
L3top | rwlyonsjr: you are trying to open a file with root permissions to edit, is that correct? | 00:43 |
ahmad | thank you MiningMarsh: i was unable to solve the method using chroot but after mounting hard drive i used live cd sudo instance and vim editor to solve the issue | 00:43 |
Jimster480-L | wut | 00:43 |
mefistofeles | hey, just upgraded ubuntu from 12.04 to 12.10 and unity is not displaying the sidebar or the top bar, any ideas what to do? | 00:43 |
n2diy_ | anyone using Mozilla's Thimble webpage maker? Curious how painful the install/setup might be? | 00:44 |
MiningMarsh | ahmad: probably better to do that then add the root anyways >< | 00:44 |
wilee-nilee | vulcanmummiex, If you confirm that the disc is good, you can load a bootloader from a ubuntu disc that will boot windows if needed, then make a recovery disc. | 00:44 |
rwlyonsjr | L3top, I am having a wireless issue and I am hoping that editing this file (disable_ani) will fix the issue that I have been having, but I have not been able to edit the file | 00:44 |
L3top | gksudo gedit /path/to/file | 00:45 |
TheRiceKing | I am learning about Unity "Lens" but I would like to manage it and remove the annoying Ubuntu app suggestion lens. Is there a lens manager? | 00:45 |
vulcanmummiex | ok I'm switchinig to my cousin's laptop, brb oh ok thanks wilee-nilee I may have to ask you about that in a bit! switching computers laters all | 00:45 |
ahmad | well thanks to you it was solved in a fraction of the time I would of took me to think of it myself :) | 00:45 |
ActionParsnip | TheRiceKing: its just a package | 00:45 |
rwlyonsjr | L3top, I have tried that, and the file will not save with changes | 00:45 |
ActionParsnip | TheRiceKing: uninstall the package with the lens you don't want and log off and on | 00:45 |
TheRiceKing | But how? | 00:45 |
TheRiceKing | Where is it located | 00:46 |
TheRiceKing | and how do I know it corresponse to the one I want to remove? | 00:46 |
L3top | rwlyonsjr: what is the location of the file? In the meantime sudo apt-get install nano... does it produce an error in console when trying to save? If so pastebin it | 00:46 |
=== Youri is now known as YBook | ||
dr_willis | The app suggestion is not a lense - i belive theres some settings to disable the suggestions.. | 00:46 |
ahmad | command -v package-name or which package-name to discover package location \n and sudo apt-get -y --purge remove package-name | 00:47 |
TheRiceKing | I have disable everything in privacy, but still there | 00:47 |
TheRiceKing | I removed amazon already | 00:47 |
dr_willis | You mean the suggestions in softwre center | 00:47 |
rwlyonsjr | L3top, what is pastebin? | 00:47 |
TheRiceKing | yes, suggestion of software center | 00:47 |
L3top | rwlyonsjr: the only thing I can think of that would not be savable would be in the kernel subsystem... | 00:47 |
rwlyonsjr | L3top, sys/kernel/debug/ieee80211/phy0/ath9k/disable_ani | 00:48 |
L3top | ah | 00:48 |
dr_willis | this mnethod may work TheRiceKing http://www.omgubuntu.co.uk/2012/01/ubuntu-12-04-finally-lets-you-disable-apps-for-download-in-unity | 00:48 |
ahmad | rwlyonsjr, it is a website where you can paste your code and share it with others, allows multiple people to work on the same file and colorcode each individuals changes | 00:48 |
L3top | rwlyonsjr: that is generally created on the fly by the kernel and not editable. What guide are you following that tells you to edit that? | 00:48 |
TheRiceKing | ok I'll give that a go | 00:48 |
les_ | Hello everyone. Installed Ubuntu 12.10 days ago and software updater tells me every day my computer is up to date, but it has only updated 3 or 4 packages since install. Is anyone else experiencing this? | 00:48 |
TheRiceKing | I also would like to learn more about managing lens | 00:48 |
rwlyonsjr | L3top, I am attempting to echo 1 to that file | 00:49 |
L3top | !pastebin | rwlyonsjr | 00:49 |
ubottu | rwlyonsjr: For posting multi-line texts into the channel, please use http://paste.ubuntu.com | To post !screenshots use http://imagebin.org/?page=add | !pastebinit to paste directly from command line | Make sure you give us the URL for your paste - see also the channel topic. | 00:49 |
ActionParsnip | les_: run: sudo apt-get update; sudo apt-get upgrade; sudo apt-get dist-upgrade | 00:49 |
dr_willis | https://wiki.ubuntu.com/Unity/Lenses | 00:49 |
TheRiceKing | What are they? Where they are? Where can I find find more and remove the ones I don't like | 00:49 |
MiningMarsh | les_: shouldnt be an issue. If you really want to be sure do "sudo aptitude update" in a terminal | 00:49 |
vulcanmum | what the heck, this xchat window is huge, it won't minimise... | 00:49 |
MiningMarsh | les_: and then see if software center wants to upgrade thigns | 00:49 |
les_ | ActionParsnip yes I had tried this at one point, but no difference | 00:49 |
TheRiceKing | time for some reading, thank you all | 00:50 |
les_ | MiningMarsh: Thanks. Trying now. | 00:50 |
=== captiankirk is now known as orionsbelt | ||
rwlyonsjr | L3top, this is the command I want to run: echo 1 > /sys/kernel/debug/ieee80211/phy0/ath9k/disable_ani | 00:50 |
PatrickDickey | TheRiceKing, google "disable apps available for download ubuntu". As for the complete list of lenses, you can google unity lens list. | 00:50 |
ActionParsnip | les_: does the update command hit the repos? | 00:50 |
MiningMarsh | les_: pastebin "cat /etc/apt/sources.list" | 00:50 |
ejcweb | I'm using Chromium as my web browser, and I want to check to see at what time (if at all) I POSTed a particular form. Is there a way I can find this out, either from a system point of view, or from within my browser? | 00:51 |
WeThePeople | actionparsnip, do you use conky? | 00:51 |
ActionParsnip | WeThePeople: no I don't | 00:52 |
L3top | rwlyonsjr: then you might sudo -i enter pass then try to echo 1 into that file | 00:52 |
les_ | ActionParsnip: yes it checks everything fine, it just says I'm up to date. But I've never had that happen for days right after a new release. | 00:52 |
L3top | or sudo echo "1" | tee > /sys/kernel/debug/ieee80211/phy0/ath9k/disable_ani | 00:52 |
ActionParsnip | L3top: other way around dude | 00:53 |
ActionParsnip | L3top: sudo on the tee ;) | 00:53 |
L3top | right | 00:53 |
L3top | or echo "1" | sudo tee > /sys/kernel/debug/ieee80211/phy0/ath9k/disable_ani | 00:53 |
ActionParsnip | L3top: and you don't need the > | 00:53 |
* L3top is so bad at that... every day you fix those for me... | 00:53 | |
OerHeks | les_, same with Kubuntu, not a lot of updates, i wouldn't worry about it. | 00:53 |
rwlyonsjr | L3top: ok let me try both | 00:53 |
L3top | you don't? I just assumed you did because I know >> appends | 00:53 |
=== darkham is now known as krabador | ||
L3top | rwlyonsjr: only need one of the two. | 00:54 |
funyu | Anyone familiar with migrating .gnome2/keyrings to a new harddisk? I moved said folder to my new disk, but seahorse does not pick up my keyrings. | 00:54 |
rwlyonsjr | l3top: do I need sudo with both? | 00:54 |
les_ | MiningMarsh: do I just paste that whole line into terminal? Tried it, but not doing anything | 00:54 |
halp | hello | 00:55 |
=== qos|away is now known as qos | ||
halp | i need some quick help with ubuntu | 00:55 |
PatrickDickey | funyu, I would use gpg to export them (if they're your personal keys) and then import them on the new hard drive. | 00:55 |
L3top | rwlyonsjr: the two options are sudo -i (this will give all actions root priveleges) or echo "1" | sudo tee /sys/kernel/debug/ieee80211/phy0/ath9k/disable_ani | 00:55 |
halp | how to i change directories to a different hard drive? | 00:55 |
funyu | Patrick, well the old environment is gone already. | 00:55 |
ahmad | halp: cd /media/hardrive-name | 00:56 |
blackshirt | halp, mount it before | 00:56 |
funyu | I just have the .gnome2/keyrings folder and the contained files | 00:56 |
les_ | OerHeks Really? I've never had that happen. Usually right after each release they are quite busy fixing things. Well, maybe everything is okay then. | 00:56 |
halp | how to i mount a hrd drive | 00:56 |
halp | im dumb when it comes to local operations | 00:56 |
ahmad | halp: sudo fdisk -l #this command will give u a list of hard drives | 00:56 |
ahmad | halp: if your hard drive is /dev/sda5 (for example) then u need to mount it | 00:57 |
ahmad | halp: you can mount it with sudo mount /dev/sda5 /media/folder-name | 00:57 |
MiningMarsh | les_: really? o_O | 00:57 |
rwlyonsjr | l3top: using sudo -i I still got permission denied. Using the last command you gave me it just echoed 1 back to the terminal | 00:57 |
les_ | MiningMarsh: be nice :-) | 00:57 |
ahmad | halp: keep in mind the folder in media may not exist and you may have to create one manually using sudo mkdir /media/harddrive-name | 00:57 |
|Anthony| | what should the permissions be on boot/vmlinuz be? | 00:58 |
L3top | cat /sys/kernel/debug/ieee80211/phy0/ath9k/disable_ani | 00:58 |
L3top | rwlyonsjr: ^ | 00:58 |
OerHeks | halp i use pygdm to mount drives in fstab, it is a gui-tool | 00:58 |
MiningMarsh | les_: try sudo ls /etc/apt | 00:58 |
selinuxium | Hi everyone. having an issue following the upgrade to Q... Basically Compiz isn't working so I don't get any side bar or topbar.. | 00:58 |
PatrickDickey | halp, building on what ahmad told you, if you type mount without anything else, you can verify if it's already mounted (after doing the fdisk -l command). | 00:58 |
selinuxium | Sould anyone help | 00:58 |
les_ | MiningMarsh: are you running 12.10? Have you noticed the same thing at all? | 00:58 |
selinuxium | Could... | 00:58 |
halp | terminal-only system | 00:58 |
MiningMarsh | les_: I am just trying to check if your ubuntu points at the right repositories. I am running something else... | 00:59 |
=== a`non`e`mus is now known as Ex0deus | ||
halp | okay cool i got it mounted, now, how do i change the home directory of vsftp to that directory? | 00:59 |
OerHeks | halp correction > pysdm | 00:59 |
rwlyonsjr | L3top: that seemed to work. I need to restart my wireless to see if the problem is fixed... be right back | 00:59 |
les_ | MiningMarsh: apt.conf.d sources.list sources.list.save trusted.gpgtrusted.gpg.d | 00:59 |
les_ | preferences.d sources.list.d trustdb.gpg trusted.gpg~ | 00:59 |
ahmad | halp: change directory command 'cd' | 01:00 |
rwlyonsjr | L3top: thanks for your help so far | 01:00 |
L3top | np rwlyonsjr | 01:00 |
MiningMarsh | les_: sudo gedit /etc/apt/sources.list and paste wahts int eh file to pastebing please. | 01:00 |
PatrickDickey | halp, are you trying to change the home directory permanently? | 01:00 |
ActionParsnip | MiningMarsh: gksudo for gedit | 01:00 |
ahmad | PatrickDickey, lol i wondered that too | 01:00 |
les_ | MiningMarsh: everything else you said I understand, but what is pastebin? | 01:01 |
MiningMarsh | ActionParsnip: is there something wrong with sudo for gedit (curious)? | 01:01 |
halp | PatrickDickey: yes | 01:01 |
ahmad | les_ i described pastebin above, or google :) | 01:01 |
MiningMarsh | les_: http://pastebin.com/ hit submit, then give me the link. its a text sharing website | 01:01 |
ActionParsnip | !gksudo | MiningMarsh | 01:01 |
ubottu | MiningMarsh: If you need to run graphical applications as root, use « gksudo », as it will set up the environment more appropriately. Never just use "sudo"! (See http://psychocats.net/ubuntu/graphicalsudo to know why) | 01:01 |
les_ | MiningMarsh: K hang on | 01:02 |
natsirt | has anyone set up a load balancer with ubuntu before? I am having issues. | 01:02 |
PatrickDickey | halp, before you can do that, you'l need to add that drive to /etc/fstab. Otherwise you'll run into problems when you reboot. And you'll probably want to mount it somewhere other than /media (probably /mnt). | 01:03 |
halp | hm, im having some trouble, i created the directory /media/ftp, then mounted with mount /dev/sdb1 /media/ftp , but now it is telling me that that file does not exist and the only dir int here is lost+found | 01:03 |
rwlyonsjr | L3top: what you told me to do worked, but it seems like my problem still remains.... | 01:03 |
les_ | MiningMarsh: http://pastebin.com/gvjTXSk8 | 01:03 |
MiningMarsh | ActionParsnip: cant that just be solved with sudo -u root? | 01:03 |
rwlyonsjr | L3top: slightly improved though | 01:03 |
PatrickDickey | halp, type mount without anything else, and see where /dev/sdb1 is mounted. | 01:03 |
halp | okay | 01:04 |
MiningMarsh | les_: youa re good. your system should be up to date. | 01:04 |
MiningMarsh | "*are | 01:04 |
ahmad | Can anyone please direct me to some resources on creating a custom daemon and have it automatically load on start up.. i wish to have a script run on boot every time to adjust system settings automatically | 01:04 |
halp | it says it is on media | 01:04 |
les_ | MiningMarsh: Thanks. Weird. Have a good one! | 01:04 |
halp | PatrickDickey: can i pm you? | 01:04 |
PatrickDickey | halp, sure. | 01:04 |
escott | ahmad, /etc/rc.local | 01:04 |
L3top | rwlyonsjr: can you explain the problem we are trying to solve? Just slow or frequent disconnects... or... and what is the hardware? lspci | grep -i ethernet | 01:05 |
L3top | er | 01:05 |
L3top | rwlyonsjr: lspci | grep -iE '(wlan|wireless|802)' | 01:05 |
Jimster480-L | has anyone submitted a patch to the linux kernel before | 01:06 |
rwlyonsjr | L3Top: I have very low wireless signal. I am running an Asus Zennbook UX31E - it uses ath9k driver | 01:06 |
Jimster480-L | or has anyone uesd the linux email list and knows how to email the list? | 01:06 |
ahmad | thank you escott, i haven't played with rc.local so i will try to do more research to find out | 01:06 |
willdabeast | jimster480: haha from cs :) | 01:06 |
escott | Jimster480-L, check http://kernelnewbies.org/ | 01:06 |
L3top | can you giev me the output of that lspci grep? | 01:07 |
Jimster480-L | yes I am the same Jimster. People keep asking me that. Yes I made SSW lol | 01:07 |
Jimster480-L | Along with a whole bunch of other things | 01:07 |
ActionParsnip | Jimster480-L: just eamil the address, it will go to the members | 01:07 |
willdabeast | jimster480: not really askin you, just assumed you're the same, not sure why anyone would want to copy that name | 01:07 |
Jimster480-L | ActionParsnip: which address? i tried to email the linux-kernel one | 01:07 |
ActionParsnip | ahmad: add the commands ABOVE the 'exit 0' line | 01:08 |
Jimster480-L | willdabeast: well its been copied hardcore on other IRC's before. | 01:08 |
ahmad | ActionParsnip, there is no etc/rc.local file in ubuntu 12.10 | 01:08 |
ahmad | i may have to create it | 01:08 |
Jimster480-L | willdabeast: people were scamming on some other IRC using my name "selling" cheats and other stuff to people. | 01:08 |
rwlyonsjr | L3top: you want me to run lspci | grep | 01:08 |
willdabeast | jimster480: lame | 01:09 |
L3top | rwlyonsjr: lspci | grep -iE '(wlan|wireless|802)' | 01:09 |
Jimster480-L | willdabeast: and while its true i do sell assorted stuff including cheats, I do not do it or advertise it on any IRC other than my own | 01:09 |
defekt | !ot | 01:09 |
ubottu | #ubuntu is the Ubuntu support channel, for all Ubuntu-related support questions. Please use #ubuntu-offtopic for other topics (though our !guidelines apply there too). Thanks! | 01:09 |
ActionParsnip | ahmad: should be, maybe it's a change. This thing runs precise so cannot check. | 01:09 |
ActionParsnip | ahmad: be sure to mark the file as executable and end the file with: exit 0 | 01:09 |
rwlyonsjr | L3top: Atheros Communications Inc. AR9485 Wireless Network Adapter (rev 01) | 01:10 |
ahmad | ActionParsnip, definitely.. i am going to test out the script now, brb | 01:10 |
vulcanmummie | ok I'm making the disk using toshiba disc creator which I've never used...eep | 01:10 |
vulcanmummie | this is all new territory for me, thank you guys that are helping me! | 01:11 |
d4rkh4nd | anyone know whay the #java is closed ? | 01:11 |
Froward | I am really loving linux, I just wish it didn't overheat my laptop sometimes. | 01:11 |
L3top | rwlyonsjr: http://ubuntuforums.org/showthread.php?t=2018238 did you see this? | 01:11 |
Froward | My laptop doesn't handle getting hot very well.. it shuts down instantly. | 01:12 |
defekt | d4rkh4nd: perhaps ask in #freenode | 01:12 |
d4rkh4nd | Forward: If you over heating when you run linux its not Liunx doing it lol | 01:12 |
wilee-nilee | d4rkh4nd, Open here do you have to be registered? | 01:12 |
ahmad | Froward, I had the same problem however after using 'mesa-utils' to install my intel HD 3000 graphics the heating went down considerably | 01:12 |
vulcanmummie | L3top after I boot my computer using the ubuntu disk should I get a chat to talk to you or just continue using this computer to do that? | 01:12 |
nyRednek | ok, i'm trying to install flash player...the download often fails...i've grabbed the file with wget -c...where do i put it? | 01:12 |
Jimster480-L | Man this is annoying, do you know what the correct address to email the linux-kernel list is? I really want to submit my modifications/optimizations to the official kernel. | 01:12 |
Froward | d4rkh4nd: derp herp derp | 01:13 |
wilee-nilee | d4rkh4nd, Actually I got ##java | 01:13 |
Froward | ahmad: really! I'll ook into that, thanks :) | 01:13 |
L3top | vulcanmummie: it would make things easier to just copy and paste commands if you were on the machine... but that link should tell you what you need to know. | 01:13 |
defekt | !lm-sensors | d4rkh4nd | 01:13 |
ubottu | d4rkh4nd: To access CPU temperature sensors and detect fan speeds, install the lm-sensors package. See https://help.ubuntu.com/community/SensorInstallHowto for installation and usage instructions. | 01:13 |
d4rkh4nd | okay ill try that | 01:13 |
MiningMarsh | myRednek: did you downlad a file ending in .deb? | 01:13 |
d4rkh4nd | Forward: well you sounded like you thought it was Linux fault lol no offence | 01:14 |
nyRednek | so i can run a dpkg --configure -a and get somewere | 01:14 |
escott | Jimster480-L, you are going to get flamed bad with your current approach | 01:14 |
nyRednek | MiningMarsh: oh, that's been grabbed and installed, i'm referring to the gz that the dpkg --configure -a wants to grab | 01:14 |
vulcanmummie | L3top I'll go ahead and get xchat, I'm just not clear what I am supposed to do if I find out my disk is fine | 01:14 |
Froward | d4rkh4nd: I assumed yes, you assumed no. same difference :) | 01:15 |
MiningMarsh | myRednek: ah. Try and extract the .deb and then poke in the preinst file to see where it stores the gz | 01:15 |
d4rkh4nd | lol | 01:15 |
n2diy_ | Why doesn't my update manager show the 12.10 upgrade? I ran the check twice. | 01:15 |
rwlyonsjr | L3top: I added that file.. I am not sure I did it correctly.... They added a <cr> after the line and I am not sure what that is | 01:15 |
escott | n2diy_, you might be set to lts only | 01:15 |
nyRednek | MiningMarsh: was kinda hoping someone would know offhand | 01:15 |
wilee-nilee | n2diy_, YOu probably need to go to software sources and change the update | 01:16 |
escott | n2diy_, edit /etc/update-manager/release-upgrades | 01:16 |
xangua | n2diy_: software center-edit-sources-update tab-set it to update to normal releases | 01:16 |
L3top | rwlyonsjr: character return (press enter) | 01:16 |
n2diy_ | escott, ah, I think your right. | 01:16 |
Jimster480-L | escott: flamed for what? Trying to contribute? The stupid webpage is like 100 pages long of pure text and it doesnt explain how to email the list or anything. | 01:16 |
nyRednek | MiningMarsh: let's put it this way, it keeps downloading to randomly-named gz files in /tmp...trying to find a way to make it quit and use a file i provided it | 01:16 |
rwlyonsjr | L3top: that is what I thought. You know, let me try that, because I did not do a line return | 01:16 |
escott | Jimster480-L, they have FAQ entry on this http://kernelnewbies.org/UpstreamMerge i suggest you read it | 01:16 |
MiningMarsh | myRednek: Then you prety much have to edit the deb file. If I remeber those files are named in such a way so that you can not replicate the name | 01:17 |
acer | anyone that can help with ubuntu core problem? | 01:17 |
ActionParsnip | n2diy_: chnage: Promt=lts to: Promt=normal | 01:17 |
nyRednek | MiningMarsh: well, that's no good | 01:18 |
L3top | !anyone | acer | 01:18 |
ubottu | acer: A high percentage of the first questions asked in this channel start with "Does anyone/anybody..." Why not ask your next question (the real one) and find out? See also !details, !gq, and !poll. | 01:18 |
ahmad | rc.local works great :) | 01:18 |
ActionParsnip | ahmad: weird it was removed....very obscure | 01:18 |
ActionParsnip | ahmad: will look into that later | 01:18 |
ahmad | ActionParsnip, i don't think it was for some reason i couldn't find it with ls | 01:18 |
acer | Acer aspire one d270 can not load ubuntu 12.10 or kubuntu 12.10 or xubuntu 12.10 or lubuntu 12.10, but it can load (off live cd, after install) ubuntu 12.04 fine. | 01:18 |
ahmad | ActionParsnip, however as soon as i tried vim it did load the file and works great ! | 01:19 |
wilee-nilee | acer, You familiar with nomodeset? | 01:19 |
L3top | nyRednek: you can "pin" the version. | 01:19 |
Froward | ahmad: sweet, I got 1190fps in glxgears. I guess it installed right? | 01:19 |
acer | wilee-nilee, no I do not but I can search online and give it a try? | 01:19 |
nyRednek | L3top: i'm listening | 01:19 |
Froward | ahmad: anyway thanks for that knowledge bump :D | 01:20 |
wilee-nilee | !nomodeset > acer | 01:20 |
ubottu | acer, please see my private message | 01:20 |
ActionParsnip | ahmad: appears you missed to leading / first time | 01:20 |
zeattacker00t | jancok | 01:20 |
ahmad | Froward, glad to hear that :) | 01:20 |
wilee-nilee | acer, I'm assuming it is a driver issue. | 01:20 |
wilee-nilee | !pm > acer | 01:20 |
ubottu | acer, please see my private message | 01:20 |
OerHeks | !rootirc | zeattacker00t | 01:20 |
ubottu | zeattacker00t: It's not technically our business, but we'd like to tell you that IRC'ing as root is a Very Bad Idea (tm). After all, doing anything as root when root is not needed is bad, and especially bad with software that connects to the Internet. | 01:20 |
ahmad | ActionParsnip, mostly likely yes it was a typo or something :| | 01:21 |
wilee-nilee | acer, i DON'T pm. ;) | 01:21 |
wilee-nilee | OOPS SORRY FOR THE CAPS | 01:21 |
acer | wilee-nile: it could be a driver issue according to this post http://ubuntuforums.org/showthread.php?t=2074161 | 01:21 |
wilee-nilee | lol | 01:21 |
nyRednek | L3top: how do you manage that? | 01:22 |
acer | I have acer aspire one d257, older mode, and all the ubuntu 12.10 load fine on that. | 01:22 |
L3top | nyRednek: you would create a file /etc/apt/preferences ... but as I backread... this works with a deb file... is this a deb file? | 01:22 |
nyRednek | L3top: nope, it's the file that flashplugin-installer is trying to download during config | 01:23 |
acer | but on my aspire one d270 it is not loading, could be due to driver issue or kernerl | 01:23 |
wilee-nilee | acer, Not sure I have a d250, but have not tried running 12.10 on it I think they are basically the same | 01:23 |
ActionParsnip | ahmad: thats why I was confused, its a standard file | 01:23 |
rwlyonsjr | L3top: my issue is still there... the signal just seems to be jumping around more. It stays higher for longer | 01:23 |
=== bazhang_ is now known as bazhang | ||
ahmad | ActionParsnip, yes sorry for the confusion :) often i type before I think lol | 01:24 |
L3top | rwlyonsjr: I would undo the other things that you have done to try and fix it prior to that fix. eg the echo | 01:25 |
rwlyonsjr | L3top: how can I undo the echo? | 01:25 |
L3top | echo what was originally there the same way. | 01:25 |
MiningMarsh | nyRednek: What is the deb's name/location on the web? | 01:26 |
d4rkh4nd | so how do i get into #java lol idk how to "register" | 01:26 |
TheRiceKing | awdawd | 01:27 |
b0x | o/ | 01:27 |
nyRednek | MiningMarsh: told you twice already, not talking about a deb, but a file the install program tries to run after you dpkg -i it | 01:27 |
=== Ex0deus is now known as Guest7454 | ||
MiningMarsh | nyRednek: I know. Iw as going to look at the deb and see if it has the location of where it expects the gz. | 01:27 |
rwlyonsjr | L3top: ok, I just did that, let me restart my wireless again. Be right back | 01:27 |
PatrickDickey | d4rkh4nd / msg NickServ REGISTER password (take the space out between the / and msg). | 01:27 |
d4rkh4nd | okay ty | 01:27 |
ActionParsnip | ahmad: no harm done dude, don't sweat it :D | 01:28 |
nyRednek | MiningMarsh: oh, i think it's flash-plugin-nonfree | 01:28 |
PatrickDickey | d4rkh4nd / msg NickServ help REGISTER will give you more infrmation about how to do it. | 01:28 |
stumper | i see all the paritions after running testdisk for the nth time..and data as well.. | 01:28 |
nyRednek | MiningMarsh: part of xubuntu-restricted-extras deps | 01:28 |
MiningMarsh | nyRednek: what version? (I am on gentoo at this moment and cant downlaod it without a link...) | 01:28 |
Jimster480-L | I'm going to have to read more of this tomorrow because it still doesnt explain why I cannot email the list. | 01:29 |
ahmad | sigh i think i am cursed.. just lost a two days old work file.. time to go afk and crunch bash :X | 01:29 |
nyRednek | MiningMarsh: http://packages.ubuntu.com/precise/flashplugin-installer | 01:29 |
vulcanmummie | L3top, are you there? I'm on the install welcome screen for ubuntu on my computer, should I install or try ubuntu to do what you said? | 01:29 |
nyRednek | MiningMarsh: this machine is far from up, and keeps dropping the download | 01:29 |
PatrickDickey | vulcanmummie try ubuntu | 01:30 |
dr_willis | Hmm.. if you want to install.. select install.. :) if you want to just try it out.. then 'try it out' ;P | 01:30 |
PatrickDickey | vulcanmummie if you do "install" it will actually install ubuntu on the drive. That would be the suggestion after you're able to boot into Windows (if you get to that point) and you want to install ubuntu alongside it. | 01:30 |
L3top | try ubuntu vulcanmummie | 01:31 |
rwlyonsjr | L3top: problem still in place... I actually see no difference with or without the echo, but the .conf file did change it some | 01:31 |
PatrickDickey | dr_willis, right now vulcanmummie is just using the Live CD to make sure the drive is good. ;-) | 01:31 |
vulcanmummie | ok, so I know you guys told me like three times so what do I do now to check my drive? | 01:31 |
L3top | vulcanmummie: rwlyonsjr I have dev work I have to get to right now. I will try and be avail... but I have a problem I have to fix. | 01:32 |
vulcanmummie | I'm typing on the laptop beside my computer | 01:32 |
dr_willis | night all.. | 01:32 |
acer | dr willis, you are still here, you were here last year too :) | 01:32 |
vulcanmummie | ok I understand L3top | 01:32 |
rwlyonsjr | l3top: understood... thanks for all your help | 01:32 |
vulcanmummie | maybe PatrickDickey you can tell me what to do? I'm so sorry for this | 01:32 |
MiningMarsh | nyRednek: the installer seems to support what you want to do. give me a minute... | 01:33 |
nyRednek | MiningMarsh: i see that the program references a specific url...is there a way i can edit it to reference a file:// url? | 01:33 |
acer | vulcanmummie: are you trying to check your windows drive for files? Click on try ubuntu. let it load. | 01:33 |
MiningMarsh | nyRednek: do echo $RET | 01:34 |
vulcanmummie | ubuntu is loaded, I'm supposed to be checking to see if my drive is ok, I installed ubuntu to my computer thru windows and it worked for like a week then I had to go back to windows then windows crashed and neither would boot | 01:34 |
nyRednek | MiningMarsh: i think it just fixed itself...brb | 01:34 |
yeehi | Hey - sometimes the edge of the windows are hard to see in Quantal - how can you easily make the bit that you click on to drag change to eg pale blue? | 01:35 |
acer | vulcanmummie: so you want to check if you hard drive is fine or have a problem? | 01:35 |
escott | vulcanmummie, there is a "disk utility" which will tell you smart data | 01:35 |
acer | vulcanmummie: click on the ubuntu icon and search for "disk utility" | 01:36 |
vulcanmummie | acer I think that is the idea | 01:36 |
ahmad | yeehi: you can always use alt + space to get the menu and lick move to move the window, or use ccsm (compiz-settings-utility) to modify windows to behave like windows snapping feature | 01:36 |
AndyOpie150 | Well...I just got done downloading and installing Ubuntu 11.10 and there was no option to hide the dock at all. Oh well. Just thought I'd pop in and finish what I'd started. Thanks for the help. Going to try Fedora 17 next. | 01:36 |
yeehi | thanks ahmad - i will try some of these things out | 01:36 |
vulcanmummie | acer disk utulity is open | 01:37 |
acer | vulcanmummie, hold until I boot into ubuntu | 01:37 |
escott | vulcanmummie, there should be a little button that says something about checking SMART status | 01:37 |
vulcanmummie | I know you guys think I'm an idiot but I'm trying to learn I promise! | 01:37 |
ahmad | yeehi: ccsm is a very advanced tool please use it with care and respect, its also worth noting that you can export your settings and save that file in a secure location in case something happens to your distribution so you don't have to re-customize cssm | 01:38 |
escott | vulcanmummie, perhaps they changed it in 12.10. click on the gears then check SMART status | 01:38 |
vulcanmummie | beside smart status it says no | 01:38 |
acer | vulcanmummie, i don't think anyone who is helping here think that. | 01:38 |
vulcanmummie | I'm not using 12.10 I stayed with 12.04 | 01:38 |
vulcanmummie | thank you acer | 01:39 |
b0x | as a user thinking of instaling ubuntu for the first time, should i try 12.10 or 12.04? seeing alot of reviews badmouthing 12.10... | 01:39 |
escott | vulcanmummie, if it won't show you smart status your only option is to move the drive to another motherboard and hope that the other motherboard supports smart | 01:39 |
acer | vulcanmummie, find your drive and click on it | 01:39 |
vulcanmummie | I was stuck on dial up since '97 and just got satellite net a month ago :) | 01:39 |
vulcanmummie | acer I'm on my hard disk drive | 01:40 |
mefistofeles | what's the command for the "additional drivers" interface? | 01:40 |
b0x | software sources? | 01:40 |
escott | mefistofeles, jockey-gtk or jockey-text | 01:40 |
acer | vulcanmummie so you all the information and options? | 01:40 |
mefistofeles | (I don't have launcher/bars etc working) | 01:40 |
mefistofeles | escott: oh ok, thanks | 01:40 |
vulcanmummie | I see some info, some info is blank it seems | 01:40 |
vulcanmummie | it shows model location capcity partitioning | 01:41 |
escott | vulcanmummie, if your system supports SMART the button "check SMART status" on the middle-upper right will open a new dialog | 01:41 |
vulcanmummie | it says no beside smart status | 01:41 |
escott | vulcanmummie, so either the motherboard or the drive itself doesn't support SMART | 01:42 |
acer | vulcanmummie: is the field SMART Status: not support? | 01:42 |
acer | vulcanmummie mine says the same | 01:42 |
escott | vulcanmummie, probably the motherboard. what kind of system is this | 01:42 |
vulcanmummie | wyes not supported | 01:42 |
acer | vulcanmummie, maybe you chose the wrong drive | 01:43 |
vulcanmummie | I dont even know, I usually have a computer guy but he keeps my computer for likea month each time and I wanted to see if I could fix it myself with the help of you guys | 01:43 |
vulcanmummie | i chose hard disk | 01:43 |
acer | vulcanmummie because when I choose hard disk under SATA host adapter, SMART status: Disk is healthy | 01:43 |
ahmad | vulcanmummie, definitely choosing the right guy to fix that for you xD | 01:44 |
ahmad | wrong guy* i mean lol | 01:44 |
vulcanmummie | I dont have a choice of who fixes it, I don't work and this guy does it pretty much for free, which is why I have to wait for freaking ever | 01:44 |
nyRednek | MiningMarsh: nope, didn't self-correct...pretended to finish, but failed | 01:44 |
acer | its best to use a screenshot utility and paste screen shots links here | 01:44 |
vulcanmummie | well it says hard disk and it's under sata | 01:44 |
MiningMarsh | nyRednek: oh, uhm... I guess I will look at that filea gain then | 01:45 |
vulcanmummie | crap, I'm on a laptop, let me get xchat on my computer hold up | 01:45 |
ahmad | free usually means let me waste your time :P lol | 01:45 |
escott | vulcanmummie, what kind of laptop is this? is it a netbook? | 01:45 |
vulcanmummie | lol I hear you, dont know what to do, well the computer I'm working on is a pc | 01:46 |
vulcanmummie | I'm on a laptop chatting with you guys right now but i'm getting xchata on my computer | 01:46 |
acer | vulcanmummie, run the live cd on the computer you are having problem with, connect to internet, use the screenshot utility by pressing "shift printscreen" | 01:46 |
vulcanmummie | I'm running the live cd on my computer, I just need to install xchat on it | 01:47 |
acer | ok | 01:47 |
acer | software center | 01:47 |
vulcanmummie | well I guess not install it just use it, guess I can't install since I'm just "trying" ubuntu | 01:47 |
vulcanmummie | well maybe I can ugggggg.... | 01:48 |
acer | you can install it temporary for this session | 01:48 |
MiningMarsh | nyRednek: think I found it | 01:48 |
ahmad | oh vulcanmummie, problem is if your using a CD you may not be allowed to do that since there is no 'reserved space' for offline data | 01:48 |
MiningMarsh | /var/lib/update-notifier/package-data-downloads/flashplugin-installer.* | 01:48 |
vulcanmummie | k cool | 01:48 |
uw | s | 01:48 |
vulcanmummie | you guys so rock I have to say | 01:48 |
ahmad | vulcanmummie: when you create a live usb however you can specify that space and then you can install programs as if it ubuntu was installed on your CD | 01:48 |
ahmad | as if it was installed on your hard drive* | 01:48 |
vulcanmummie | well it looks like it's trying to install, do I make a screen shot and put it on imgur or some shit? | 01:49 |
escott | vulcanmummie, yes, and please watch the language | 01:49 |
vulcanmummie | oops sorry | 01:49 |
Jisawesome2 | I have found that the only way i can connect to the internet is using "sudo dhclient eth0" | 01:49 |
MiningMarsh | nyRednek: from what I can tell, you can manually install it via /usr/lib/flashplugin-installer/install_plugin "path to the flash plugin gz" | 01:49 |
Jisawesome2 | Is there a way to automatically connect? | 01:50 |
escott | Jisawesome2, go to the network settings and make sure it it set to full DHCP not "Addresses Only" | 01:50 |
Jisawesome2 | Where is network settings | 01:50 |
Jisawesome2 | I am using ubuntu server | 01:50 |
escott | Jisawesome2, how did you configure your network initially then | 01:50 |
Jisawesome2 | I believe that I skipped that part | 01:51 |
Jisawesome2 | If that is possible | 01:51 |
Jisawesome2 | I certaintly did not use DCHP | 01:53 |
PatrickDickey | Jisawesome2, which version of Ubuntu server are you using? (I just came back, so I missed it) | 01:53 |
ActionParsnip | Jisawesome2: you could add the command in /etc/rc.local to make it run at boot. add it above the 'exit 0' line :) | 01:54 |
escott | Jisawesome2, network-manager manages network configurations for most gui users. for server setup there are often static configs, but you might see if network-manager is running for you | 01:54 |
Jisawesome2 | I am using 8.04 | 01:54 |
Jisawesome2 | escott, how do I do that | 01:54 |
PatrickDickey | do you have a desktop or just a terminal Jisawesome2 | 01:55 |
escott | vulcanmummie, did you take that screenshot? | 01:55 |
Jisawesome2 | terminal | 01:55 |
PatrickDickey | https://help.ubuntu.com/8.04/serverguide/network-configuration.html This might help you. If it's just configuring your network, I mean. | 01:56 |
Jisawesome2 | patrick, that page did not ecxist for me | 01:57 |
PatrickDickey | Has anyone compiled Evolution from source on Ubuntu 12.04 (a later version than what's installed from the official repos)? | 01:57 |
wilee-nilee | PatrickDickey, You might look for a PPA. | 01:58 |
michael_ | anyone know how to set the VNC access right for ubuntu10.04? | 01:58 |
RichardRaseley | Running Ubuntu 12.04 Desktop. I created a bridged interface (br0) bound to eth0 to expose to my VMs (QUEMU). Upon doing this the GUI (in the upper right corner) shows me as disconnected (although I am online without any odd behavior) and if I click on it says "Wired network device not managed". Has anyone encountered this before? Any way to manage my br0 interface via the GUI? | 01:58 |
=== Guest67360 is now known as jsec | ||
PatrickDickey | Jisawesome2 does this link work? https://help.ubuntu.com/8.04/serverguide/ | 01:59 |
michael_ | I have connected the ubuntu vnc server successfully, but after a while, Xp VNC viewer connection will be broken automatically. | 01:59 |
Jisawesome2 | I will just use the 10.04 guide | 02:00 |
michael_ | I also create shared directory by samba between xp and ubuntu10.04. but the connection between them will also be broken soon. | 02:01 |
ActionParsnip | RichardRaseley: if you use /etc/network/interfaces then network manager cannot touch the interfaces you configure in the file | 02:01 |
michael_ | anyone could help solve such problems? | 02:02 |
ActionParsnip | Jisawesome2: if you have a fix, just apply it. The command makes it work. | 02:02 |
ahmad | can anyone please help, i am trying to figure out which lines are required to manually inject inside sources.list to install skype 64-bit | 02:02 |
ActionParsnip | michael_: what are you connecting to the system to achieve? | 02:02 |
ActionParsnip | ahmad: just grab the deb from the skype site | 02:02 |
=== ronny is now known as Guest8063 | ||
wilee-nilee | ahmad, You can open it with gedit. | 02:03 |
ActionParsnip | ahmad: you can also uncomment the lines for the partner repo in /etc/apt/sources.list too if you want | 02:03 |
michael_ | ubuntu vnc server | 02:03 |
ahmad | ActionParsnip, I am creating a bash script to automatically do all that for me.. thats why its more convenient if i inject the ppa sources line. | 02:03 |
ActionParsnip | michael_: yes but what do you do ondce connected? | 02:03 |
michael_ | I installed vnc4server in ubuntu | 02:03 |
ActionParsnip | ahmad: its not in a PPA, its in the partner repo which you can enable by uncommenting the lines | 02:03 |
wilee-nilee | ahmad, There is a PPA install app. | 02:03 |
ActionParsnip | michael_: you aren't answering the question | 02:04 |
michael_ | I can see the destop of ubuntu by xp vncviewer | 02:04 |
ActionParsnip | michael_: when you connect from XP to Ubuntu and you see the desktop, what sorts of things do you do? | 02:04 |
Guest8063 | hi, I have a big problem, I want to access to mi external HDD and windown say that the HDD neeed a format!!! you believe that g parted can help me??? | 02:04 |
ActionParsnip | Guest8063: is there data on the drive? | 02:05 |
ahmad | ActionParsnip, which lines in particular do i need to uncomment? | 02:05 |
Guest8063 | yes!! :( | 02:05 |
Jisawesome2 | Does anyone know why I would have to use dhclient to connect to the internet | 02:05 |
ActionParsnip | Guest8063: ok and what format is the partition on the USB devce? | 02:05 |
RichardRaseley | ActionParsnip: So, how would I allow the network manager to "touch" the file? | 02:05 |
Guest8063 | Fat32 | 02:05 |
ActionParsnip | ahmad: then ones that say partner that start with the word deb | 02:06 |
ActionParsnip | Jisawesome2: so that your interface gets a DHCP assigned IP as well as the DNS servers you use | 02:06 |
ahmad | ActionParsnip, thank you i will investigate further :) | 02:06 |
michael_ | 1. run vncviewer ip:1 in xp 2. sometimes i can see the desktop of ubuntu and visit its file system,but sometimes I can't connect server successfully. | 02:06 |
Jisawesome2 | actionparsnip, I need a static ip, how do I do that | 02:06 |
ActionParsnip | Guest8063: when you last unplugged it, did you use the safely remove feature of your OS or did you just yank it out? | 02:06 |
ActionParsnip | michael_: again, not answering the question | 02:07 |
ActionParsnip | michael_: when you connect from XP to Ubuntu and you see the desktop, what sorts of things do you do? | 02:07 |
ActionParsnip | michael_: what do you use VNC to achieve? | 02:07 |
acer | michael_: what do you want to do? | 02:07 |
=== Youri is now known as YBook | ||
Jisawesome2 | actionparsnip, do I have to use ifup to bring it up? | 02:08 |
PatrickDickey | Guest8063, was the external drive formatted originally in Windows or Linux? And when you say "Windows says that the HDD needs to be formatted", are you talking about Windows (the operating system)? | 02:08 |
acer | michael_: if just trying to connect once in a while: http://www.unixmen.com/how-to-use-remote-desktop-in-ubuntu/ | 02:08 |
ActionParsnip | Jisawesome2: possibly, I believe that is default | 02:08 |
Callmea | salut | 02:09 |
ActionParsnip | Jisawesome2: if you specify the addressing in /etc/network/interfaces it will be used, you can also tell it to ifup and use dhcp by dfefault | 02:09 |
michael_ | sometimes, when I want to connect to ubuntu server by vncviewer, I get a error" connection reset by peer". | 02:09 |
Guest8063 | yes windows the OS, I used a special software at windows to give the format, because windows cant do it | 02:09 |
ActionParsnip | michael_: last time; why do you use use VNC, anythingb else is of zero interest | 02:09 |
Jisawesome2 | I want it to use static ip addresses | 02:09 |
PatrickDickey | If you mount it in Ubuntu, can you see the data? | 02:09 |
ActionParsnip | Jisawesome2: then this will help: http://www.cyberciti.biz/faq/setting-up-an-network-interfaces-file/ | 02:10 |
ActionParsnip | Jisawesome2: you will need to manually specify nameservers | 02:10 |
vulcanmummie | wth I think windows is booting now...what is wrong with my computer!!!! gah! | 02:10 |
ActionParsnip | Jisawesome2: also, note that Hardy server is EOL in April next year, you may weant to upgrade soon | 02:10 |
Jisawesome2 | I think I did that, are they the ones located in resolv.conf?? | 02:10 |
PatrickDickey | vulcanmummie, that's a great sign. Now, you can go into Add/Remove Programs and uninstall ubuntu. | 02:10 |
ActionParsnip | Jisawesome2: yes, you may need to define them in the interfaces file though | 02:11 |
michael_ | I like read the code in XP instead of ubuntu. | 02:11 |
ActionParsnip | michael_: what code? | 02:11 |
vulcanmummie | PatrickDickey, I am doing that right now lol, then should I install using the cd? | 02:11 |
itaws | what is the command to install update from terminal | 02:11 |
michael_ | but I must compile the android code in ubuntu | 02:11 |
ActionParsnip | michael_: and you do this in a terminal? | 02:11 |
michael_ | source code. | 02:11 |
Jisawesome2 | I did that actionparsnip, but when I reload the file, I still need a command to make the internet work | 02:11 |
PatrickDickey | vulcanmummie, yes (if you want ubuntu installed). Choose the option to "install alongside Windows". | 02:11 |
ActionParsnip | michael_: do you compile the code in a terminal? | 02:11 |
michael_ | I like a GUI interface instead of terminal | 02:12 |
michael_ | yes | 02:12 |
PatrickDickey | itaws sudo apt-get update (updates the list) and sudo apt-get dist-upgrade updates. | 02:12 |
tripelb | problem: download torrent or direct Ubuntu fails on crap tethered connection, and takes overnight. How long should I plan for on starbucks? is there a better way I have not thought of? Only I could ask someone else to do it for me. but I'do rather do it myself. | 02:12 |
ActionParsnip | michael_: then why not install openssh-server and connect to the system using putty from windows | 02:12 |
ActionParsnip | michael_: it is drastically lighter and simpler | 02:12 |
ActionParsnip | michael_: and you can do what you need | 02:12 |
ahmad | is it wise to use precise based sources instead of quantal (providing there are no quantal alternatives) | 02:13 |
Jisawesome2 | Screw it, I will deal with it later | 02:13 |
PatrickDickey | tripleb, if you have a local college with a public computer lab, you could download it there. | 02:13 |
ActionParsnip | michael_: are you seriously saying you VNC to a server then open a terminal and do stuff? | 02:13 |
michael_ | yes, but the connection is alway broken automated. | 02:13 |
vulcanmummie | PatrickDickey, do you think it's safe to use this disk? when I was trying to show acer my desktop the cd froze... | 02:13 |
ActionParsnip | michael_: dude, you are adding extra stuf you don't even need | 02:13 |
PatrickDickey | michael_ could you use ssh instead of vnc? | 02:13 |
ActionParsnip | michael_: on the server side install openssh-server and you can connect on port 22 using putty | 02:13 |
vulcanmummie | PatrickDickey, should I make another copy? | 02:14 |
|Anthony| | why are folders in /home/user/ created with rwxr-xr-x | 02:14 |
michael_ | ok, let me try. | 02:14 |
ActionParsnip | michael_: you can do everything you need there and it will run faster as you aren't streaminhg the whole desktop, you don't need the desktop | 02:14 |
Guest8063 | no i cant see anything of data, linux cant see the format | 02:14 |
PatrickDickey | vulcanmummie, you can test the disc to make sure it's good. I'll see if I can find some information on how to do that. | 02:15 |
ActionParsnip | michael_: this is why I always ask because people ALWAYS install dumbass VNC when 99% of the time there is a _significantly_ sleeker solution using fewer resources and being faster | 02:15 |
|Anthony| | ssh -x ftw | 02:15 |
michael_ | I see. :) | 02:15 |
vulcanmummie | oh it's prompting me to reboot to start the live cd | 02:15 |
ActionParsnip | Guest8063: are you accessing the partition in Winedows | 02:15 |
tripelb | PatrickDickey: the nonstudent ones are limited and can't be there for hours. | 02:15 |
ActionParsnip | |Anthony|: capital X ;) | 02:15 |
michael_ | thanks , I will try your solution. | 02:15 |
vulcanmummie | PatrickDickey, ^ | 02:16 |
PatrickDickey | tripleb public library maybe? | 02:16 |
PatrickDickey | There you go vulcanmummie. | 02:16 |
* PatrickDickey the reboot prompt | 02:16 | |
PatrickDickey | Guest8063, what software did you use to format the drive originally? | 02:17 |
vulcanmummie | PatrickDickey, so I can reinstall it next to windows? nice... | 02:17 |
|Anthony| | er ssh -X | 02:17 |
PatrickDickey | vulcanmummie, yes. That's how I originally did it. | 02:17 |
ActionParsnip | Guest8063: when you last unplugged it, did you use the safely remove feature of your OS or did you just yank it out? | 02:17 |
Guest8063 | I believe that can be the partition table, can I fix it?? | 02:17 |
vulcanmummie | PatrickDickey, ok good, I wonder why nothing would boot earlier and now magically windows booted? | 02:17 |
ActionParsnip | Guest8063: How is this an Ubuntu issue if you are using Windows? | 02:18 |
ahmad | question: is it wise to use precise based sources instead of quantal (providing there are no quantal alternatives) | 02:18 |
ActionParsnip | ahmad: ou should use Precise sources in Precise and QUantal sources in Quantal | 02:18 |
vulcanmummie | PatrickDickey, I wonder what the initial problem was? | 02:18 |
PatrickDickey | vulcanmummie, if it started working after you fixed grub, or after you removed the wubi installation, that was your problem. | 02:18 |
ahmad | ActionParsnip, problem is there are no quantal sources for the package i am trying install (BURG) | 02:19 |
Guest8063 | the issue is in windows and linux, I dont remember the software tha I used, but I do it in windows | 02:19 |
ActionParsnip | ahmad: burg isn't supported here. I wouldn't advise using it either | 02:19 |
vulcanmummie | PatrickDickey, oh ok good, why would it have messed with windows tho? oh also after I installed ubuntu earlier I had to put in some code because my screen kept blacking out, don't remember the code tho, I think it was because I have one of those old monitors | 02:19 |
ahmad | ActionParsnip, yes it has given me a lot of issues already | 02:19 |
vulcanmummie | PatrickDickey, it didn't boot from the cd.. | 02:20 |
ActionParsnip | ahmad: so why bother with it, considering the boot prettiness is on the screen for less than a few seconds, why bother | 02:20 |
stumper | Hi... I have a windows image and want to install Ubuntu fresh on a new disk.. which approach is better - install ubuntu first or Windows? | 02:20 |
Guest8063 | And I used the the safely remove feature | 02:20 |
PatrickDickey | vulcanmummie, did it boot from the CD earlier? | 02:20 |
tonyyarusso | stumper: Windows first. | 02:20 |
vulcanmummie | yes it did, it just booted straight to windows PatrickDickey | 02:20 |
stumper | thakns | 02:20 |
PatrickDickey | Guest8063, what was the software supposed to do? I mean like encrypt the drive, or something like that. | 02:21 |
Guest8063 | you believe tha I can recovery my data?? | 02:21 |
tonyyarusso | stumper: Otherwise you'll have to do a separate step to recover the bootloader. | 02:21 |
ActionParsnip | Guest8063: you could use testdisk to make the partition again, then fsck the partition | 02:21 |
ActionParsnip | Guest8063: why do you not have a backup of the data? | 02:21 |
ahmad | ActionParsnip, well I am starting to agree with you it may not be worth the trouble. But if I am able to successfully automate its installation without problems then it might be worth it. Either way, BURG is off my list for now :) | 02:21 |
ActionParsnip | Guest8063: and why are you using crappy FAT32 for importsnt data? | 02:21 |
PatrickDickey | vulcanmummie, you might need to go into BIOS (setup) or if you have an option to pick a boot device (Boot Menu), try that. | 02:21 |
vulcanmummie | ok I'm installing cd boot helper | 02:21 |
PatrickDickey | vulcanmummie, once you're in BIOS, you can set it to boot to CD first (or if you open the boot menu, select the CD Drive). | 02:22 |
vulcanmummie | PatrickDickey, I'm sorry I don't know how to do that | 02:22 |
Guest8063 | no, I dont have? backup, that I use that HDD with my PS3 its only Fat32 | 02:22 |
_DanN_ | any openldap guru available ? I need to change roles in 2 ldaps replicated 1 way so master will become slave and slave will become master | 02:23 |
PatrickDickey | vulcanmummie, what kind of computer is it? (manufacture and model) I'll see if I can find out how to get in. | 02:23 |
ActionParsnip | Guest8063: but if the data is importnat, why is there no backup? | 02:23 |
vulcanmummie | umm, it's homemade lol PatrickDickey | 02:23 |
Guest8063 | that HDD is my backup, I lose my normal HDD the last week and now my backup HDD! | 02:24 |
PatrickDickey | vulcanmummie, does it give you a Splash screen? if so, try F1 when that comes up. | 02:24 |
Pedrolito | Guest8063, sorry to hear that, that's bad luck to lose both of them so close apart | 02:25 |
Guest8063 | :'( I`m going to try with testdisk | 02:26 |
stumper | tonyyarusso, ubuntu-secured-remix - how about this ? | 02:26 |
Pedrolito | Guest8063, did you try to use some recovery software? | 02:27 |
Lesterwood | hello, i am doing some first time manual partitioning for fun | 02:28 |
escott | Guest8063, if its in the same case and one fails buy two | 02:28 |
ArubaDods | hi all | 02:28 |
vulcanmummiex | woops | 02:28 |
ArubaDods | need some help here | 02:28 |
Lesterwood | can someone reccomend how much a given partition should take up in space? for example how large is /boot | 02:28 |
vulcanmummiex | PatrickDickey, ok ubuntu is loading | 02:28 |
Lesterwood | or /home | 02:28 |
vulcanmummiex | from the cd | 02:28 |
Lesterwood | basically just some reccomendations, please help others before me because i am just playing around | 02:28 |
Guest8063 | I dont make a recovery | 02:28 |
escott | Lesterwood, a few hundred megs for /boot. /home depends on how much data you need to save | 02:28 |
PatrickDickey | Good deal. Then you'll be able to do the Install option. And select "Install Alongside Windows." | 02:28 |
ArubaDods | after installing ubuntu 12.10 I notice the small icon of the mail on top right corner is missing | 02:29 |
Lesterwood | escott, why bother, just put another partition for files? | 02:29 |
Lesterwood | so other linux can access it easily | 02:29 |
Guest8063 | I used this software to make a firt format: fat32format.exe | 02:29 |
trism | ArubaDods: if you don't have any apps using it, it will hide itself in 12.10 | 02:29 |
Lesterwood | my confusion is about /tmp usr var srv opt and usr/local | 02:29 |
Lesterwood | im not certain what exactly they are | 02:30 |
escott | !lfs | 02:30 |
ubottu | LFS is Linux From Scratch (www.linuxfromscratch.org) - not to be confused with !LTS, which is the long term support release of Ubuntu (currently 8.04 (server), 10.04 and 12.04) | 02:30 |
ArubaDods | trism, so I just need to start using it so it appears again? | 02:30 |
escott | !fhs | 02:30 |
ubottu | An explanation of how files and directories are organized on Ubuntu, and how they can be manipulated, can be found at https://help.ubuntu.com/community/LinuxFilesystemTreeOverview see also: man hier | 02:30 |
escott | Lesterwood, ^^^ | 02:30 |
Lesterwood | thank you | 02:31 |
Lesterwood | i greatly appreciate it | 02:31 |
Pedrolito | Guest8063, try Testdisk as you said | 02:31 |
vulcanmummiex | oh wait, PatrickDickey i'm on install and it doesn't say anything about installing alongside windows | 02:31 |
PatrickDickey | What does it say? | 02:31 |
trism | ArubaDods: if should appear if you start an app that uses it, but several of the apps didn't get ported to the new API in 12.10 | 02:31 |
ArubaDods | trism, Oh...ok Thanks a lot! | 02:32 |
vulcanmummiex | PatrickDickey, it just says welcome and has the choice of language and says you may wish to read the release notes... | 02:32 |
Guest8063 | ok thanks to all :'( | 02:33 |
PatrickDickey | vulcanmummie, it will be a couple of screens in. You'll click "Next" and get a page where you can install updates automatically, and install third party software. Then it should give you the option. | 02:33 |
=== Guest7454 is now known as Ex0deus | ||
escott | Lesterwood, you don't need to have lots or partitions if you dont want to. a lot of people have one big monolithic / and are perfectly happy with it | 02:34 |
vulcanmummiex | oh ok good, do I need to install third party software? | 02:34 |
* PatrickDickey is one of those with a huge / | 02:34 | |
Lesterwood | escott, well, im learning | 02:34 |
Lesterwood | supposedly having seperate partitions makes recovery/tranfer easyt | 02:34 |
PatrickDickey | vulcanmummie, that depends on you. I do, because I watch videos and listen to mp3's. But, if you don't want closed-source software, then I would say no. | 02:35 |
facu | Someone can help me? | 02:35 |
PatrickDickey | facu, we can try. What's the problem? | 02:35 |
_Marcus | I am trying to compile something and it says "fatal error: llvm/Value.h: No such file or directory compilation terminated." yet I have llvm-3.0 installed. | 02:35 |
facu | I want to format my hd but the livecd only do a fast format | 02:36 |
tonyyarusso | _Marcus: First question: Why are you trying to compile something? | 02:36 |
michael_ | I have tried to use the Putty to visit the ubuntu openssh-server, but I get a error" Network error: Software caused connection abort". | 02:36 |
facu | I wwant to do a Complete format | 02:36 |
_Marcus | tonyyarusso: Because that's how life is. | 02:36 |
vulcanmummiex | PatrickDickey, oh jeez it's asking about partitions | 02:36 |
PatrickDickey | vulcanmummie, is it saying "Ubuntu has detected Windows"? | 02:36 |
facu | How can I do it? | 02:36 |
vulcanmummiex | yes | 02:36 |
PatrickDickey | vulcanmummie, is one of the options to install alongside Windows? | 02:37 |
escott | facu, you can just dd if=/dev/zero of=/dev/sda | 02:37 |
vulcanmummiex | no, it' replace windows or something else:you can create or resize partitions yourself, or choose multiple partitions for ubunut | 02:37 |
trism | _Marcus: llvm-3.0-dev | 02:38 |
facu | but if I'll do it, I have to stay on O.S | 02:38 |
zruty | Can I upgrade my x32 Ubuntu to an x64 version without completely reinstalling? | 02:38 |
facu | Or can I do it from the LiveCD? | 02:38 |
_Marcus | trism: Still didn't work. | 02:38 |
tonyyarusso | zruty: no | 02:38 |
PatrickDickey | zruty, no. You have to reinstall. | 02:38 |
trism | _Marcus: it's in /usr/lib/llvm-3.0/include/llvm/Value.h | 02:39 |
tonyyarusso | zruty: That's a replacement, not an "upgrade". | 02:39 |
escott | facu, you cannot mess with the root device. so you *HAVE* to do it from a livecd | 02:39 |
vulcanmummiex | I dont know anything about partitions | 02:39 |
facu | Ok ty bro | 02:39 |
PatrickDickey | vulcanmummie, I would hold off on the installation then. Make sure Wndows is working correctly before you do it. For some reason it's not giving you the option to install alongside. | 02:39 |
vulcanmummiex | it did when I first ran the cd | 02:39 |
zruty | tonyyarusso: I see... ok, thanks! Kind of interesting though, I'd say that the partitions are there anyway, there is no difference between 32- and 64-bit partitions, just the files (... most of them, I'm pretty sure) on them need to be replaced... | 02:40 |
PatrickDickey | vulcanmummie, I would close the installation (Cancel or just click the X) and reboot. Take the CD out, and make sure it boots into Windows. | 02:40 |
vulcanmummiex | ok | 02:41 |
tonyyarusso | zruty: Right. Partitions are a disk concept, not an OS one. | 02:41 |
escott | zruty, being able to migrate among multiarch is in the long term plans but is a few years out at best | 02:42 |
zruty | escott: ... by that time I am ready to buy my next computer, I hope... | 02:42 |
zruty | tonyyarusso: Right. Thanks again! | 02:42 |
vulcanmummiex | PatrickDickey, it says disk read error occurred....gah! | 02:43 |
escott | vulcanmummiex, sounds like the disk is bad | 02:43 |
vulcanmummiex | now it's asking if I want to use ubuntu or windows... | 02:43 |
=== evilTabmow is now known as Tabmow | ||
PatrickDickey | vulcanmummie, you'll have to find a repair disk and run the boot member fix that L3top mentioned earlier. | 02:43 |
vulcanmummiex | windows is booted now | 02:44 |
PatrickDickey | vulcanmummie, without the CD in the drive, right? | 02:44 |
vulcanmummiex | yes | 02:44 |
vulcanmummiex | so um, no ubuntu for me? | 02:45 |
PatrickDickey | vulcanmummie, not today at least. | 02:45 |
vulcanmummiex | wait, somehow ubuntu was installed again already, I uninstalled again, can I try one more time to install from the cd but doing it beside windows? | 02:46 |
vulcanmummiex | I am a pain in the arse... | 02:47 |
PatrickDickey | vulcanmummie, I would check the Add/Remove programs and make sure it's not installed anymore. | 02:47 |
vulcanmummiex | I just uninstalled it | 02:47 |
WeThePeople | what webpage would i go to to know what every char. means and does from this>>> ${execi 30 netstat -ept | grep ESTAB | awk '{print $9}' | cut -d: -f1 | sort | uniq -c | sort -nr} | 02:48 |
PatrickDickey | I'd check again, just to be sure. Stranger things have happened. | 02:48 |
vulcanmummiex | ok should I just put the disk in and restart? | 02:48 |
escott | WeThePeople, the man pages | 02:49 |
escott | !man | WeThePeople | 02:49 |
ubottu | WeThePeople: The "man" command brings up the Linux manual pages for the command you're interested in. Try "man intro" at the command line, or see https://help.ubuntu.com/community/UsingTheTerminal | Manpages online: http://manpages.ubuntu.com/ | 02:49 |
PatrickDickey | Not yet. I'd check that first, and reboot without the disk. Make sure that Windows boots normally. | 02:49 |
WeThePeople | escott, do the manpages have page for > $ < | 02:49 |
vulcanmummiex | ok, no ubuntu, restarting | 02:49 |
=== shantorn_ is now known as shantorn | ||
yanick_ | hi, I just upgrade from 12.04 to 12.10 and I can't get HDMI to send sound to the TV. Furthermore, while the graphics are accelerated, the computer is heating up badly. I tried installing the proprietary drivers for my ATI Radio HD 3600 card but I can't find any driver in the software sources window | 02:50 |
yanick_ | I tried looking on AskUbuntu, launchpad and other forums, but no real solution has been brought up | 02:50 |
yanick_ | what's wrong with this release and proprietary drivers? | 02:50 |
vulcanmummiex | nope disk read error again...wtf? | 02:51 |
itaws | what is the command for partial upgrade for terminal | 02:51 |
escott | WeThePeople, the curly brace is a bashism that allows manipulation of the variable | 02:51 |
=== rafael is now known as Guest18035 | ||
vulcanmummiex | so now there's no way to see what's wrong with my disk? | 02:52 |
escott | vulcanmummiex, if you are getting read errors the disk is bad. what more do you need to know | 02:52 |
PatrickDickey | vulcanmummie, did you try the link that L3top gave you earlier? If so, what did it show? | 02:53 |
escott | vulcanmummiex, if you want a reason why its bad i will tell you the secret. Its lonely, and it wants a wife onto which you can copy all its data. go buy it one and it will be happy | 02:53 |
* PatrickDickey was away from the computer earlier | 02:53 | |
vulcanmummiex | I'd love to, but that goes back to why I have to rely on the computer guy I have, no money | 02:54 |
PatrickDickey | vulcanmummie, again, did you try the suggestions in the link L3top gave earlier? | 02:54 |
vulcanmummiex | someone told me to check using the live disk | 02:55 |
PatrickDickey | right. And L3top gave you a link with drive checking for beginners. | 02:55 |
vulcanmummiex | so can I use that link using the ubuntu live disk? | 02:56 |
PatrickDickey | yes. That's how you'll do the steps in the link. | 02:56 |
Snowie | Anyone explain this error to me? doesn't seem to make sense. The command is not a file??? ~/dos$ game-data-packager -i quake -d c/QUAKE_SW/ | 02:56 |
Snowie | /usr/games/game-data-packager: is not a file | 02:56 |
PatrickDickey | You'll want to pick the "Try Ubuntu without making changes" option (or Try Ubuntu button). | 02:56 |
escott | Snowie, /usr/games/game-data-packager is probably a directory or maybe a broken symlink | 02:57 |
escott | Snowie, in other words its not a file | 02:57 |
Snowie | hmm. the command seems to half work though. | 02:57 |
PatrickDickey | Snowie, try ln -l /usr/games and see what it shows for game-data-packager if it has a d in the beginning, it's a directory. | 02:58 |
PatrickDickey | ls -l ^ | 02:58 |
escott | Snowie, run "ls -l /usr/games/game-data-packager" and see what it says | 02:58 |
Snowie | -rwxrwxr-x 1 root root 1942 Apr 6 2011 /usr/games/game-data-packager | 02:58 |
Snowie | not a directory right? | 02:59 |
vulcanmummiex | I tried booting with the live cd and now windows is booting.... | 02:59 |
Snowie | should i run that command as root perhaps? | 02:59 |
vulcanmummiex | this is infuriating, I can use that link thru windows I'm assuming to find out wth is going on with my disk? | 02:59 |
escott | Snowie, what does "file /usr/games/game-data-packager" say | 02:59 |
PatrickDickey | vulcanmummie, what version of Windows are you using? | 03:00 |
Snowie | /usr/games/game-data-packager: POSIX shell script, ASCII text executable | 03:00 |
Snowie | sh script right/ | 03:00 |
Snowie | ? | 03:00 |
vulcanmummiex | xp professional | 03:00 |
PatrickDickey | How did you install it, or did you buy the computer with it installed? | 03:00 |
vulcanmummiex | it was already installed | 03:00 |
escott | Snowie, try "games-data-packager --help" | 03:00 |
PatrickDickey | Did you buy it from your computer repair guy? | 03:01 |
vulcanmummiex | yes, he built it | 03:01 |
Snowie | http://paste.ubuntu.com/1296680/ | 03:02 |
PatrickDickey | He should have given you a disc or at least a recovery disc then. | 03:02 |
PatrickDickey | If he didn't, then he needs to. | 03:03 |
escott | Snowie, more than likely the "is not a file" error is coming from inside the script. try "grep -in "is not" /usr/games/game-data-packager" and see if it prints any lines with "is not a file" | 03:03 |
vulcanmummiex | I'll ask for one | 03:03 |
vulcanmummiex | he may have given me one back when I got the computer but that was years ago and I was, um, in a different headspace then | 03:04 |
escott | Snowie, the other possibility is some kind of filesystem corruption, that is being triggered when BASH gets to a later point in the file. You could try and run "tail /usr/games/game-data-packager" and see if that cause the "is not a file" error | 03:04 |
Snowie | escott, ahhh, i get you. meaning that it probably wants an executable path, not a directory??? it does say use a directory. | 03:04 |
johnjacobjingerh | hmmm... what would be the proper syntax to grant users 0755 to my home directory | 03:04 |
PatrickDickey | vulcanmummie, understood... | 03:04 |
johnjacobjingerh | grant all users | 03:04 |
escott | !permissions | johnjacobjingerh | 03:05 |
ubottu | johnjacobjingerh: An explanation of what file permissions are and how they can be manipulated can be found at https://help.ubuntu.com/community/FilePermissions | 03:05 |
vulcanmummiex | PatrickDickey, so I should just drop trying to fix my computer right now then? | 03:05 |
PatrickDickey | vulcanmummie, yes. You need to get the Windows part fixed, otherwise it won't let you install alongside. | 03:06 |
RichardRaseley | Running Ubuntu 12.04 Desktop. I created a bridged interface (br0) bound to eth0 to expose to my VMs (QUEMU). Upon doing this the GUI (in the upper right corner) shows me as disconnected (although I am online without any odd behavior) and if I click on it says "Wired network device not managed". Has anyone encountered this before? Any way to manage my br0 interface via the GUI? | 03:06 |
vulcanmummiex | ok thanks PatrickDickey | 03:07 |
vulcanmummiex | so something's just up with xp then? | 03:07 |
insomniac_lemon | !natty | 03:07 |
ubottu | Ubuntu 11.04 (Natty Narwhal) was the fourteenth release of Ubuntu. Download http://releases.ubuntu.com/11.04/ - Release Info: http://www.ubuntu.com/getubuntu/releasenotes/1104 | 03:07 |
Snowie | escott, i think it's time to take a step back. What i really want to do is play quake, but instructions are all over the place. i have the official script from the repo's, and have unpacked the shareware version via dosbox. the folder it tells me to move the PAKs to doesnt exist, and even when i create it, the official launcher tells me to head to the readme. Any suggestions? | 03:08 |
PatrickDickey | vulcanmummie, something's up with the boot member. | 03:08 |
PatrickDickey | vulcanmummie, may I PM you (private message)? | 03:08 |
vulcanmummiex | PatrickDickey, sure | 03:08 |
escott | Snowie, well the PAK file presumably goes in /usr/share/games/quake or the like | 03:08 |
escott | Snowie, and you can apt-get install a variant of quake (there are a few different versions) | 03:09 |
Snowie | it says in /usr/share/games/quake/id1 ... id1 doesnt exist. when i create it and move the pack, same issue. just errors with missing data and directs to readme. | 03:09 |
Snowie | escott, yeah. might install darkplaces. | 03:10 |
=== Jikan is now known as Jikai | ||
insomniac_lemon | escott, is there a tool (something with a GUI) I can use in Linux that will make a clone of a drive that I can use in a VM? Think on windows freeze, and clonezilla freezes when I try to restore the image onto the VM. | 03:12 |
insomniac_lemon | *Things on windows | 03:13 |
escott | insomniac_lemon, trying to snapshot windows running on bare metal and then running that in a vm is probably not going to work | 03:13 |
celthunder | insomniac_lemon: dd ? | 03:13 |
escott | insomniac_lemon, if the bare metal system you want to clone is linux i would just boot a livecd dd the disk off to an image, and then try to convert the image | 03:14 |
insomniac_lemon | celthunder, I don't think dd has a GUI, I don't feel like doing it in terminal. | 03:14 |
bkc_ | insomniac_lemon: sure there are GUIs for dd... | 03:15 |
insomniac_lemon | escott, I made a clone with clonezilla (which I believe uses dd) and converted that into a clonezilla restore disk. However, when I try to use the disk, it freezes | 03:15 |
escott | insomniac_lemon, "use the disk" meaning? | 03:16 |
insomniac_lemon | escott, I boot into the disc, attempt to restore the image, and It gets to about 75% restored, and then freezes the VM. | 03:16 |
escott | insomniac_lemon, boot into what disk? try and be a bit more specific. you have the livecd which you made the snapshot from, the original bare metal install that you made the snapshot of, and you have the snapshot. what are you booting into and what are you restoring to | 03:17 |
escott | insomniac_lemon, and what are you booting under real or virtual hardware | 03:18 |
nykac_ | how can we add a CA cert to our system? | 03:19 |
insomniac_lemon | escott, I made a clonezilla CD, I used that to make an image of my windows drive. I used clonezilla again to turn this image into a self-restoring conezilla disc. I booted into this disc on the VM to try to restore the drive to the VM. The VM had sufficient (very high) graphics, RAM, and processor setting, but it didn't stop it from freezing. | 03:20 |
kavelot | is there a way to configure what the ' deadkey should produce? ie, I want '+c to become ç and '+m to become 'm (two letters) | 03:21 |
kavelot | (or, better said, two characters) | 03:21 |
escott | insomniac_lemon, yeah im not sure how well that would work. even if you get it restored to the virtual disk i suspect you will get caught in the windows HAL loop. i would just get yourself a windows install CD and reinstall windows to the VM, and then use the software key you already have | 03:22 |
Konald | anyone know why terminal hangs briefly and says this when i start it? bash: /etc/bash_completion.d/iproute2: Input/output error | 03:23 |
|Anthony| | are there any problems that could arise from setting rwxr-x--- on $HOME files/folders? | 03:23 |
ActionParsnip | |Anthony|: sounds ok, keeps other users out :) | 03:23 |
escott | |Anthony|, only if you need to share files with others | 03:24 |
|Anthony| | ActionParsnip, that's the intention. just wan't sure if there were some instances where some system group would need to read files for configs | 03:24 |
|Anthony| | or would it effect clamav? | 03:24 |
OerHeks | nykac_, see https://help.ubuntu.com/12.04/serverguide/certificates-and-security.html | 03:24 |
nykac_ | OerHeks: nvm. it's not os specific. java is just being stupid | 03:25 |
ActionParsnip | |Anthony|: clamav will be ran as your user, or root. It'll have access :) | 03:25 |
|Anthony| | well that's good | 03:25 |
michelle_ | installing ubuntu via live cd. my screen is black now. i can hear the cd drive working. did it go to sleep? touching any keys does not wake it up | 03:27 |
insomniac_lemon | escott, the thing is, I don't know if I even have an install disk. I might have one, a disk I used to fix my MBR after I tried Fedora on another partition but didn't like it. I'll see if it will install. But honestly, I just want my existing Windows 7 drive, but I want to be able to use the software on it in Ubuntu without needing to reboot and go into Windows separately. Wine doesn't work so well :( | 03:27 |
Snowie | escott, lol, answer was simply case sensitivity http://www.christopherkois.com/?p=304 | 03:27 |
Snowie | escott, thanks though bro | 03:27 |
escott | insomniac_lemon, you can borrow one from someone or find an image somewhere else. as long as its the same variant (ie win7 or win7 home or professional) all you need is the key | 03:28 |
zruty | How can I see which DNS server I am DNSing to? | 03:28 |
ActionParsnip | michelle_: what video chip do you use? | 03:28 |
cfhowlett | escott: or you download the win7 image from digitalriver.com | 03:28 |
michelle_ | ActionParsnip mac osx | 03:28 |
ActionParsnip | michelle_: add the boot option: nomodeset | 03:29 |
escott | zruty, /etc/resolv.conf or just "dig" something | 03:29 |
insomniac_lemon | escott, will it activate and think it is the same machine? Because techanccaly, it is the same computer and hardware that I am using Windows on. | 03:29 |
ActionParsnip | michelle_: 'mac osx' is an OS, not hardware | 03:29 |
mal10c | zruty: you can do a: cat /etc/resolv.conf | 03:29 |
escott | insomniac_lemon, no thats a big part of the problem. it looks like different hardware to the OS | 03:29 |
zruty | escott: + mal10c: Thanks ! | 03:30 |
michelle_ | ActionParsnip its already installing ubuntu to my external hd. the screen all of the sudden went black | 03:30 |
|Anthony| | ActionParsnip, would the same be true for / chomod -R 750 / | 03:30 |
escott | |Anthony|, you dont want that | 03:30 |
=== goo- is now known as goo | ||
|Anthony| | nvm | 03:30 |
escott | |Anthony|, chmod -R o-rwx is safer | 03:31 |
ActionParsnip | |Anthony|: i wouldn't go messing with /, there are some delicate accesses and ownerships there | 03:31 |
escott | |Anthony|, otherwise all your non-executable files are now executable | 03:31 |
|Anthony| | i realized the stupidity of that though after i hit ENTER | 03:31 |
|Anthony| | heh | 03:31 |
escott | |Anthony|, and as ActionParsnip pointed out don't mess with / | 03:31 |
ActionParsnip | michelle_: screensaver under mac? | 03:31 |
* PatrickDickey learned the hard way, changing chmod on / is a bad, bad thing.. Like reinstallation bad. | 03:31 | |
* PatrickDickey actually it was chown not chmod, but still... | 03:32 | |
michelle_ | ActionParsnip doubt it, i think its the live cd screensaver | 03:32 |
insomniac_lemon | escott, if I install windows on the VM, can I manually do a backup on my real windows drive and restore it to the VM? | 03:32 |
ActionParsnip | michelle_: I'd try the boot option: nomodeset may help | 03:33 |
michelle_ | ActionParsnip so i have to power off the computer then do the boot option? | 03:34 |
brightspark | Hi, does anyone know how to get the treetex package for texlive? I don't see it in the repositories. | 03:34 |
ActionParsnip | michelle_: you wil need to reboot to the CD again and add the option | 03:36 |
trism | brightspark: maybe texlive-plain-extra, I see several treetex directories there anyway | 03:36 |
ActionParsnip | brightspark: what is the output of: lsb_release -sc | 03:36 |
brightspark | trism, that's it. Thanks" | 03:37 |
michelle_ | ActionParsnip k ty | 03:37 |
ActionParsnip | !info texlive-plain-extra | 03:37 |
ubottu | texlive-plain-extra (source: texlive-extra): TeX Live: Plain TeX supplementary packages. In component universe, is optional. Version 2012.20120611-1 (quantal), package size 2647 kB, installed size 5241 kB | 03:37 |
olinux | ok so i alt+tab a lot, unity is a bit frustrating when i have two windows from the same app, they are combined and not individually selectable | 03:38 |
brightspark | ActionParsnip, maverick. | 03:38 |
olinux | what's the default way to choose select one of the app windows? | 03:38 |
ActionParsnip | brightspark: maverick is EOL | 03:38 |
ActionParsnip | olinux: press SuperL + W | 03:39 |
user_ | 03:39 | |
insomniac_lemon | ActionParsnip, isn't Natty end of life now? Or in a week at least.... | 03:39 |
brightspark | ActionParsnip, true. but this package has been around since the eighties. I was just surprised that searching "treetex" in aptitude gave me no results. | 03:39 |
ActionParsnip | brightspark: all the repos for Maverick have been turned off, there are no packages for it. I suggest a fresh install of Precise for LTS goodness, or Quantal for the latest features | 03:40 |
OerHeks | olinux, press winkey + s | 03:40 |
ActionParsnip | brightspark: yes, you'll get no results as there are no packages | 03:40 |
OerHeks | olinux, or hold win key to see all keycombo's | 03:40 |
brightspark | ActionParsnip, I just installed texlive-plain-extra. | 03:40 |
ActionParsnip | brightspark: I suggest you upgrade, ideally with a clean install | 03:41 |
robertzaccour | The only DE that recordmydesktop outputs 1920x1080 in is Gnome Shell. The others I tried recently (Unity, Xfce, KDE, LXDE) recordmydesktop outputs 1920x1072. Is this normal or just something to do with my system? | 03:42 |
brightspark | ActionParsnip, thanks for the suggestion, but I'm happy with this system. I tried Unity for a month and it seriously disappointed me- I don't want to have to fight it to use my computer everyday. | 03:42 |
ActionParsnip | brightspark: you don't have to use Unity | 03:42 |
robertzaccour | brightspark, try gnome shell with docky and install ubuntu tweak and add the minimize and close buttons to the windows | 03:43 |
espen77 | is there any way i can get the "key" from installed package that is not authorized? | 03:43 |
ActionParsnip | brightspark: Lubuntu, Xubuntu and Kubuntu do not use Unity. It's not even installed | 03:43 |
=== richard is now known as Guest35605 | ||
olinux | ok i setup a shortcut for 'switches window of current application' | 03:46 |
ActionParsnip | olinux: look into the scal plugin in ccsm :) | 03:46 |
olinux | ActionParsnip OerHeks thanks those are useful | 03:46 |
DouglasK | Question: I installed Pidgin and plugins pack. Now, pidgin is listed in the chat drop down, I've added an account, but I cannot see the main pidgin window. How do I get to that? | 03:46 |
nulli_ | hello ther | 03:47 |
ActionParsnip | DouglasK: if you ALT+TAB, is it there | 03:48 |
DouglasK | ActionParsnip, that brings up only a chat window with myself. | 03:48 |
olinux | seems silly to me that installed apps do not have an OPEN button in the ubuntu software manager | 03:48 |
=== morpheus is now known as Guest79716 | ||
ActionParsnip | DouglasK: then use the chat menu and there may be a show main window option (or similar) | 03:49 |
ActionParsnip | DouglasK: or you could kill pidgin off then rerun it | 03:49 |
DouglasK | ActionParsnip, I think I'll try that first.. it's easy. :) | 03:49 |
olinux | ActionParsnip, can scale do windows aero style snap? | 03:50 |
DouglasK | ActionParsnip, that did it, thanks | 03:50 |
brightspark | ActionParsnip, robertzaccour, thanks for the suggestions; I'll look into them a bit more this week. Goodnight all | 03:50 |
olinux | snap window 50% right/left | 03:50 |
olinux | DouglasK, ubuntu does this weird combining of windows from the same app, i would guess pidgin uses sep windows for the main app and each chat session | 03:52 |
olinux | at least skype does | 03:52 |
=== Wug[Hyperspace] is now known as Wug | ||
Konald | anyone know why terminal hangs briefly and says this when i start it? bash: /etc/bash_completion.d/iproute2: Input/output error | 03:52 |
* DouglasK nods. | 03:52 | |
DouglasK | Thanks | 03:52 |
ActionParsnip | olinux: oh i hate that 'aero snap' thig. Its called Grid in ccsm | 03:53 |
=== paulus68_ is now known as paulus68 | ||
ActionParsnip | Konald: are there any bugs reported? | 03:54 |
Konald | I mean I know why it's saying it, I want it to stop saying it... | 03:54 |
ActionParsnip | Konald: possibly a bad drive | 03:54 |
Konald | ActionParsnip - ok | 03:55 |
=== somethinginteres is now known as Guest97367 | ||
robertzaccour | The only DE that recordmydesktop outputs 1920x1080 in is Gnome Shell. The others I tried recently (Unity, Xfce, KDE, LXDE) recordmydesktop outputs 1920x1072. Is this normal or just something to do with my system? Any suggestions? | 04:01 |
ActionParsnip | robertzaccour: sounds like a bug | 04:05 |
ActionParsnip | robertzaccour: is the 8 pixel strip really that crucial? | 04:06 |
ActionParsnip | robertzaccour: worth the effort? | 04:06 |
Souravaj | hi plz help i want to configure mutt for hotmail? | 04:07 |
somethinginteres | Trying to test out the new webapps feature. It's not prompting me to install webapps for suppored sites. Ideas? | 04:08 |
ActionParsnip | Souravaj: let me search, didn't think anyone used mutt | 04:08 |
ActionParsnip | Souravaj: http://forums.fedoraforum.org/showthread.php?t=275592 may help | 04:08 |
ActionParsnip | Souravaj: https://bbs.archlinux.org/viewtopic.php?id=103776 | 04:09 |
ActionParsnip | Souravaj: http://crunchbanglinux-fr.org/forum/viewtopic.php?id=1570 | 04:10 |
robertzaccour | ActionParsnip, 1072 is uneditable | 04:10 |
robertzaccour | ActionParsnip, Its not in a video editor's profile setup | 04:10 |
ActionParsnip | robertzaccour: then report a bug | 04:11 |
robertzaccour | ActionParsnip, Kdenlive has a specific set of paramaters for video editing, no way to do it. I wonder why the other DE's are affected by it that way? | 04:11 |
Souravaj | thanks ActionParsnip | 04:11 |
ActionParsnip | robertzaccour: tried using a different editor, maybe they are more flexible | 04:12 |
ActionParsnip | robertzaccour: or use a differnet screen recording app | 04:12 |
rockworldmi | why siddebar dosent hiding when i run app in maximized .. | 04:12 |
rockworldmi | any settings? | 04:13 |
robertzaccour | ActionParsnip, for Linux there is no equal substitute for Kdenlive | 04:13 |
robertzaccour | ActionParsnip, the other ones are garbage from my use of them and ffmpeg has bad audio/video sync issues. | 04:13 |
Strav | Hi! Anyone else having problems with the persistence of their window key bindings (either assigned with system settings/keyboard/shortcuts or directly in compiz) on ubuntu 12.10? (upon rebooting, the defaults seems to randomly overwrite my configs) | 04:17 |
ActionParsnip | robertzaccour: report a bug with the video capturing app | 04:17 |
ActionParsnip | Strav: are the config folders owned by your user? | 04:19 |
Grecoo | hi | 04:19 |
Grecoo | i'm looking for some good mysql gui | 04:20 |
Grecoo | do you know someone? | 04:21 |
Strav | ActionParsnip: hmmm. I'm not certain of which config folders you're refering to... | 04:21 |
Strav | ActionParsnip: I guess those config would be in ~/.config | 04:21 |
Strav | ActionParsnip: which is surely owned by my user | 04:21 |
Strav | Grecoo: try mysql administrator (for admin the server) or mysql query browser for sql queries and such | 04:23 |
vulcanmummie1 | anyone home? | 04:23 |
Grecoo | thanks, ill try | 04:23 |
Grecoo | im a noob at sql, so well | 04:23 |
Grecoo | i have no idea :p | 04:23 |
ActionParsnip | Strav: try: sudo chown -R $USER:USER ~/.config | 04:24 |
ActionParsnip | Strav: will make sure :) | 04:24 |
robertzaccour | ActionParsnip, I have a Lauchpad account, but where's the link to report the bug? | 04:25 |
ActionParsnip | Grecoo: the output of mysql commands in CLI is nicely formatted you know | 04:25 |
ActionParsnip | robertzaccour: what app are you recoding the desktop with, please? | 04:25 |
robertzaccour | ActionParsnip, recordmydesktop | 04:26 |
ActionParsnip | robertzaccour: ubuntu-bug recordmydesktop | 04:26 |
robertzaccour | no questions regarding my issue, I searched | 04:26 |
robertzaccour | in terminal? | 04:26 |
ActionParsnip | robertzaccour: yes, that will kick off the process and fire up your browser (or a new tab if it's already open) | 04:26 |
robertzaccour | ActionParsnip, Ok doing it now thanks. | 04:26 |
Strav | Grecoo: they're intuitive enough... next step is a good sql book. ;) (if you care foor a suggestion: try Database Systems: A Practical Approach to Design, Implementation, and Management; had this book as a text book in a DB class and found it to be very well written. | 04:26 |
robertzaccour | ActionParsnip, Thanks bro. | 04:27 |
ActionParsnip | robertzaccour: no worriesd dude :) | 04:27 |
firebalrog | functional dependency | 04:27 |
ActionParsnip | robertzaccour: I find the CLI way of starting the bug reporting much easier than faffing with GUI nonsesne | 04:27 |
Strav | ActionParsnip: I'll do that but I'm not certain why it should matter... I can define those settings and they often remain after rebooting, but sometimes not (I found that this most happens if the computer is abruptly shut down) | 04:28 |
Grecoo | thanks, here i have some data base books, but at the moment im learning just a few things of sql | 04:28 |
Grecoo | i just need to do a simple table | 04:29 |
Strav | brb | 04:29 |
ahmad | haha, i iz pwnaging awk and sed =D | 04:29 |
=== raymond is now known as raymond__ | ||
Grecoo | im not studying computation | 04:30 |
Grecoo | (yet) | 04:30 |
ActionParsnip | ahmad: a powerful skill | 04:31 |
=== root is now known as Guest216 | ||
ahmad | ActionParsnip, lol just automated the removing comments from canonical partnership deb from sources.list | 04:32 |
ahmad | ActionParsnip, lazyness ftw :P | 04:32 |
robertzaccour | ActionParsnip, Yeah makes sense because it includes apport-collect info too | 04:33 |
ActionParsnip | Strav: could try: Strav could try renaming the compiz config folder in ~/.config then log off and on again | 04:34 |
=== root____1 is now known as souravaj | ||
coreyfro_ | Hey all. Just installed 12.10 on a lenovo y580 with nvidia optimus BS. I've been trying to figure out how to get my nvidia card working erither with or without optimus, I don't care. I just can't find the right set of instructions on how to do this. How do I get a geforce 660m card working under ubuntu 12.10 if I have this lame hybrid configuration of cards? | 04:38 |
mah454 | hello | 04:42 |
ActionParsnip | coreyfro_: may help. This is all I know: https://help.ubuntu.com/community/HybridGraphics | 04:42 |
mah454 | wht ubuntu developers do not remove this message on init scripts : "Rather than invoking init scripts through /etc/init.d, use the service(8) utility" | 04:42 |
mah454 | 04:42 | |
mah454 | all init scripts have this message ! | 04:43 |
mah454 | s/wht/why | 04:43 |
wastrel | i think they want you to use the service utility | 04:44 |
gitesh | I want nm-applet icon.......please help | 04:44 |
ActionParsnip | mah454: use: sudo service name start|stop|status | 04:45 |
mah454 | ActionParsnip: wastrel: debian have invoke-rc.d | 04:45 |
insomniac_lemon | Speaking of applets, does anyone here make Cinnamon applets? | 04:45 |
ActionParsnip | mah454: the starting etc of servics is slightly different and is now easier to understand | 04:45 |
ActionParsnip | mah454: so what is Debian has invoke-rc.d? | 04:46 |
mah454 | ActionParsnip: invoke-rc.d is standard script (command) for debian disto's . | 04:47 |
souliaq | recommended distro for 64 bit Desktop, with NVidia!!, Ubuntu 12.04 (64) fails, can't install Nvidia drivers, unity so slow. | 04:47 |
=== Dreadtower is now known as Breadflour | ||
ActionParsnip | mah454: maybe, but ubuntu uses something different | 04:48 |
ActionParsnip | souliaq: this is ubuntu support, not help me find a distro | 04:48 |
blackshirt | souliaq, i think nvidia was not release 64 bit version for linux | 04:48 |
ActionParsnip | souliaq: you don't have to use Unity in Ubuntu, either | 04:49 |
insomniac_lemon | !Gnome3 | 04:49 |
ubottu | GNOME 3 is the desktop environment on which Unity is based. To use GNOME Shell instead of Unity, install the "gnome-shell" package and investigate "gnome-tweak-tool". GNOME 3 is not supported under Natty/11.04, and may break your system if installed from alternate sources. | 04:49 |
insomniac_lemon | !Cinnamon | 04:49 |
n1ckn4me09876543 | If I do full hard drive encryption, will I still be able to have more than 1 operating system? how does grub boot loader works with UBUNTU FULL HDD ENCRYPTION? | 04:49 |
ActionParsnip | souliaq: if you install Lubuntu, Xubuntu or Kubuntu it won't even be installed | 04:49 |
souliaq | I tried with this driver: http://www.nvidia.com/object/linux-display-amd64-260.19.12-driver.html | 04:49 |
ActionParsnip | blackshirt: I have 64bit nvidia drivers: http://paste.ubuntu.com/1296779/ | 04:50 |
cfhowlett | n1ckn4me09876543: fully encrypting a hdd with multiple OS's? Expect unforeseen consequences ... | 04:51 |
ActionParsnip | souliaq: what nvidia GPU do you use? | 04:51 |
insomniac_lemon | Somone should add the information on Cinnamon ( http://cinnamon.linuxmint.com/ ) to Ubottu. | 04:51 |
ActionParsnip | souliaq: do you use that Optimus nonsesne? | 04:51 |
n1ckn4me09876543 | cfhowlett: i thought so, same thing happen with Truecrypt when trying to do full HDD encryption | 04:51 |
ActionParsnip | insomniac_lemon: you can do it | 04:51 |
souliaq | Sorry my mistake, was this: http://www.nvidia.com/object/linux-display-amd64-295.33-driver.html, GeForce 620 | 04:51 |
insomniac_lemon | !help | 04:51 |
ubottu | Please don't ask to ask a question, simply ask the question (all on ONE line and in the channel, so that others can read and follow it easily). If anyone knows the answer they will most likely reply. :-) See also !patience | 04:51 |
enq | any tips how to fix screen brightness on dell xps? | 04:52 |
insomniac_lemon | I meant help for using Ubottu :( | 04:52 |
ActionParsnip | souliaq: sudo add-apt-repository ppa:ubuntu-x-swat/x-updates; sudo apt-get update; sudo apt-get upgrade | 04:52 |
cfhowlett | n1ckn4me09876543: exactly. I don't have the technobabble to explain, but everything I've read suggest it's a bad idea. But why encrypt the whole HDD? Why not just the data /home | 04:52 |
=== Breadflour is now known as Dreadtower | ||
ActionParsnip | insomniac_lemon: type: /msg ubottu !thing is This is the description bit | 04:52 |
ubuntuuser | hey | 04:52 |
ActionParsnip | insomniac_lemon: eg: /msg ubottu !cinnamon is Cinammon is not supported here etc | 04:53 |
shiyushun | 有中国人在吗? | 04:54 |
enq | i have dell xps L702x with nvidea GT555 3D graphic, and screen brightness doesnt change, drivers is nvidia(tested one) | 04:54 |
souliaq | ActionParsnip if not unity, then what? | 04:54 |
Jordan_U | !cn | shiyushun | 04:54 |
ubottu | shiyushun: 如欲獲得中文的協助,請輸入 /join #ubuntu-cn 或 /join #ubuntu-tw | 04:54 |
shiyushun | chinese people?? | 04:54 |
n1ckn4me09876543 | cfhowlett: I'm still new to linux, but is it possible for a hacker to install or put a program outside of /Home folder and make it run whenever I log onto ubuntu? | 04:56 |
=== Youri is now known as YBook | ||
Guest80374 | someone knows the password I set on twitter | 04:56 |
Guest80374 | can I discuss it here lol | 04:56 |
Guest80374 | I guess not | 04:57 |
cfhowlett | !cn>shiyushun: | 04:58 |
Guest80374 | if you're good with twitter and are tech savvy, let me know or pm me. I need assistance regarding my account being compromised. | 04:58 |
cfhowlett | n1ckn4me09876543: possible? sure. Still, if you check the ubuntu/linux virus attack logs, it's q | 04:58 |
cfhowlett | n1ckn4me09876543: QUITE rare. windows is a bigger target and OSX is catching up. | 04:58 |
cfhowlett | n1ckn4me09876543: but check with the penetration testing experts, not me... | 04:58 |
n1ckn4me09876543 | cfhowlett: that's why I wanted to encrypt the whole hdd so every folder is non accessible | 04:58 |
Guest80374 | if you're good with twitter and are tech savvy, let me know or pm me. I need assistance regarding my account being compromised. | 04:58 |
n1ckn4me09876543 | Guest80374: see if you can get password reset, or use KeepassX | 04:59 |
cfhowlett | Guest80374: or you could contact twitter support? | 04:59 |
DBoyz | [Ubuntu 11.10] I am using proxy to browse the internet (mozilla firefox). I tried to update ubuntu using the same proxy but the speed it awfully slow. In mozilla my speed is 100+ kB/s but in terminal, my speed is only 30 B/s. How to solve this problem? | 04:59 |
Dragonster82 | Hello there everybody! | 04:59 |
Jordan_U | n1ckn4me09876543: Encrypting your home directory won't in any way prevent someone from installing mallicious software on it. Encrypting data only helps with keeping it private. | 05:00 |
blackshirt | yes | 05:00 |
Jordan_U | n1ckn4me09876543: Sorry, I meant "whole hard drive" rather than "home directory" in that last message. | 05:00 |
blackshirt | colek saa7_go engkur | 05:01 |
root____1 | bitlbee | 05:02 |
Jordan_U | n1ckn4me09876543: For instance, if someone had physical access to the machine then they could add a physical keylogger which would grab your password when you entered it then get all of your data and install whatever mallicious software they wanted. | 05:02 |
rockworldmi | any one having problem with ip messengr? | 05:02 |
=== Kiyonich is now known as Bakemono | ||
Jordan_U | n1ckn4me09876543: This is true of any OS. | 05:02 |
Seven_Six_Two | Anyone know vpn? I'm trying to set up a vpn on my home network for private web browsing while out and about. I believe I need "bridged" but I'm not sure. My server only has one network card... | 05:02 |
Jordan_U | n1ckn4me09876543: If they're instead using a software exploit, like a security flaw in Firefox, to attack your computer then since the OS is already booted, all your data is already decrypted and their mallicious code can do whatever it wants. | 05:03 |
ActionParsnip | soupeee: you can use gnome-panel as the shell, or switch to xfce for that gnome2 smell | 05:03 |
root____1 | gh | 05:03 |
stumper | Trying to install WIndows on a SATA III HDD ... Win 7 DVD says requires drivers | 05:04 |
Jordan_U | stumper: This is #ubuntu. Try ##windows. | 05:04 |
cfhowlett | stumper: ask in ##windows | 05:04 |
ActionParsnip | Guest80374: i suggest you contact the twitter admins | 05:04 |
n1ckn4me09876543 | Jordan_U: yea I always open my computer before turning it on to see if there's anything new lol, guess I'm a little paranoid | 05:04 |
stumper | Once I install Windows, I will install Ubuntu.. I guess many here would have faced the same issue | 05:05 |
Seven_Six_Two | stumper, almost 10 years since I installed Windows first on anything. | 05:06 |
ActionParsnip | stumper: if you leave unpartitioned space you can avoid the whole resizing partitins dance | 05:06 |
ActionParsnip | its been ages since I've installed windows on my own kit | 05:07 |
stumper | Seven_Six_Two / ActionParsnip - I will recover my Windows Image, shrink the remaining partition and then do a fresh Ubuntu install | 05:07 |
Jordan_U | n1ckn4me09876543: The only thing that encryption helps with is if you have a laptop and you lose it, the theif won't be able to get your credit card information or other sensitive information from it. So you'll still be out a laptop, but your private data stays private. | 05:07 |
=== anon is now known as Guest54185 | ||
Jordan_U | stumper: It's easier to just let Ubuntu's installer do the shrinking. | 05:08 |
=== Guest8804 is now known as saji89_ | ||
ActionParsnip | stumper: win7 can shrink it's own partitions too | 05:09 |
Jordan_U | n1ckn4me09876543: And since your private data probably resides in your home directory, encrypting your home directory probably gives you all the *real* security you want. | 05:09 |
stumper | wondering if windows image restore may delete Ubuntu.. | 05:09 |
cfhowlett | stumper: I seem to recall that it does. Windows doesn't play nice with other OS's | 05:10 |
=== saji89_ is now known as saji89 | ||
=== saji89 is now known as Guest41453 | ||
wilee-nilee | stumper, You can clone ubuntu to be safe with clonezilla. | 05:11 |
=== Guest41453 is now known as saji89 | ||
stumper | thanks, cfhowlett, wilee-nilee and others for the suggestions.. restoring Win image now.. will see if Ubuntu CD recognizes the partitions.. | 05:12 |
blackshirt | !info thunderbird | 05:13 |
ubottu | thunderbird (source: thunderbird): Email, RSS and newsgroup client with integrated spam filter. In component main, is optional. Version 15.0.1+build1-0ubuntu1 (quantal), package size 21131 kB, installed size 43745 kB | 05:13 |
=== ubuntu is now known as Guest60067 | ||
Froward | alright ubuntu developer peoples, I said I was really proud of you for magicking my volume control hotkeys to not be delayed anymore | 05:14 |
Froward | but I'm TAKING IT BACK | 05:14 |
Froward | because a few reboots later, they don't work anymore | 05:15 |
Froward | was it an update? is it an intermittent bug? who knows!? | 05:15 |
Froward | I'm disappointed in you, developer dudes | 05:15 |
Froward | I am so sad | 05:15 |
Mechdave_ | Froward, with that attitude you can sort it out yourself | 05:15 |
tdlguik1ckugga | ENYABOYZIORGEMELANINNINJONSONAFAEFORONIBRONZXTONCLIANTINAVIRDIHINMITSAYPACKIETAISERVRHAD | 05:16 |
cfhowlett | tdlguik1ckugga: stop | 05:16 |
ActionParsnip | Froward: report a bug | 05:16 |
wastrel | tdlguik1ckugga: that's my password how did you know | 05:16 |
Froward | oh, okay. thanks. | 05:17 |
Seven_Six_Two | Froward, haha, silly user. You forgot to enable the flux capacitor's /0 macro. | 05:18 |
ActionParsnip | Froward: you do realize that 99.99999% of users here are like you, users | 05:18 |
Froward | man I unno I'm just frustrated | 05:18 |
ActionParsnip | Froward: well, shouting in an IRC channel does nothing, except make you look like an ass | 05:18 |
tdlguik1ckugga | ENYABOYZIORGEMELANINNINJONSONAFAEFORONIBRONZXTONCLIANTINAVIRDIHINMITSAYPACKIETAISERVRHADENYABOYZIORGEMELANINNINJONSONAFAEFORONIBRONZXTONSAYPACKIETAISERVRHADENYABOYITSAYPACKIETAISERVRHADENYABOYZIORGEMELANINNINJONSONAFAEFORONIBRONZXTONCLIANTINAVIRDIHGEGELANINNXTONCLIANTINAVIZIORGEMELANINNINJONSONAFAEFORONIBRONZXTONCLIANTINAVIRDIHINMITSAYPACKIETAISERVRHADENYACLFANTINAVIRDIHINMRDINMITSAYPACKIETAI | 05:19 |
tdlguik1ckugga | SERVRHADENYABOYZIORGEMELANINNINJONSONAFAEFORONIBRONZXTONCLIANTINAVIRDINMTTBOYZIORGEMELAIHNINNINJONSONAFAEFORONIBRONZXTONCLIANTINAVIRDIHINMITSAYPACKIETAISERVRHADENYABOYZIORIHINMINJONSONAFAEFORONIBRONZXTONCLIANTINAVIRDIHINMITSAYPACKIETAISERVRHADENYABOYZIORGEMELANINNINJONSONALAEFORONIBRONZITSAYPACKIETAISERVRHADENYABOYZIORGEMELANINNINJONSONAFAEFORONIBRONZXTONCLIANTINAVIRDIHINMITSAYPACKIETAISERVRH | 05:19 |
tdlguik1ckugga | ADENYABOYZIORGEMELANINNINJONSONAFAEFORONIBRONZXTONNJONSONA | 05:19 |
FloodBot1 | tdlguik1ckugga: Please don't flood; use http://paste.ubuntu.com to paste; don't use Enter as punctuation. | 05:19 |
ActionParsnip | Froward: reporting the bug gets lets the devs know there is an issue and can lead to fixes | 05:19 |
Froward | you're right, Parsnip. | 05:19 |
ActionParsnip | Froward: you could boot to an older kernel (if you have one) to see if it is a kernel upgrade that broke it | 05:19 |
Froward | sorry for the rant, everyone. | 05:19 |
ActionParsnip | Froward: its cool :) | 05:19 |
Mechdave_ | Froward, All good mate :) | 05:19 |
Froward | boot to an older kernel, eh? | 05:20 |
Mechdave_ | Froward, you should have an older kernel listing in grub when you get the grub menu when you boot | 05:20 |
Froward | got it! | 05:21 |
Seven_Six_Two | Froward, do you get input from the keys using xev? | 05:21 |
irinix | Is there a simple way to do a line by line character read from the terminal? | 05:21 |
=== subRing-0 is now known as qxt | ||
Froward | Seven_Six_Two: I don't know! | 05:22 |
wastrel | irinix: ? using read | 05:22 |
wastrel | what are you trying to do | 05:22 |
Seven_Six_Two | Froward, run xev in a terminal. put your mouse in the box, then do the media keys. Look in the terminal for output (events) | 05:22 |
irinix | trying to a get a line by line char output for Dwarf Fortress | 05:22 |
wilee-nilee | irinix, YOu just cross posted on this channel #debian and ##linux don't do that. | 05:22 |
wastrel | dorf fortress runs in the terminal? i thought it launched its own gui | 05:23 |
irinix | it does in a curses based one. | 05:23 |
try | ;) | 05:23 |
irinix | we're trying to write an AI to play the game, but can't get past the interface. | 05:23 |
IdleOne | try #python | 05:24 |
Mechdave_ | irinix, what language are you using to develop this AI player? | 05:24 |
irinix | python | 05:24 |
wastrel | irinix: ask the nethack botters how they did it | 05:24 |
irinix | copy copy. They probably pulled from memory though, we're trying to avoid that. | 05:25 |
Froward | Seven_Six_Two: media keys don't output anything :~ | 05:25 |
Mechdave_ | irinix, have a look at http://docs.python.org/tutorial/inputoutput.html reading files is really similar to reading console pipe | 05:26 |
DBoyz | Reposting my question: [Ubuntu 11.10] I am using proxy to browse the internet (mozilla firefox). I tried to update ubuntu using the same proxy but the speed it awfully slow. In mozilla my speed is 100+ kB/s but in terminal, my speed is only 30 B/s. How to solve this problem? | 05:26 |
Mechdave_ | irinix, then try #python :) | 05:26 |
irinix | Mechdave_, we can read stdout but its all control characters and very difficult to map. | 05:26 |
irinix | We've been unable to find a COMPLETE list of control codes, and the partial ones miss a lot of the term setup. | 05:27 |
Froward | Seven_Six_Two: thanks for your help though, I'm gonna track it down in the morning when I can think straight :) | 05:28 |
Mechdave_ | irinix, you should be able to intercept the stdout stream and it all be ascii. Also remember there is stderr streram as well :) | 05:28 |
irinix | Mechdave_, we've been doing that. | 05:28 |
irinix | Its all curses formatted | 05:28 |
irinix | and no one knows what they do. | 05:28 |
irinix | lots of control characters. | 05:28 |
Seven_Six_Two | Froward, that's no good. I think it's your kernel if you aren't getting any output | 05:29 |
=== Dreadtower is now known as Breadflour | ||
Mechdave_ | irinix, Oh dear :( Maybe this might help --> http://stackoverflow.com/questions/3999114/linux-pipe-into-python-ncurses-script-stdin-and-termios | 05:30 |
Froward | I'll try the last one, next boot | 05:30 |
Froward | I didn't know it's already done two kernel updates! | 05:30 |
irinix | I'll check that out. | 05:30 |
Froward | That's really cool and seamless! | 05:30 |
Mechdave_ | irinix, I just googled read stdout curses with python | 05:31 |
Jordan_U | !rootirc | root | 05:33 |
ubottu | root: It's not technically our business, but we'd like to tell you that IRC'ing as root is a Very Bad Idea (tm). After all, doing anything as root when root is not needed is bad, and especially bad with software that connects to the Internet. | 05:33 |
=== root is now known as Guest71600 | ||
ESphynx | Hey guys... https://bugs.launchpad.net/ubuntu/+source/linux/+bug/676171 --> this issue is terrible plague for us. anyone cares to raise the heat or fix it? =) | 05:35 |
ubottu | Launchpad bug 676171 in linux (Ubuntu) "readdir(3) fails for cifs mount in 32-bit process on amd64" [Undecided,Confirmed] | 05:35 |
OerHeks | ESphynx, karmic is EOL | 05:35 |
ESphynx | OerHeks: but the problem would still occur in Quantal, would it not? | 05:36 |
ActionParsnip | ESphynx: try it | 05:36 |
OerHeks | ESphynx, try it, i don't know | 05:36 |
crizis | OerHeks, yet the bug remains | 05:36 |
sunny_ | . | 05:37 |
sunny_ | any1 thr | 05:37 |
crizis | ESphynx, seriously though, why not just compile your software to 64bit and forget 32bit bugs? :p | 05:37 |
sunny_ | floodbots online? :D | 05:37 |
doomlord | heh x32 | 05:38 |
OerHeks | crizis, yes it remains, so? | 05:38 |
sunny_ | bugs :o | 05:38 |
sunny_ | exit | 05:38 |
ESphynx | crizis: http://www.ecere.com/forums/viewtopic.php?f=28&t=246&start=10 --> help porting Ecere to 64 bit welcome | 05:38 |
crizis | OerHeks, if you bothered to read the actual bug report, you'd notice it mentions supported releases being affected, instead of throwing up useless "karmi is EOL"- comments | 05:39 |
irinix | Why the hell do we have to write our own library for this? | 05:39 |
ESphynx | thanks for the support crizis =) | 05:39 |
irinix | why can't we just say to terminal "what character is this one right here? X, Y" | 05:39 |
ActionParsnip | ESphynx: confirf that the same is happening in Quantal and update the bug | 05:39 |
ESphynx | ActionParsnip: thanks, will do. | 05:41 |
ActionParsnip | ESphynx: sweet | 05:41 |
ESphynx | gotta download/install Quantal | 05:41 |
booh- | Hi. I'm in 32bits. I upgraded from 12.04 to 12.10 and now, when I put a DVD in the tray, I have this message: Adding read ACL for uid 1000 to `/media/booh' failed: Operation not supported | 05:42 |
wastrel | booh-: type id in a terminal | 05:43 |
wastrel | "id" | 05:43 |
booh- | ok and what should I see? | 05:44 |
wastrel | uid=1000(booh) gid=1000(booh) groups=1000(booh) and a bunch of groups following that | 05:45 |
booh- | uid=1000(booh) gid=1000(booh) groups=1000(booh),4(adm),7(lp),20(dialout),24(cdrom),46(plugdev),104(lpadmin),115(admin),120(sambashare),124(libvirtd),125(vboxusers) | 05:45 |
wastrel | just making sure you're in the cdrom group | 05:45 |
blackshirt | booh, are you setup ACL on your box? | 05:45 |
KiLuM | i installed a driver but it didnt install properly now when i install something from the store gives me an error | 05:45 |
KiLuM | anyehing | 05:45 |
=== KiLuM is now known as KiLuMnaTi | ||
KiLuMnaTi | i did sudu remove package.deb | 05:46 |
booh- | blackshirt, no, only upgrade. | 05:46 |
Seven_Six_Two | KiLuMnaTi, and did it remove? | 05:46 |
ActionParsnip | KiLuMnaTi: sudo apt-get --purge remove packagename | 05:47 |
ESphynx | Why hasn't the default 'Distribution' in http://packages.ubuntu.com/ been updated to Quantal yet? :P | 05:47 |
ActionParsnip | KiLuMnaTi: its the naem of the app, not the deb file. You may find the 2 are similar | 05:47 |
crizis | lts > quantal sub-bar bug releases, that's why :P | 05:47 |
=== root____1 is now known as SouravAj | ||
booh- | I try to play an original dvd movie | 05:48 |
grigory | привет | 05:49 |
L3top | !ru| grigory | 05:49 |
ubottu | grigory: Пожалуйста наберите /join #ubuntu-ru для получения помощи на русском языке. | Pozhalujsta naberite /join #ubuntu-ru dlya polucheniya pomoshi na russkom yazyke. | 05:49 |
booh- | When I put a DVD in the tray, I have this message: Adding read ACL for uid 1000 to `/media/booh' failed: Operation not supported <--- but there is no /media/booh directory... should have? | 05:49 |
booh- | pouah! just do sudo mkdir /media/booh and now that's work... | 05:50 |
=== |Nordom| is now known as Nordom | ||
KiLuMnaTi | ActionParsnip its the djconsole driver i used the first tutorial how do i uninstall it now.. http://lightrush.ndoytchev.com/random-1/herculesdjconsoleonkernel2635orubuntumaverick | 05:50 |
KiLuMnaTi | sudo dpkg -i /tmp/hdjmod-dkms.deb | 05:51 |
=== qxt is now known as Evollana | ||
ActionParsnip | KiLuMnaTi: sudo apt-get --purge remove hdjmod-dkms | 05:52 |
KiLuMnaTi | k thanks ill try that | 05:52 |
shiyushun | hi | 05:55 |
WeThePeople | hi | 05:59 |
Jimster480-L | what is everyone upto here | 06:00 |
apoplectic | Jimster480-L: do you really want to know | 06:01 |
apoplectic | technophilia | 06:01 |
tdlguik1ckugga | NOMORETHAN4 | 06:04 |
apoplectic | ? | 06:04 |
lycosa | hi | 06:05 |
Wug | Would anyone know off the top of their head whether the behavior of the suid and sgid bits on directories is still "directory owner inherits created files"? | 06:08 |
Wug | I was unable to get it behaving as expected | 06:08 |
Wug | I feel like the behavior is a sgid bit thing but was unable to reproduce with either bit set. | 06:10 |
Jordan_U | Wug: Due to security concerns setuid on directories has been ignored by most (all?) *NIX systems for a long time, I'm not sure GNU/Linux ever honored setuid on directories. | 06:11 |
Wug | A different angle then | 06:12 |
apoplectic | I am runing a laptop with Windows 7, can someone give me a comrehensive list of things i should do in order to install ubuntu so i could have a dual boot system? | 06:13 |
Wug | Is there a way i can prevent a user from being able to change permissions on files he owns? | 06:13 |
ESphynx | apoplectic: You could give wubi a try? It might just work easily | 06:13 |
* apoplectic looks up wubi | 06:13 | |
Wug | Its the windows ubuntu installer. | 06:14 |
apoplectic | any downsides to wubi? | 06:14 |
ESphynx | apoplectic: Alternatively you could download an Ubuntu CD, boot off it... and just make sure you take care in the setup/partitioning step to resize or otherwise put Ubuntu on the side of your Windows 7 installation | 06:14 |
Wug | Probably not | 06:14 |
ESphynx | and then include it in the GRUB boot loader options somehow :) | 06:14 |
ESphynx | apoplectic: there might be, I think it's installed as a file as opposed to as a partition? | 06:15 |
apoplectic | wait why would i put ubuntu on the side of windows 7 installation? | 06:15 |
ESphynx | lower performance perhaps | 06:15 |
KhuduZulu | apoplectic: dude, run VBOX inside windows rather | 06:15 |
Jordan_U | apoplectic: Yes, many. Mostly that it doesn't have active maintainers. I recommend against using it. | 06:15 |
ESphynx | apoplectic: Ubuntu on one partition, Windows 7 on another partition | 06:15 |
crizis | games, perhaps.. | 06:15 |
tripelb | I can tell you how wubi sucks | 06:15 |
Ascavasaion | Anyon else here having continual crashes using Ubuntu 12.04.1? Especially when using filemanagers? | 06:15 |
Wug | ESphynx: as long as you install ububtu after windows grub should take care of itself. In my experience it has anyway | 06:15 |
Jordan_U | Wug: What is your end goal? | 06:15 |
apoplectic | Jordan_U: what are active maintainers? | 06:15 |
ESphynx | Sad... when I first tried wubi (a while back), I thoguht it worked great... | 06:15 |
Jimster480-L | apoplectic: yes i do | 06:16 |
Calinou | apoplectic: if you bought your computer in 2011 or 2012, it might have UEFI. bootloading is possible through UEFI but it might fail | 06:16 |
ESphynx | it had me up and running on Linux in no time, as I had missed my flight home and was stuck working remotely on my wife's laptop which didn't have Linux installed | 06:16 |
Jimster480-L | fck uefi | 06:16 |
tripelb | you can only access its data if that windows partition boots | 06:16 |
ESphynx | sad to hear it hasn't kept up :| | 06:16 |
apoplectic | bootloading referring to? | 06:17 |
ESphynx | Wug: right. things always go wrong for me :P | 06:17 |
Jordan_U | apoplectic: People who invest their time in making Wubi better and ensuring that it works well. There just isn't anyone that currently wants to work on Wubi, at least last that I checked. | 06:17 |
apoplectic | Jordan_U what are "active maintainers" | 06:17 |
apoplectic | KhuduZulu what is VBOX? | 06:17 |
ESphynx | apoplectic: Virtual Box... now Oracle Virtual Box :) | 06:17 |
tripelb | what about Ubuntu on a USB.. then u can customize | 06:17 |
apoplectic | ESphynx if i use wubi, i cant install ubuntu on a separate parittion? | 06:17 |
ESphynx | running your linux inside a virtual machine inside Windows 7 | 06:18 |
ESphynx | apoplectic: I don't think you can? correct me if I'm wrong | 06:18 |
KiLuMnaTi | im using ubuntu 12.10 as my HTPC luving it | 06:18 |
ESphynx | apoplectic : forget about wubi since people here recommend against it :) | 06:18 |
KiLuMnaTi | great sound from HDMI to my stereo | 06:18 |
tripelb | apoplectic: no. on a separate is dual boot. | 06:18 |
KiLuMnaTi | my htpc used to be a hackintosh pc | 06:18 |
KiLuMnaTi | installed in like 10 min | 06:18 |
apoplectic | HTPC KiLuMnaTi? | 06:18 |
apoplectic | whats that | 06:18 |
KiLuMnaTi | everything working great | 06:18 |
KiLuMnaTi | home theatre pc | 06:19 |
ESphynx | apoplectic: a home theater PC | 06:19 |
KiLuMnaTi | xbmc insalled | 06:19 |
KhuduZulu | apoplectic:I used to be Pro MS, but I installed ubuntu once on my laptop...and was immidiately converted to linux.. i hate MS now...but unfortunately I have to run it at work, so to get my Ubuntu, I run it inside windows using VBOX (virtual Box)...google it | 06:19 |
apoplectic | xbmc? KiLuMnaTi? | 06:19 |
tripelb | wubi acts like dual boot until bad things. then it is not fixable | 06:19 |
Wug | I just install from cds. I usually leave a partition empty so i can put ubuntu on it | 06:19 |
Jimster480-L | KhuduZulu: just because you use linux doesnt meant you need to hate MS | 06:19 |
Jimster480-L | my desktop is windows | 06:19 |
KiLuMnaTi | now just trying to find live animated wallpapers for ubuntu 12.10 | 06:19 |
Jimster480-L | I am a windows developer, and yet im making contributions to the linux kernel and I use linux aswell | 06:19 |
apoplectic | KhuduZulu im familar with VBOX's | 06:19 |
apoplectic | but i'd like to have ubuntu on a dual boot | 06:20 |
apoplectic | so what is the best way to go about this | 06:20 |
apoplectic | im taking wubi off the table | 06:20 |
apoplectic | so that i can install ubuntu on its own parittion | 06:20 |
FloodBot1 | apoplectic: Please don't flood; use http://paste.ubuntu.com to paste; don't use Enter as punctuation. | 06:20 |
KhuduZulu | Jimster480-L>: different stroke bro.. | 06:20 |
robertzaccour | hey yall | 06:20 |
Calinou | Jimster480-L: [citation needed] | 06:22 |
Calinou | also, having fun being a windows dev? | 06:22 |
tripelb | apoplectic: expect ease. I have had good times w/ ubuntu .. and 12u | 06:22 |
apoplectic | How can i install ubuntu on a separate parittion from my windows? | 06:23 |
tripelb | 12.04 fixed all my old hassles. sorry I'm typing on the phone | 06:23 |
=== guest-laqGR1 is now known as dani | ||
tripelb | apoplectic: it's all on the Ubuntu website it's easy | 06:23 |
=== dani is now known as Guest12199 | ||
konza_ | hi | 06:24 |
KhuduZulu | apoplectic: Just run your ubuntu off external HDD or flash dud | 06:24 |
tripelb | do thee and read. it is made to work that way. | 06:24 |
janith | guys, I just downloaded java 7 and extracted to /usr/local/java. I had openJDK 1.6 before. so can you help me to set the path for the new one? | 06:24 |
Jimster480-L | Calinou: yea I have no problems being a windows dev. Idk whats going to happen with Windows 8 but it shouldnt be an issue. I do alot of low level stuff | 06:24 |
tripelb | go thee .. fon. :( | 06:24 |
Jimster480-L | Mostly cheats for games and things of that nature, but I am working on an enterprise Order management system | 06:24 |
konza_ | janith, what does java -version give? | 06:25 |
* Calinou applauses | 06:25 | |
Jimster480-L | KhuduZulu: I guess so | 06:25 |
janith | 1.6 | 06:25 |
Evildoer | t | 06:25 |
tripelb | KhuduZulu: why. it is easier to dual boot. | 06:25 |
tripelb | s | 06:25 |
tripelb | why dual hdd | 06:26 |
konza_ | janith, Please type my name in front of the chat.. Else it will get un noticed :) | 06:26 |
janith | <konza_> 1.6 | 06:26 |
janith | <konza_> just got it | 06:26 |
KhuduZulu | tripelb: given apoplectics knowledge on this subject, it might be easier for him/her to do fresh install on ext hdd rather than re-partitioning existing? | 06:27 |
apoplectic | i want to install minimal ubuntu | 06:27 |
apoplectic | what should i know about doing this | 06:27 |
apoplectic | i want "minimal ubuntu" whatever that means and xorg and openbox | 06:27 |
KhuduZulu | i have to run.... | 06:28 |
KhuduZulu | can anybody point me to channels regarding tech blogs | 06:29 |
apoplectic | tech blogs regarding what? | 06:29 |
janith | <konza_> I found thhis stackoverflow post http://goo.gl/CPqT3 But need some more advice | 06:29 |
konza_ | janith, okay, I wil check it | 06:29 |
=== Guest12199 is now known as danidam | ||
konza_ | janith, you installed it via apt? | 06:29 |
apoplectic | i want to install minimal ubuntu | 06:30 |
riqdiiz | daemon you there? | 06:30 |
apoplectic | what should i know about doing this | 06:30 |
janith | <konza_> no just dwnloaded and extracted | 06:30 |
rephy222 | how do i open a new terminal in a terminal | 06:30 |
konza_ | janith, JAVA_HOME=/usr/lib/jvm/java-6-openjdk | 06:30 |
Jimster480-L | apoplectic: minimal ubuntu doesnt come with a desktop. Thats for server installs. But imho its kinda bloated for a server | 06:30 |
konza_ | janith, this iw where my java installation is | 06:30 |
KhuduZulu | apoplectic: mobile, social, linux edtc | 06:31 |
konza_ | janith, so give your java_home to the installed directory | 06:31 |
janith | <konza_> ok How | 06:31 |
rephy222 | anyone | 06:31 |
konza_ | janith, there is a .bashrc file in your home folder | 06:32 |
janith | <konza_> found | 06:32 |
apoplectic | Oh so what do you guyssuggest for a fast linux based distribution? | 06:32 |
konza_ | JAVA_HOME=<your installed location> | 06:32 |
riqdiiz | is it possible to encrypt messages on irc? | 06:32 |
konza_ | export JAVA_HOME | 06:32 |
janith | <konza_> Trying | 06:32 |
konza_ | janith, add this to the end of the file | 06:33 |
Stanley00 | riqdiiz: you can use ssh with your irc client | 06:33 |
slackerboy | !tab | janith | 06:33 |
ubottu | janith: You can use your <tab> key for autocompletion of nicknames in IRC, as well as for completion of filenames and programs on the command line. | 06:33 |
=== adrianrly|OFF is now known as adrianrly | ||
konza_ | janith, show me the output of this command file /usr/bin/java | 06:34 |
janith | ubottu, Thanx | 06:34 |
ubottu | You're welcome! But keep in mind I'm just a bot ;-) | 06:34 |
jjkinas | Is there another way to make the unity bar smaller on 12.10 ? I used to use myunity but it does not work on 12.10 yet. | 06:34 |
janith | <konza_> /usr/bin/java: symbolic link to `/etc/alternatives/java | 06:35 |
deatheater | is it worthy to buy a netbook? | 06:35 |
deatheater | to run ubuntu? | 06:35 |
konza_ | janith, yeah, its a link to java utility.. Replace it with the java utility in you new installation path | 06:35 |
aeon-ltd | deatheater: go into offtopic i'll meet you there | 06:35 |
konza_ | janith, whats your new installed path? | 06:36 |
deatheater | how to go offtopic? | 06:36 |
riqdiiz | can the messages be saved for offline ? | 06:36 |
aeon-ltd | deatheater: join the #ubuntu-offtopic channel | 06:36 |
deatheater | ok | 06:36 |
Ascavasaion | deatheater: /join #offtopic | 06:36 |
janith | <konza_> /usr/local/java/jre1.7.0_09 | 06:36 |
konza_ | janith, inside that there is a bin folder rite? | 06:37 |
janith | <konza_> /usr/local/java/jre1.7.0_0 | 06:37 |
janith | <konza_> yep | 06:37 |
konza_ | janith, cd /usr/local/java/jre1.7.0_0/bin | 06:37 |
apoplectic | What fastest linux distro you suggest? | 06:37 |
janith | <konza_> done | 06:37 |
konza_ | janith, ./java -version | 06:37 |
robertzaccour | What are those things called that on one end has the white and red audio prongs and on the other end a female end where you can plug in headphones and pc speakers? | 06:37 |
Stanley00 | riqdiiz: well, I don't think this is ubuntu question, so please ask in #freenode, maybe | 06:37 |
Calinou | apoplectic: debian, arch sucks | 06:37 |
apoplectic | Arch? | 06:38 |
apoplectic | How about bhoti? | 06:38 |
janith | java version "1.6.0_24" | 06:38 |
janith | OpenJDK Runtime Environment (IcedTea6 1.11.1) (6b24-1.11.1-4ubuntu2) | 06:38 |
janith | OpenJDK Client VM (build 20.0-b12, mixed mode, sharing) | 06:38 |
insomniac_lemon | apoplectic, in #ubuntu, I (as most people probably would say) Ubuntu. | 06:38 |
Stanley00 | apoplectic: may be you should ask this in ##linux | 06:38 |
SouravAj | apop: try bt5 its get all setting preloaded | 06:38 |
janith | <konza_> sorry, wrong command wait | 06:38 |
janith | <konza_> worked, java version "1.7.0_09" | 06:39 |
apoplectic | Stan wine? Stanley00 ?? | 06:39 |
SouravAj | apoplectic : try backtrak 5 | 06:40 |
janith | <konza_> what if I remake those shortcuts? | 06:40 |
konza_ | janith, remove the short cuts and create a new shortcut to the new location | 06:41 |
janith | <konza_> I'll try | 06:41 |
ncopa | mornings | 06:41 |
ncopa | i just tested 12.10 in a kvm vm | 06:41 |
ncopa | i find it sluggish on my i7 | 06:41 |
konza_ | janith, stop | 06:42 |
Jordan_U | ncopa: Likely because there was no hardware accellerated 3D. | 06:42 |
janith | <konza_> why? | 06:42 |
konza_ | janith, the path which you gave is the loaction of jre and not java | 06:42 |
ncopa | here is my experience | 06:42 |
ncopa | i boot it up, log in first time | 06:42 |
ncopa | i see the A icon (amazon) | 06:43 |
janith | <konza_> Holy **** I just saw that. | 06:43 |
Jordan_U | Does anyone know where I can find a zsync link for 12.10 isos? | 06:43 |
ncopa | i start "amazon" (which is an url so firefox opens | 06:43 |
janith | <konza_> Where's JDK? | 06:43 |
=== joe75_ is now known as joe75 | ||
ncopa | its sluggish (no hw accel) | 06:43 |
ncopa | i maximize | 06:43 |
konza_ | janith, did you install it? | 06:43 |
ncopa | i restore fro maximized window | 06:43 |
ncopa | and boooom | 06:43 |
ncopa | it craches | 06:44 |
konza_ | janith, install it via apt... dont worry it wont overrite the previous one | 06:44 |
janith | <konza_> Ok. | 06:44 |
ncopa | so my first impression of 12.10 is: garbage | 06:44 |
ncopa | sorry | 06:44 |
konza_ | janith, you can try either sun jdk or open jdk, I am using open-jdk.. | 06:44 |
Jordan_U | ncopa: Did you check the md5sum of the iso? Also note that if you're not looking for support this is the wrong channel. | 06:45 |
apoplectic | You know I've noticed that the people in this room tend to be the happiest | 06:45 |
ncopa | Jordan_U: im not looking for support. | 06:45 |
Calinou | apoplectic: no u | 06:46 |
riqdiiz | does Ubuntu 12 . have a server capability? | 06:46 |
ncopa | im just sharing my first impression | 06:46 |
konza_ | janith, will be back in a sec :) | 06:46 |
ncopa | i also think i know what the problem is... | 06:46 |
Stanley00 | !enter | ncopa | 06:46 |
ubottu | ncopa: Please try to keep your questions/responses on one line. Don't use the "Enter" key as punctuation! | 06:46 |
janith | <konza_> Ok. | 06:46 |
apoplectic | Calinou: No u? | 06:46 |
Jordan_U | ncopa: Then this is the wrong channel, please stick to support questions and answers in the future (or move to #ubuntu-offtopic). | 06:46 |
Stanley00 | Jordan_U: check this link cdimages.ubuntu.com | 06:46 |
Calinou | you mean cdimage.ubuntu.com | 06:47 |
Jordan_U | Stanley00: I wasn't able to find any there for the standard AMD64 desktop image, were you? | 06:47 |
ncopa | jordan_U: what is the official "feedback" channel? | 06:47 |
riqdiiz | does Ubuntu 12 . have a server capability? | 06:48 |
=== Kartrohm_afk is now known as Kartrohm | ||
konza | janith, I am back | 06:48 |
jjkinas | I always partition my hard drive when I install and dual boot windows and ubuntu on one hard drive... My friend wants to install ubuntu to a spare second drive and keep from reinstalling windows. Before his install should he make the ubuntu drive primary and install the bootloader to the ubuntu drive and make the windows drive secondary ? Will grub2 find the Windows loader on the other drive ? | 06:48 |
slackerboy | riqdiiz: yes there is ubuntu server | 06:48 |
Jordan_U | ncopa: There is no "feedback" IRC channel. For specific issues you can file a bug report. | 06:48 |
domo | how do I upgrade to 12.04.01? | 06:48 |
domo | .1* | 06:48 |
janith | <konza_> Found the apt way and now installing... | 06:49 |
Jordan_U | domo: From what? | 06:49 |
konza | janith, you may remove the _ at the end of my name :) | 06:50 |
domo | 12.04 | 06:50 |
Stanley00 | Jordan_U: how about this mirror? http://mirror.bytemark.co.uk/ubuntu-releases//quantal/ | 06:50 |
janith | <konza> Ok | 06:50 |
Jordan_U | Stanley00: That has it. Thanks. | 06:51 |
cfhowlett | domo: sudo apt-get update && sudo apt-get upgrade && sudo apt-get dist-upgrade | 06:51 |
Stanley00 | Jordan_U: :) | 06:51 |
insomniac_lemon | jjkinas, yes, GRUB should see your windows drive and it should be an option to boot to | 06:51 |
Jordan_U | domo: Just keep up to date using update-mangager. | 06:51 |
dArKd3ViL | what is the command/script to switch applications in reverse order? I am not asking for keyboard shortcut likt alt+tab or alt+shift+tab.. but the command | 06:52 |
dArKd3ViL | *like | 06:52 |
janith | <konza> Hey, do you know the command to copy a directory? | 06:52 |
konza | janith, cp -r source destination | 06:52 |
jjkinas | insomniac_lemon: Should grub be installed to the ubuntu drive ? | 06:53 |
janith | <konza> Thanx | 06:53 |
konza | janith, Are you new to linux? | 06:53 |
insomniac_lemon | jjkinas, it's much safer on a separate drive then making a new partition for Linux.... I know because when I was new to this sort of thing I did it with Fedora.... I didn't like it, deleted the partition, and had to fix my MBR in order to use my computer | 06:53 |
janith | <konza> new to command line | 06:53 |
insomniac_lemon | jjkinas, I think when you install it, it does all of that for you | 06:54 |
jjkinas | insomniac_lemon: Thanks ! I just have not done dual boot from separate drives before. He should have no problem then | 06:54 |
huxiaolei | ??? | 06:56 |
huxiaolei | Can I speak chinese?? | 06:57 |
janith | <konza> Its installing. Time to go. Thank you very much. | 06:57 |
dArKd3ViL | somebody help me with adding a custom keyboard shortcut | 06:57 |
ncopa | where can i find the md5sums of the isos? | 06:57 |
konza | janith, Welcome,. Bye. | 06:57 |
huxiaolei | Can I speak Chinese??/ | 06:57 |
SouravAj | huxiaolei sure u can speak but plz dont write | 06:58 |
cfhowlett | !zh|huxiaolei: | 06:58 |
ubottu | huxiaolei:: 如欲獲得中文的協助,請輸入 /join #ubuntu-cn 或 /join #ubuntu-tw | 06:58 |
huxiaolei | ...... | 06:58 |
huxiaolei | 为什么我的系统有时候启动时会进入文字界面? | 06:59 |
huxiaolei | 这个几率还挺大的 | 06:59 |
cfhowlett | !english|englishuxiaolei: | 06:59 |
ubottu | englishuxiaolei:: The #ubuntu, #kubuntu and #xubuntu channels are English only. For a complete list of channels in other languages, please visit https://wiki.ubuntu.com/IRC/ChannelList | 06:59 |
cfhowlett | !zh|huxiaolei: | 06:59 |
ubottu | huxiaolei:: 如欲獲得中文的協助,請輸入 /join #ubuntu-cn 或 /join #ubuntu-tw | 06:59 |
=== defekt is now known as Guest20633 | ||
=== defekt_ is now known as defekt | ||
=== mulder_ is now known as Guest80227 | ||
greenmang0 | what is the right way to increase number of open files limit for all users on 11.10? the wild card entry "* soft nofile 32000" and "* hard nofile 32000" doesn't seem to work for all users but only a default user - ubuntu in my case | 07:06 |
Guest80227 | I am trying to remove "AMD Unsupported hardware" watermark on 12.04 and can't seem to do it, any help welcome. | 07:06 |
pranav | i am on ubuntu 12.04 with a wired internet connection. I need to share this connection via wifi to a windows 7 system. Any suggestion please ? | 07:06 |
konza | greenmang0, Tis may help you http://www.cyberciti.biz/faq/linux-increase-the-maximum-number-of-open-files/ | 07:07 |
[blazed-vms-] | hi i need some help with vnc on ubuntu 12.10, i cant seem to rdp tro my ubuntu install from my desktop. any help would be awesome | 07:07 |
pranav | i am on ubuntu 12.04 with a wired internet connection. I need to share this connection via wifi to a windows 7 system. Any suggestion please ? | 07:07 |
SwedeMike | pranav: https://help.ubuntu.com/community/Internet/ConnectionSharing | 07:08 |
defekt | !repeat | pranav | 07:08 |
ubottu | pranav: Don't feel ignored and repeat your question quickly; if nobody knows your answer, nobody will answer you. While you wait, try searching https://help.ubuntu.com or http://ubuntuforums.org or http://askubuntu.com/ | 07:08 |
robertzaccour | goin to sleep | 07:09 |
robertzaccour | later yall | 07:09 |
Dogget | I am trying to remove "AMD unsupported hardware" in 12.04 64 bits and I can't seem to do it right, any help welcome. | 07:09 |
Dogget | Forgot to mention it's a watermark, doh! | 07:09 |
blackshirt | hello | 07:15 |
pranav | i am on ubuntu 12.04 with a wired internet connection. I need to share this connection via wifi to a windows 7 system. Any suggestion please ? | 07:15 |
pranav | SwedeMike: that was for 2 Ethernet ports | 07:15 |
=== pranav is now known as trap24 | ||
=== zz_megabitdragon is now known as megabitdragon | ||
Xiaolei | #ubuntu-cn | 07:18 |
Xiaolei | #ubuntu -cn | 07:18 |
cfhowlett | Xiaolei: type /join #ubuntu-cn | 07:19 |
[blazed-vms-] | anyone any good with vnc? | 07:20 |
[blazed-vms-] | i have set it all up but im getting a grey screen? | 07:20 |
=== misha is now known as Guest998 | ||
Guest998 | Hey guys can you please help me... I have been stressing about this for a while now... | 07:21 |
slackerboy | any screen shot pastebin ? | 07:21 |
slackerboy | !pastebin | 07:21 |
ubottu | For posting multi-line texts into the channel, please use http://paste.ubuntu.com | To post !screenshots use http://imagebin.org/?page=add | !pastebinit to paste directly from command line | Make sure you give us the URL for your paste - see also the channel topic. | 07:21 |
blackshirt | guest998, what the problems was happened ? | 07:21 |
Dogget | I am trying to remove "AMD unsupported hardware" in 12.04 64 bits and I can't seem to do it right, any help welcome please. | 07:21 |
Xiaolei | #ubuntu-cn | 07:22 |
Guest998 | Ok so I have never been able to get my hdmi to work. I have an envy14 with ati 5650 switchable graphics card. I tried the fglx driver, and the driver on ati website and no dice | 07:22 |
blackshirt | Dogget, what amd device you have ? | 07:23 |
cfhowlett | 小雷输入/ join#ubuntu的-CN | 07:23 |
Dogget | @blackshirt ati 7850 | 07:23 |
DreadKnight | hello, there's this retarded pop-up that appears at login and from time to time, asking me to provide password for an account (which is my mail email address), I removed all online accounts and account credentials like that; it's annoying that it steals keyboard focus and I can't use any hotkeys and such... any suggestions? :( | 07:23 |
Dogget | The driver itself works fine, it is the watermark that is annoying! | 07:23 |
Dragonster82 | Hey does anyone know why gtk-recordmydesktop records the frames too fast? I've put it at 30fps but its playback is way too fast. | 07:23 |
Guest998 | What is the watermark thing you guys talk about? | 07:24 |
blackshirt | dogget, i haven't this devices, is this devices belong to newer release ? | 07:24 |
Jordan_U | trap24: Create a new ad-hoc connection with network-manager, and in nm-connection-editor configure this ad-hoc connection to be "Shared to other computers". (then just connect to this ad-hoc network from your Windows machine and you're done). | 07:24 |
Dogget | Not sure really | 07:24 |
Dogget | I tried using 12.10 but the ati driver is a no go and screw my system with a massive lag overall, so reverted back to 12.04 which is smooth as butter. | 07:25 |
Xiaolei | 怎么进入中文IRC?? | 07:25 |
Xiaolei | 。。。。。help!!!! | 07:25 |
rusher | Hi, I have a problem with freezing ubuntu. Once a time freezes my system and I can't even restart x server. | 07:26 |
[deXter] | !cn | Xiaolei | 07:26 |
ubottu | Xiaolei: 如欲獲得中文的協助,請輸入 /join #ubuntu-cn 或 /join #ubuntu-tw | 07:26 |
trap24 | Xiaolei: how to enter chinese irc | 07:26 |
cfhowlett | Xiaolei: 小雷这IRC通道是英语,。加入Ubuntu的cn代表中国语言支持。抱歉。 | 07:27 |
mmm4m5m | Hi. A little help please. Connected with ssh to remove PC. I am able to run "gedit" (there) and use it. I am NOT able to run "sudo -u another_user gedit"... Usually, in case of local PC - I can give access to other users like this: "xhost +si:localuser:user"... How to give access to the remote user with name "another_user" ? Thanks!!! | 07:29 |
Dogget | @blackshirt do you think you can help? :-( | 07:29 |
Xiaolei | R U Chinese?? | 07:29 |
mmm4m5m | me? lol, no | 07:30 |
Guest998 | How do I change my name on this | 07:30 |
bazhang | Xiaolei, this is ubuntu support in english | 07:30 |
trap24 | Jordan_U: it says passphrase incorrent in windows | 07:30 |
blackshirt | dogget, not much ... But if you want to remove the driver, you can using apt/aptitude | 07:30 |
trap24 | although i have kept it same | 07:30 |
bazhang | Xiaolei, /join #ubuntu-cn for chinese support | 07:30 |
cfhowlett | bazhang: I keep telling him that... | 07:30 |
bazhang | cfhowlett, he's there. | 07:31 |
Dogget | I don't want to be honest, I just want to get rid of that watermark mate. | 07:31 |
Dogget | There must be a way. | 07:31 |
cfhowlett | :) | 07:32 |
=== Guest998 is now known as MishkaBear | ||
Kinder-Pingvi | hello... i have a question.. | 07:33 |
zutgorak | ls | 07:33 |
MishkaBear | Hey guys I need some help, I have an envy 14 running ubuntu 12.04. I have never ever been able to get my hdmi output to work. It works on windows but not on ubuntu. Can anyone help please? | 07:33 |
blackshirt | !ask | kinder-pingvi | 07:33 |
ubottu | kinder-pingvi: Please don't ask to ask a question, simply ask the question (all on ONE line and in the channel, so that others can read and follow it easily). If anyone knows the answer they will most likely reply. :-) See also !patience | 07:33 |
MishkaBear | I have downlaoded the ati drivers, no dice. I currently deleted all the ati drivers | 07:34 |
Kinder-Pingvi | i need help with my wireless.. atheros ar242x/542x .. very low speed download and upload... and somesimes wifi beaks the connection.. | 07:34 |
Kinder-Pingvi | sorry my english... :) | 07:34 |
trap24 | how to know the usernames of people connecting to my wireless internet ? | 07:35 |
konza | Kinder-Pingvi, Is it really fast when you connect it via LAN | 07:35 |
trap24 | :( i had to manage without passphrase | 07:35 |
Kinder-Pingvi | konza: on windows and my old fedora all ok.. but ubuntu.. | 07:35 |
MishkaBear | You can't log into your router? | 07:35 |
insomniac_lemon | trap24, MAC filtering? That's be the closest wat. | 07:36 |
insomniac_lemon | *way | 07:36 |
konza | Kinder-Pingvi, did you google it? If you can show me some threads i will look into it. | 07:36 |
MishkaBear | Does anyone know how to get the hdmi output to work with a ati5650 graphic card? | 07:36 |
Kinder-Pingvi | yes... and i have not seen module ath_pci in ubuntu.. it has only ath5k ath3k ath... but no ath_pci.. | 07:37 |
trap24 | insomniac_lemon: well ok. but i just want to know who is connected to my adhoc wifi networks | 07:37 |
=== SeoZ is now known as SeoZ-work[AWAY] | ||
Kinder-Pingvi | ps.. ubuntu 12.10 :) | 07:37 |
trap24 | usernames, their bandwidth usages ? | 07:37 |
neoman4426 | My trackpad and wireless (at least. haven't checked if wired still works, but it shows up in the network manager, which the wireless doesn't) have stopped working since the upgrade to 12.10. Plugging in a mouse works. Both trackpad and wireless worked in 12.04, in the Windows partition, and in 12.10 live session. Any ideas? | 07:37 |
MishkaBear | You can't really do that trap | 07:37 |
MishkaBear | You would have to get them to download a program | 07:37 |
nimda28 | Last driver version? | 07:37 |
MishkaBear | And then you can see everyones bandwidth usage. I looked that up once | 07:37 |
ahmad | can anyone help with a vmware issue i am having | 07:37 |
MishkaBear | nimda are you asking me? | 07:38 |
ahmad | i was trying it out and after installing its asking for keneral headers for version 3.5.0-17-generic | 07:38 |
ahmad | its vmware 9 | 07:38 |
nimda28 | yeah | 07:38 |
trap24 | MishkaBear: for the time being, i just want to know the usernames of people using my ad-hoc wifi :/ | 07:38 |
MishkaBear | I tried the latest one I think 12.8 | 07:38 |
konza | !tab | 07:39 |
ubottu | You can use your <tab> key for autocompletion of nicknames in IRC, as well as for completion of filenames and programs on the command line. | 07:39 |
konza | !tab | Kinder-Pingvi | 07:39 |
ubottu | Kinder-Pingvi: please see above | 07:39 |
MishkaBear | nimda28: I have tried for the last 10 updates to see if it will make the hdmi work but no | 07:40 |
konza | Kinder-Pingvi, were you able to install the driver | 07:40 |
=== mio is now known as dk123 | ||
MishkaBear | Hey trap24 there are some unix commands | 07:41 |
MishkaBear | Are you using linux? | 07:41 |
nimda28 | the driver you install give you some kind of assistant ? , in my nvidia card i use that assistant to configure the output | 07:42 |
celthunder | MishkaBear: xrandr and set your hdmi output as the one you want. | 07:43 |
dk123 | /msg NickServ VERIFY REGISTER dk123 ecaevqxynbdb | 07:43 |
MishkaBear | celthunder: ok I'll try now | 07:43 |
greenmang0 | konza, thanks… the wildcard actually works, the thing is I was using "su www-data" and then "ulimit -n" to check if the limit is increased … the thing is "pam_limits.d" is commented out in "/etc/pam.d/su" so ulimit was showing default value 1024, i uncommented the line and now i see the expected value | 07:43 |
the_dark_knight | hey guys, what if i want to run a script at 1PM everyday. what do i put in crontab | 07:43 |
celthunder | dk123: lol you added a space there | 07:43 |
dk123 | @celthunder thanks | 07:44 |
konza | greenmang0, Welcome | 07:44 |
MishkaBear | celthunder: hey man how do I show you what popped up when I ran xrandr | 07:44 |
celthunder | MishkaBear: pastebin ? | 07:44 |
MishkaBear | I can't copy and paste in my cmd window | 07:45 |
ignerious | unity crash after the installation of AMD additional driver in ubuntu 12.10. Unity does not start after restart. PLease Help!!!!!!!!!!!!!!!!!!!!!!! | 07:45 |
neoman4426 | MishkaBear, could install pastebinit and pipe the command into that | 07:45 |
celthunder | MishkaBear: there are scripts that output to pastebin all your output pastebinit for example | 07:46 |
MishkaBear | celthunder: how do you select the hdmi output you want though? It says vga at the bottom | 07:46 |
trap24 | MishkaBear: nmap -? | 07:46 |
MishkaBear | celthunder: ok man thanks I'll download pastebin | 07:46 |
insomniac_lemon | ignerious, Unity and AMD just seems like a really bad combo.... especially if you've got an Intel processor.... (AMD & Intel don't go so well together......) | 07:46 |
=== mio is now known as Guest26804 | ||
CrazyHorse18 | should i run 32bit or 64bit for ubuntu? | 07:49 |
CrazyHorse18 | for a server running postgres and nginx | 07:50 |
the_dark_knight | nimda28: thanks | 07:50 |
nimda28 | =) | 07:50 |
brontosaurusrex | CrazyHorse18: why not 64? | 07:51 |
brontosaurusrex | all my servers are running 64 since 2009 i think | 07:51 |
CrazyHorse18 | oh it just gave me two options | 07:51 |
MishkaBear | Screen 0: minimum 320 x 200, current 1600 x 900, maximum 8192 x 8192 | 07:51 |
MishkaBear | LVDS1 connected 1600x900+0+0 (normal left inverted right x axis y axis) 322mm x 181mm | 07:51 |
nimda28 | yeah 64 | 07:51 |
MishkaBear | 1600x900 60.0*+ | 07:51 |
MishkaBear | 1440x900 59.9 | 07:51 |
MishkaBear | 1360x768 59.8 60.0 | 07:51 |
FloodBot1 | MishkaBear: Please don't flood; use http://paste.ubuntu.com to paste; don't use Enter as punctuation. | 07:51 |
MishkaBear | 1152x864 60.0 | 07:51 |
MishkaBear | 1024x768 60.0 | 07:51 |
MishkaBear | 800x600 60.3 56.2 | 07:51 |
CrazyHorse18 | :D | 07:51 |
Dragonster82 | I is jesus. | 07:52 |
nomike | hi | 07:53 |
MishkaBear | ok celthunder <script src="http://pastebin.com/embed_js.php?i=b9rGVNin"></script> | 07:54 |
nomike | I want to create a preseed file for ubuntu quantal. I already have one for precise, but afaik the official recommended way is to use the sample file from the "Installation Guide" on ubuntu.com and customize it with the settings from the previous preseed file instead of just updating the old one. | 07:55 |
nomike | However there is no "Installation Guide" for quantal. Where is the preseeding documented and where can I find the example file? | 07:55 |
nomike | (here https://help.ubuntu.com/12.10/index.html point 3. is missing) | 07:56 |
insomniac_lemon | MishkaBear, you also can use Ctrl+enter as a line break, (or at least in my IRC client I can) | 07:56 |
insomniac_lemon | See? | 07:56 |
MishkaBear | skfskdf | 07:57 |
MishkaBear | Hmmm I hit ctrl enter and nothing | 07:57 |
MishkaBear | My script didn't work | 07:57 |
MishkaBear | I used that pastebin website and it didn't show up | 07:57 |
MishkaBear | Ahhh ok guys heres my randr http://pastebin.com/embed_js.php?i=b9rGVNin how do i change it to use hdmi | 07:59 |
[x] | http://pastebin.com/iuift04a | 08:03 |
[x] | vlc getting crashed while opening video | 08:03 |
[x] | audio file working fine | 08:03 |
[x] | any help to over come this problem | 08:03 |
MishkaBear | celthunder: hey there how do you choose the hdmi it says sometime hdmi could say its a vga instead and needs to be set up | 08:06 |
MishkaBear | Anyone there know how to use xrandr? | 08:08 |
frankpolidoro01 | buongiorno :) | 08:09 |
cfhowlett | !it|frankpolidoro01: | 08:10 |
ubottu | frankpolidoro01:: Vai su #ubuntu-it se vuoi parlare in italiano, in questo canale usiamo solo l'inglese. Grazie! (per entrare, scrivi « /join #ubuntu-it » senza virgolette) | 08:10 |
shawnqin | anybody there? | 08:10 |
brontosaurusrex | shawnqin: 1597 users - a bot or two | 08:11 |
underground | alguem em casa ??? | 08:12 |
Piratelv | Hello guys and gals, I got a bit of trouble with my install of ubuntu 12.04. Sometimes when graphical power is needed the entire system freezes | 08:14 |
=== owen is now known as Guest59797 | ||
underground | hello | 08:15 |
underground | (: | 08:15 |
frankpolidoro01 | is here anybody who can help me for a matter with gnome 3 in ubuntu 12.10 ? | 08:15 |
underground | no speak englesh | 08:16 |
gordonjcp | frankpolidoro01: don't ask to ask | 08:16 |
ardchoille | underground: which language? | 08:16 |
Piratelv | I don't expect a magic solution, but some help in debugging would be appreciated | 08:17 |
underground | I'm sorry | 08:17 |
ardchoille | underground: what is your native language? | 08:18 |
adrianrly | frankpolidoro01, why don't you post the question? | 08:18 |
ardchoille | !br | underground | 08:18 |
ubottu | underground: Por favor, use #ubuntu-br para ajuda em português. Para entrar no canal por favor faça "/join #ubuntu-br" sem as aspas. Para a comunidade local portuguêsa, use #ubuntu-pt. Obrigado. | 08:18 |
underground | ok | 08:19 |
brady | dogget, how did you revert back? | 08:20 |
ssedano | Hi, how can a cpp program that is running in ubuntu? (I know that this is not a cpp channel but I can't find anything in google) thanks | 08:20 |
ardchoille | ssedano: you might want to finish that sentence :) | 08:21 |
nimda28 | jeje | 08:22 |
Jimster480 | gnite all | 08:23 |
yalex | Hello how does update-initramfs determine the latest kernel version? | 08:28 |
ahmad | can anyone please provide some instructions on trying to install openstack xcp on ubuntu | 08:30 |
ahmad | yes i have tried other channel but no one replies | 08:30 |
ardchoille | ahmad: I see openstack in the repos, is that what you want? | 08:32 |
yalex | for some reason update-initramfs seems to be picking up a kernel from opensuse 3.6 as opposed to ubuntu 3.5 being the latest | 08:32 |
ardchoille | openstack-dashboard - django web interface to Openstack | 08:32 |
ahmad | i hope its not that easy.. | 08:33 |
ardchoille | ahmad: apt-cache search -n openstack | 08:33 |
ahmad | perhaps it is? let me try see what happens.. ty ardchoille | 08:34 |
ardchoille | yw | 08:34 |
ardchoille | ahmad: wait, what I see in the repos seems to be django web interface to Openstack | 08:35 |
ardchoille | leading me to believe that openstack is something entirely different | 08:35 |
ardchoille | !openstack | 08:35 |
MishkaBear | ok guys so I found the xorg file and I want to change the file so I can put the VGA device in it. Does anyone know how to do that? | 08:35 |
ahmad | !openstack | 08:35 |
ahmad | he doesnt know anything lol | 08:36 |
=== enrico_ is now known as DPITTI | ||
ardchoille | ahmad: perhaps I was wrong, that item in the repos is a django web interface to openstack | 08:36 |
MishkaBear | Theres a section that says device and one that says monitor. Someone onlne said it was device but does anyone know how to do that | 08:36 |
ahmad | http://docs.openstack.org/trunk/openstack-compute/install/content/ch_install-dashboard.html | 08:36 |
ahmad | i found this though, for everyone's information | 08:36 |
ardchoille | ahmad: yeah, the dashboard is what I found in the repos | 08:37 |
ahmad | yeappers | 08:38 |
=== jakub_ is now known as jakub_r | ||
ardchoille | ahmad: that's quite an interesting project | 08:39 |
ahmad | ardchoille, yes very interesting i am learning a lot because of it, but also very difficult :) | 08:40 |
dyd | guys where can i ask about linux distros? | 08:40 |
nimda28 | ?? | 08:41 |
ardchoille | dyd: perhaps join #linux | 08:41 |
=== Kitar|st_ is now known as Kitar|st | ||
=== pranav is now known as trap24 | ||
trap24 | is there a way to place "force quit application" in the bar at the top in unity ?? :( | 08:43 |
=== TuxLof_ is now known as TuxLof | ||
adrianrly | trap24, click X multiple times. | 08:45 |
jiero | hi, I clicked on "Access Your Private Data" trying to access my encrypted home directory on same PC. But nothing happened, and I tried "ecryptfs-mount-private" then, nothing appears. | 08:46 |
trap24 | adrianrly, i've to reinstall pidgin, deluge, and now i installed wireshark is freezing just when i am about choose network interface, give a dialogue of "report of problem".. and they say 12.04 is stable :( | 08:47 |
trap24 | am i being wrong somewhere or what.. upgraded from 10.04 | 08:47 |
KaKila | hi! When I click on shutdown my desktop computer goes down but 3 seconds after it comes up again automatically. any fix to this? Using 12.10 | 08:48 |
Eagleman | Where can i find the folder modules for apache | 08:49 |
adrianrly | trap24, I don't trust upgrades and I find them quite of a trouble. I never did a upgrade. | 08:50 |
trap24 | it freezes often when i shutdown my computer using 'halt' with those sliding bars. i never knew linux freezes during shutdown, and often the intel_GPU.py error reporting pops which i had to ignore.. anyway to never show them ? | 08:50 |
fidel_ | Eagleman: the main apache files are in /etc/apache ...including mods-available & -enabled ...if thats what you are asking | 08:50 |
trap24 | adrianrly: what do you use then ? | 08:51 |
fidel_ | well: /etc/apache2 ;) | 08:51 |
adrianrly | trap24, fresh install is the best way. | 08:51 |
adrianrly | trap24, again. This is my point of view. | 08:51 |
trap24 | adrianrly: seems like it. yup | 08:51 |
Eagleman | I have to find php4.so | 08:51 |
nimda28 | locate php4.so | 08:52 |
adrianrly | trap24, it's like... the time you spend backing up your stuff is less than fixing issues. And it's good to have a backup. | 08:52 |
adrianrly | Eagleman, are you sure you have PHP4 ? I found mine here: /usr/lib/apache2/modules/libphp5.so | 08:53 |
artemm | Hello. During apt-get upgrade I got message: " (Reading database ... 85%%dpkg: unrecoverable fatal error, aborting: reading files list for package 'liborc-0.4-0:i386': Is a directory Error in ...". And I actually have that as directory. /var/lib/dpkg/info/liborc-0.4-0:i386.list Any ideas what is the problem or how to solve this? | 08:54 |
a1_ | hi all, i need to find a word at all of my file system, find and sed coomand didnt help me, what should i do plz? | 08:55 |
Eagleman | adrianrly nothing about php in there | 08:55 |
rigo | mc "freezes" and/or hangs if i copy larger files from ftp to local ntfs mounted hdd. it goes to 100% than it stops. (file is ok, but i have to restart the session.) | 08:55 |
fidel_ | a1_: first of all start with a clear description. are you lookin for a word-file or a file containing a specific word? | 08:56 |
rigo | i removed with dpkg --purge deleted all the *mc* files from ~ and from usr/share too. no luck. | 08:56 |
lapion | so anyone know why I have to reboot everytime I do a cold start for udev modifications to take effect ? | 08:56 |
KaKila | hi again, my computer reboots instead of shutdiwn when I send init 0 | 08:57 |
nimda28 | @artemm apt-get install --reinstall packagename ?? | 08:57 |
a1_ | fidel_, there are several files that may be my word is in it, i wanna know those file that have my word . | 08:58 |
fidel_ | a1_: and what methods have you tried so far? | 09:00 |
artemm | @nimda28 it gives the same error | 09:00 |
rigo | its pretty annoying. i have to restart the whole shit after all large files. i download a 50gb pack with lot of large files.. | 09:00 |
KaKila | nimda28: reboots after init 0 | 09:00 |
ewook | *yawn* | 09:01 |
amgarching | is povray gone in 12.04? | 09:02 |
=== uksysadmin is now known as itarchitectkev | ||
fidel_ | a1_: in short: grep can do that | 09:02 |
fidel_ | hf | 09:02 |
Eagleman | Where do i download php4*.so? | 09:03 |
fidel_ | Eagleman: why do you think you need to download php4*.so ? | 09:04 |
Eagleman | becuase php is not working on php pages | 09:04 |
Eagleman | it just downloads the .php files when i visit one of the pages | 09:05 |
fidel_ | Eagleman: afaik php5 is default ;) | 09:05 |
fidel_ | so consider checking what versions you are using - then setup a php test file using phpinfo() ...and go further | 09:05 |
=== alin|mobile is now known as alinmear | ||
a1_ | fidel_, i just can search in a file my word with sed and find command,but i need it search all of my files that exist on my file system. | 09:05 |
Eagleman | PHP 4.4.4-9 (cli) (built: Mar 4 2007 13:34:30) | 09:05 |
fidel_ | a1_: i told you everything you need from my point of view. good luck ;) | 09:06 |
bkc_ | a1_: for FILE in `find /`; do grep "someword" $FILE; done | 09:07 |
bkc_ | a1_: also, why would you ever want to search for a specific word in your _entire_ filesystem? o.O | 09:08 |
=== alinmear is now known as alin|mobile | ||
=== K[a]rtagis is now known as Kartagis | ||
=== erry_ is now known as erry | ||
Piratelv | did anyone see my question? | 09:10 |
bkc_ | nope | 09:11 |
a1_ | bkc_, i have 500 files, and i wanna find to those files about an IP. | 09:12 |
20WABFZKK | nimda28: yeah, is always rebootign. Any idea? | 09:12 |
insomniac_lemon | Piratelv, dedicated or integrated graphics? Have you tried using Unity 2D or GNOME 3 instead of Unity? | 09:12 |
Piratelv | nvidia ( 9800GT) , propiatary driver, V295.40. also tried the current-updates but same result | 09:14 |
ewook | a bit annoying, anyone know the reason why 12.04 lags behind so much on the nvidia drivers? Isn't that one provided from canonical ? | 09:14 |
bkc_ | ewook: install the X-Swat ppa :) | 09:14 |
Piratelv | yes it is. it the one from the repo ( nvidia-current) | 09:14 |
ewook | Piratelv: that one e-historic :p | 09:15 |
20WABFZKK | nimda28: it hangs on the shutting down process and never finishes | 09:15 |
ewook | pre-historic, not e-historic | 09:15 |
rigo | the install reinstall thing looks good nevertheless i copy now smaller files | 09:15 |
ewook | bkc_: aaaha, that's neato. better maintained? | 09:15 |
Piratelv | ewook, Sorry I didn't get that. What do you mean? | 09:15 |
bkc_ | ewook: more like cutting edge, the ubuntu-provided is tested and lags a few majors behind because they don't want the serious bugs that *might* exist... | 09:16 |
alexis_ | who know how to instal league of legends on linux ? | 09:16 |
bkc_ | Piratelv: he meant that your graphicscard is old :) | 09:16 |
bkc_ | alexis_: http://appdb.winehq.org/objectManager.php?sClass=application&iId=10436 | 09:17 |
bkc_ | alexis_: http://na.leagueoflegends.com/board/showthread.php?t=1946188 | 09:17 |
bkc_ | LoL for Linux isn't done yet | 09:17 |
Piratelv | bkc_, ewook , ah yea. but still doing 100+ fps on most of my games, so I'm happy | 09:17 |
gordonjcp | Piratelv: you don't need faster than 60Hz | 09:18 |
bkc_ | ewook: I'm using the latest driver from nvidia (304.58 iirc) and it's working great on my GTS250 :) | 09:18 |
gordonjcp | Piratelv: your monitor isn't going to display it any quicker | 09:18 |
bkc_ | gordonjcp: that actually depends on how the game is built... | 09:18 |
ewook | bkc_: aah, I installed mine manually.. thanks for the tip! | 09:19 |
20WABFZKK | nimda28: ok, I will try bootoptions for acpi | 09:19 |
bkc_ | if the input-events are checked on each render-pass, then yes... higher fps would result in a smoother event-handling... | 09:19 |
bkc_ | ewook: just use the PPA :) | 09:19 |
20WABFZKK | nimda28: first removing it | 09:19 |
=== 20WABFZKK is now known as Kakila | ||
ewook | bkc_: will do, thanks! | 09:20 |
alexis_ | bkc i already had tried this tutorial but it didn't help me | 09:20 |
Piratelv | anyhow. Any of you have some points on how I could debug the driver. As soon as it crashes I lose all mouse and keyboard control | 09:20 |
bkc_ | ewook: using the PPA is better than manual install because then apt would keep track of updates for you :) | 09:20 |
bkc_ | Piratelv: check the logs, file bug-reports, etc... it's a propietary driver, so there's really nothing you can do about it :) | 09:21 |
bkc_ | logs are in /var/logs/Xorg.log | 09:21 |
bkc_ | should be in* | 09:21 |
gordonjcp | bkc_: good point | 09:22 |
the_dark_knight | hi, How do I get notified by email every time my cronjob is done? should I put my email-id id MAIL variable in crontab? | 09:22 |
bkc_ | the_dark_knight: do you have sendmail setup correctly? | 09:22 |
the_dark_knight | is sendmail a package? | 09:23 |
ewook | bkc_: yep, I know. didn't know tho that one existed ;) | 09:23 |
bkc_ | ewook: okey :) | 09:23 |
chaotix | hi... i am about to do a fresh install of ubuntu gnome remix 12.10 and have a (probably dumb) question, but here goes... the options are for x86, and amd64... does amd64 mean you MUST have amd and not intel? because i have 64bit, but it is intel | 09:23 |
bkc_ | the_dark_knight: yes... | 09:23 |
bkc_ | chaotix: both | 09:24 |
ewook | chaotix: nope, amd94 goes for intels x64 arch as well. | 09:24 |
ewook | oops, amd64 eveb | 09:24 |
chaotix | ok | 09:24 |
ewook | even | 09:24 |
nailora1 | hi, my system (4 cpus) has load 25, but the cpus idle, no swapping or other i/o is happening and the system does not feel sluggish. what could that be? | 09:24 |
chaotix | so i should use the 64 one right? | 09:24 |
ewook | chaotix: what cpu do hoy have? | 09:25 |
bkc_ | nailora1: load what? | 09:25 |
a1_ | fidel_, thanks, but i use find . grep "my-IP" / and nothing happen: | 09:25 |
ignerious | can anyone help me to fix my grafic driver problem.pleaseeeeeeeeeeeeee | 09:25 |
=== magentar_ is now known as magentar | ||
nailora1 | bkc_: system load as shown by e.g. uptime | 09:25 |
chaotix | ewook, t4300 | 09:25 |
chaotix | intel | 09:25 |
ignerious | can anyone help me to fix my grafic driver problem.pleaseeeeeeeeeeeeee | 09:26 |
bkc_ | nailora1: that I do know... however some people thinks that CPU usage is the same as load... which it isn't... | 09:26 |
chaotix | ewook, my windows bersion is 64bit | 09:26 |
ewook | chaotix - yepp, i'd go with the amd64 :) | 09:26 |
chaotix | ok.. thanks. bye | 09:26 |
chaotix | :) | 09:26 |
bkc_ | !ask | ignerious | 09:27 |
ubottu | ignerious: Please don't ask to ask a question, simply ask the question (all on ONE line and in the channel, so that others can read and follow it easily). If anyone knows the answer they will most likely reply. :-) See also !patience | 09:27 |
ewook | chaotix np! gl! | 09:27 |
nailora1 | bkc_: the load displayed by uptime is 25 and i do not know the reason for it. i'd like to find out what causes this load. | 09:27 |
nailora1 | any ideas where to look | 09:28 |
arulmozhi | @chaotix: it supports both. amd64 and x64 are synonymous here. | 09:29 |
bkc_ | nailora1: it could be any number of things that could make it go up. I would need more specific details about your system to even make an estimated guess... | 09:29 |
=== dana is now known as Guest25962 | ||
ignerious | when i install AMD additional driver and restart , unity get crashed after restart | 09:30 |
=== Breadflour is now known as Dreadtower | ||
nailora1 | bkc_: feel free to ask for any information you might need | 09:30 |
spaa | hi , ty | 09:30 |
a1_ | grep works, thanks all :) | 09:30 |
ignerious | only walpaper apperrs | 09:30 |
ignerious | i use ubuntu 12.10 64 bit | 09:31 |
bkc_ | nailora1: I'd basically need access to the computer, so no go there :) as long as the CPU-load, ram-usage, etc are fine and the system isn't sluggish, just ignore the load... it's just a number too see how much a machine is used anyways :) | 09:31 |
ignerious | what should i do???? | 09:31 |
ignerious | please help meeee | 09:32 |
bkc_ | ignerious: did you follow the wiki to the letter? | 09:32 |
bkc_ | also | 09:32 |
bkc_ | !patience | ignerious | 09:32 |
ubottu | ignerious: Don't feel ignored and repeat your question quickly; if nobody knows your answer, nobody will answer you. While you wait, try searching https://help.ubuntu.com or http://ubuntuforums.org or http://askubuntu.com/ | 09:32 |
cfhowlett | ignerious: install LTS only ... 12.04. Unless you REALLY need the latest, greatest, shiny version and you're willing to pull your hair in frustration every 6 months. | 09:32 |
1JTAANKWR | pc reboots instead of shutdown. even with noacpi in boot options | 09:32 |
Piratelv | bkc_, yes, I checked the logs. All logs stop at the exact time of freeze. The xorg logs shows something. A partial backtrace ( only first line ) | 09:33 |
pvh_sa | hi there, I'm running 12.04 - when I open a document with LibreOffice, nothing appears in the Dock or the windows that I can access using Alt-Tab - so as soon as focus leaves the window, its effectively gone. Any hints as to how to fix this? | 09:34 |
ignerious | but LTS has bug that after being idle for long time it do not display anything | 09:34 |
bkc_ | cfhowlett: that's a lot of bull for one line :) the latest stable release is well tested and most of the bugs have been worked out already... so don't go blurting out nonsence without giving a valid reason... | 09:34 |
ignerious | so what should i do??? | 09:35 |
cfhowlett | bkc_: don't go assuming I don't have a valid reason. | 09:35 |
ignerious | how should i fix this?? | 09:35 |
cfhowlett | bkc_: but thanks for your opinion | 09:35 |
bkc_ | ignerious: have you read this one? https://bugs.launchpad.net/fglrx/+bug/1068661 | 09:36 |
ubottu | Launchpad bug 1068661 in fglrx-installer (Ubuntu) "1002:6740 Unity does not load after installing fglrx-installer Radeon HD 6700M Series" [High,Confirmed] | 09:36 |
=== 1JTAANKWR is now known as Kakila | ||
magic_al | hi all, i just installed skype for ubuntu after i set up a ubuntu 12.04 version. however, there is no skype icon in the upper bar beside the time as it was before.... can i add app-icons? | 09:39 |
bkc_ | cfhowlett: reason being "it too new to be tested enough"? why do you think ubuntu is _not_ a rolling release distro? it's because they want stuff in testing for a few months first, to sort out the eventuall bugs and tweaks first... LTS is only good for one thing really... servers, where you can't have in-house stuff breaking every 6 months because some other package broke it's API/ABI when they up'ed the version... (read python & php) | 09:39 |
bkc_ | magic_al: I'm guessing you havn't turned on the sys-tray icon in skype-settings then :) | 09:40 |
cfhowlett | bkc_: again, thanks for your (unsolicited) opinion. Now can we get back to the channel topic please. | 09:40 |
bkc_ | sure :) | 09:40 |
ignerious | cfhowlett: can you help me?? | 09:41 |
cfhowlett | ignerious: I don't run 12.10. perhaps bkc_ can help. | 09:42 |
bkc_ | I've already pointed him too a bug-report that isn't resolved. My advice is to try the X-Swat PPA and see if the bug is fixed in the latest driver :) | 09:43 |
Guest82103 | ubuntu crash at the end when installing system message appear | 09:44 |
eddie_ | join #ruby | 09:44 |
Ribena | is there any way to edit the size of partitions? | 09:44 |
fairuz | Ribena: gparted (?) | 09:45 |
=== awk_ is now known as awkk | ||
=== awkk is now known as awk | ||
ignerious | when i install AMD additional driver and restart , unity get crashed after restart | 09:46 |
ignerious | please help meeee | 09:46 |
fairuz | ignerious: You can try to reinstall unity | 09:49 |
foobArrr | running jockey-gtk says "The program 'jockey-gtk' is currently not installed. You can install it by typing: sudo apt-get install jockey-gtk". running sudo apt-get install jockey-gtk says "jockey-gtk is already the newest version.". http://paste.ubuntu.com/1297072/ | 09:50 |
Guest82103 | can i install ubuntu in a ext3 or ext2 partition instead of a ext4? what is the difference? | 09:51 |
mikey1234 | Has anyone had this issue in 12.10 where if you install the proprietary nvidia drivers via the sources thing in the settings, once you reboot it locks up on the login screen. Like, it goes past it but you only see the wallpaper. | 09:51 |
MonkeyDust | ignerious what you can do: ctrl-alt F1 and then sudo apt-get update;sudo apt-get upgrade then try unity again | 09:51 |
cfhowlett | Guest82103: you can ... but ext4 is optimized for ubuntu. Stability and so forth. | 09:52 |
MonkeyDust | Guest82103 ext4 has journalling | 09:52 |
MonkeyDust | ignerious keep it in the channel please | 09:53 |
mikey1234 | Anyone? | 09:53 |
Guest82103 | MonkeyDust , have you ever flashed a bios to add something to it? | 09:53 |
Guest82103 | cfhowlett , have you ever flashed a bios to add something to it? | 09:54 |
the_dark_knight | how to check length of args in shell? | 09:54 |
cfhowlett | Guest82103: yes I have. why? | 09:54 |
gordonjcp | Guest82103: what do you mean, "add something to it"? | 09:54 |
Guest82103 | to add a boot option | 09:54 |
cfhowlett | Guest82103: I've only flashed a bios update | 09:55 |
=== PS is now known as Guest46931 | ||
hateball | the_dark_knight: do you mean you want to know how many characters a command is? | 09:56 |
Kakila | I can't shutdown. the computer reboots. any idea? | 09:56 |
MonkeyDust | Kakila try sudo init 0 | 09:56 |
Kakila | MonkeyDust: tried already. the same. only when i keep the power button for 5 secs the pc stays off. but then i can't wakeonlan | 09:57 |
=== pranav is now known as trap24 | ||
GuessWho | hello everybody, i am trying to access a shared drive that is present in my work place's network. What do I need to install/enable to see/access it from ubuntu? | 09:58 |
cfhowlett | GuessWho: pretty sure you need samba if it's windows | 09:58 |
GuessWho | to my knowledge it is just a normal ntfs drive that everybody can access | 09:59 |
dr_willis | just to see it. nautilus should be able to do that | 09:59 |
dr_willis | smb://servernameorip/sharename | 10:00 |
MonkeyDust | Kakila try sudo shutdown -h now (h = halt) | 10:00 |
Kakila | MonkeyDust: tried that too | 10:01 |
dr_willis | show rhe address entry field in nauitlus via / key. or ctrl-h i think | 10:01 |
federico | hi there | 10:01 |
=== federico is now known as Guest86937 | ||
cfhowlett | Guest86937: greetings | 10:01 |
Eagleman | For what is this being asked? Please enter the following 'extra' attributes | 10:02 |
Eagleman | to be sent with your certificate request | 10:02 |
Eagleman | A challenge password []: | 10:02 |
=== Youri is now known as YBook | ||
Guest25962 | ?????? | 10:03 |
bkc_ | Kakila: are you using Ubuntu Desktop or Ubuntu Server... the Server-edition will reboot even on shutdown-commands as a server isn't intended to be powered off :/ | 10:05 |
dr_willis | or his wake on lan is waking it backup as soon as it shutdowns | 10:07 |
dr_willis | or theres some annoying apci/bios/powermanager bug | 10:07 |
foobArrr | is there a way to get a window switching function like with compiz scale or apple's expose without compiz? | 10:07 |
bkc_ | also a very much valid explanation :) | 10:07 |
Kakila | bkc_: desktop | 10:08 |
Kakila | bkc_: afaik | 10:08 |
dr_willis | foobArrr: i recall a few experimental window managers with similer features. but they were not very mature | 10:08 |
bkc_ | Kakila: then I'd suggest borking throuhg your BIOS-settings :) | 10:08 |
dbugger | Hi guys. can someone tell me how could i create PDF files, on a system where I have no root privileges? im not sure what kind of library I could use | 10:09 |
cfhowlett | dbugger: libre office will export PDF | 10:09 |
cfhowlett | dbugger: as will open office | 10:09 |
bkc_ | foobArrr: basically, the expose-feature requires a compisiting window manager to work (off-screen rendering), so if you don't want compiz, try xcompmgr and see if that one has a similar feature :) | 10:09 |
=== guest-E2DMxc is now known as danidam | ||
bkc_ | cfhowlett: LibreOffice and OpenOffice is basically the same thing... just a few more (wanted) features in Libre compared to Open :) | 10:10 |
insomniac_lemon | dbugger: I don't know why you would need root to make .PDFs (or any files) anyways, unless it was in a restricted directory | 10:10 |
cfhowlett | bkc_: yep | 10:11 |
ahmad | can anyone please help with this ? i downloaded virtual box and i get the following error Kernel driver not installed (rc=-1908) | 10:11 |
foobArrr | bkc_: will do, thanks | 10:11 |
bkc_ | cfhowlett: ooh, read the wrong nick on the first comment, sorry ;) | 10:11 |
cfhowlett | bkc_: grrr | 10:12 |
bkc_ | insomniac_lemon: I'm guessing he's referring too the ability to install new packages. just guessing thou as I'm not familiar with the art of mind-reading just yet ;) | 10:12 |
bkc_ | dbugger: basically, both OpenOffice and LibreOffice (Writer for example) have the ability to export your document as a PDF-file :) | 10:13 |
insomniac_lemon | bkc_: Don't you need root privileges to install any packages? Or at least in Ubuntu by default | 10:14 |
bkc_ | ... now that is bad design :P | 10:14 |
dbugger | bkc_, cfhowlett, dont I need root privileges to install openoffice on a system? | 10:15 |
dbugger | OH! my bad! I thought I was in the PHP channel -_- | 10:15 |
dr_willis | libreoffice is installed by default | 10:15 |
dbugger | I was meaning a code in PHP :P | 10:15 |
bkc_ | no idea, I havn't used ubuntu in ~6months now :) | 10:15 |
bkc_ | dbugger: that however I can help with ;) | 10:15 |
Piratelv | ahmad, to install the kernel driver run the following | 10:16 |
Piratelv | sudo /etc/init.d/vboxdrv setup | 10:16 |
bkc_ | dbugger: start by looking at pdflib :) | 10:16 |
* Kakila shutdown | 10:17 | |
dbugger | bkc_, I looked at PDFLib but you have to use "make" to install, which surely needs root privileges | 10:17 |
dr_willis | not totally correct dbugger | 10:18 |
bkc_ | make doens't require root, installing the package might... depending on where you put it | 10:18 |
adrianrly | dbugger, make compiles. make install installs what you compiled, and requires root. | 10:18 |
bkc_ | adrianrly: _might_ require root... | 10:18 |
bkc_ | as I said... it depends on where php is installed, and where it looks for files... | 10:19 |
dr_willis | unless the user installs it to their Home | 10:19 |
dbugger | I see... | 10:19 |
dbugger | I will try it out | 10:19 |
bkc_ | s/files/libs/ | 10:19 |
bkc_ | dbugger: and this is true to every lib there is actually... | 10:19 |
bkc_ | whether you compile them yourself or install through a package-manager (unless you can install packages without root in ubuntu nowadays) | 10:20 |
ahmad | Piratelv, it says command not found | 10:21 |
ahmad | Piratelv, i looked it up in the directory as well, it doesnt exist | 10:21 |
ahmad | oh sudo apt-get install vboxdrv | 10:21 |
ahmad | xbox360? | 10:22 |
Piratelv | ahmad, what version of virtualbox are you using? | 10:22 |
ahmad | sudo apt-cache search vboxdrv | 10:22 |
ahmad | i am using 4.1.18 | 10:23 |
Piratelv | ahmad, that file should be part of the virtualbox-4.1 package | 10:23 |
=== Err404NotFound is now known as Error404NotFound | ||
Piratelv | bkc_, Finally has some usefull data. Xorg is complaining about too many EQ proccessings and halting to finish those | 10:24 |
ahmad | Piratelv, its not included i even tried upgrade virtualbox.. maybe let me try to reinstall | 10:25 |
=== hotfloppy is now known as Guest29070 | ||
=== Guest29070 is now known as PencintaKucing | ||
bkc_ | Piratelv: fall back to unity2D and see if that helps :) | 10:26 |
Piratelv | bkc_, I'm not using unity. While running that I would get a crash every +/- 23 minutes | 10:27 |
bkc_ | then turn off whatever composition that you have enabled :) | 10:27 |
bkc_ | bascially, your graphicscard or too old to run a full-blown 3D-accelerated desktop :P | 10:27 |
Piratelv | I did and then it runs smooth. but when gaming / watching flash the same happens | 10:27 |
Piratelv | (I did by just installing xubuntu-desktop) | 10:28 |
Piratelv | bkc_, How do you mean too old? I can run any game at 100+ fps without problem and on ubuntu 10.10 I have had 0 gfx issues for 3 years | 10:29 |
ahmad | Piratelv, i re installed it, still that module is not there and command not found | 10:29 |
ahmad | first i did sudo apt-get -y --purge remove virtual box and then sudo apt-get -y install virutalbox && sudo apt-get -y build-dep virtualbox | 10:30 |
Piratelv | ahmad, that exact command? | 10:31 |
ahmad | yes | 10:31 |
ahmad | sudo /etc/init.d/vboxdrv setup --> command not found or ls | 10:32 |
Piratelv | ok try 'sudo apt-get install virtualbox-4.1' | 10:32 |
rigo | bad | 10:32 |
ahmad | there is no virtualbox-4.1 package | 10:33 |
ahmad | sudo apt-cache search virtualbox-4.1 | 10:33 |
nimo_ | nvidia drivers via jockey cant be enabled in 12.04 ?? anyonw else ?? | 10:33 |
ewook | ahmad: did you add the virtualbox repo? | 10:33 |
rigo | apt-get install virtualbox virtualbox-dkms virtualbox-fuse virtualbox | 10:33 |
ewook | ahmad: and did you perform an apt-get update? | 10:33 |
ahmad | yes i did update but i do sudo apt-get -y install virtualbox works so i must have the repo | 10:34 |
ahmad | i am going to try to download the .deb file from https://www.virtualbox.org/wiki/Linux_Downloads | 10:34 |
rigo | have you read this? https://www.virtualbox.org/wiki/Linux_Downloads | 10:34 |
ewook | virtualbox is also in the default repositories. | 10:35 |
dr_willis | nimo_: good idea to state your video chipset | 10:35 |
ewook | ahmad: it's recommended that you use the virtualbox repo, instructions to follow from the link rigo gave you. | 10:35 |
ahmad | ty rigo and ewook i will try that next and let you guys know | 10:36 |
ewook | ahmad: cool :) | 10:36 |
rigo | trust m its easy to do it im a fckn noob either :D | 10:36 |
slackerboy | i am using a micromax modem in ubuntu 12.04 | 10:36 |
slackerboy | how can i connect the modem automatically upon boot | 10:37 |
dr_willis | slackerboy: usb? dialup? 3g? cable modem? | 10:37 |
slackerboy | i am using sakis 3g script currently | 10:37 |
slackerboy | dr_willis: it is a usb modem | 10:37 |
dr_willis | if you have a script that works, you could launch the script from /etc/rc.local | 10:37 |
bkc_ | slackerboy: what dr_willis said, and make sure it's after network :) | 10:38 |
=== alin|mobile is now known as alinmear | ||
borax12 | Does anyone here own a laptop with an ati mobility 5K series ? | 10:38 |
borax12 | and installed 12.10 | 10:38 |
borax12 | ? | 10:38 |
dr_willis | rc.local is the last service to run i belive. but the way upstart works. some services can wait untill otheres finish | 10:39 |
slackerboy | dr_willis: each time i connect using sakis 3g, it asks some parameters | 10:39 |
slackerboy | is it possible to make sakis 3g script noninteractive | 10:39 |
ahmad | if grep -r 'rfkill block bluetooth' /etc/rc.local >/dev/null; | 10:39 |
ahmad | then echo -e "Bluetooth disable on startup is already enabled."; | 10:39 |
ahmad | else sed 's/exit 0/rfkill block bluetooth\n&/g' /etc/rc.local > /etc/rc.temp && sudo mv /etc/rc.temp /etc/rc.local; | 10:39 |
ahmad | fi | 10:39 |
FloodBot1 | ahmad: Please don't flood; use http://paste.ubuntu.com to paste; don't use Enter as punctuation. | 10:40 |
rigo | can you tell me why the hell mc freezes if i download via ftp large files? | 10:40 |
dr_willis | without knowing what the script is asking, or doing. we dont know slackerboy | 10:40 |
ahmad | you might find this useful for scripting automatically commands into rc.local file | 10:40 |
slackerboy | it asks about the apn username passsword ,etc | 10:41 |
foobArrr | how do I switch between nvidia's binary blob and nouveau? how do I get higher resolution during boot with nvidia's binary blob? | 10:41 |
borax12 | is quantal causing issues with Ati 5K cards ? | 10:41 |
insomniac_lemon | I'm trying to do updates on Natty (11.04) and it's telling me "CD/DVD 'Ubuntu 12.04.1 LTS _Precise Pangolin_ - Release amd64 (20120823.1)' is required. Please insert the above CD/DVD into the drive '/media/cdrom/' to install software packages from it." | 10:41 |
dr_willis | slackerboy: look at the script and see if it can read settingsa from somewhere | 10:41 |
bkc_ | borax12: it borks up because of Xorg 1.13... so yes... install Catalyst 12.9 from AMD's website :) | 10:42 |
cfhowlett | insomniac_lemon: you've authorized the distribution upgrade so your sources are now set to 12.04.1 Cd | 10:42 |
borax12 | bkc_, thanks !! and that works perfectly ,does it ? | 10:42 |
bkc_ | borax12: no idea as I don | 10:42 |
dr_willis | cd should be one of the sources, you can remove it as a source and it should download the files. | 10:43 |
bkc_ | don't have a 5k-card to test it with :) | 10:43 |
borax12 | oh , thanks anyways ... i guess i will be looking around then | 10:43 |
borax12 | :) | 10:43 |
insomniac_lemon | cfhowlett, dr_willis, I don't remember ever adding the 12.04 CD to my repository list (I did click the "11.10 release available" button, but didn't agree). I did remove it using the synaptic package manager, and that fixed it. | 10:45 |
cfhowlett | insomniac_lemon: good work. | 10:46 |
auronandace | insomniac_lemon: 11.04 is eol this month (very shortly) | 10:46 |
dr_willis | insomniac_lemon: check your sources listing via the source manager tool, or look at /etc/apt/sources.list and see. # comment it out if ita there | 10:47 |
insomniac_lemon | auronandace, yes, I know. Why was 11.04 not LTS? Where there LTS version before that, or did those come recently? | 10:47 |
insomniac_lemon | dr_willis, I already fixed it. | 10:47 |
auronandace | insomniac_lemon: lts releases occur every 2 years | 10:48 |
cfhowlett | insomniac_lemon: current LTS is 12.04 | 10:48 |
pgdac | What's new in ubuntu 12.10? | 10:48 |
auronandace | !12.10 | pgdac | 10:49 |
ubottu | pgdac: Ubuntu 12.10 (Quantal Quetzal) is the current stable release of Ubuntu. Download http://releases.ubuntu.com/12.10/ - Release notes: http://ubuntu.com/getubuntu/releasenotes/12.10 - Support in #ubuntu | 10:49 |
themhz | its new :P | 10:49 |
KM0201 | pgdac: probably not much.. :) | 10:49 |
pgdac | auronandace: I know current release but tell me whats new in it . Please don't refer to ubottu if not necessary. Thanks! | 10:49 |
insomniac_lemon | cfhowlett, yeah, I know. Don't you mean most recent LTS? Is there a way to upgrade to 12.04 LTS straight from Natty without using the live CD? | 10:50 |
auronandace | pgdac: re-read what ubottu told you, there are release notes there | 10:50 |
FlyingElvis | i have a question...what will firefox and linux in genral do about flash now that is no longer supported? | 10:50 |
pgdac | auronandace: Ok . Going to read . Thanks! | 10:50 |
KM0201 | FlyingElvis: who knows... | 10:50 |
FlyingElvis | well arent people asking these questions? | 10:51 |
KM0201 | FlyingElvis: probably.. | 10:51 |
insomniac_lemon | FlyingElvis, use Chrome that has built in Flash manged somewhat by Google? | 10:51 |
KM0201 | we'll just have to wait and see | 10:51 |
cfhowlett | insomniac_lemon: 11.10 will upgrade to 12.04. Personally, I'd recommend you torrent the iso, md5sum that sucker, burn a usb/disk and clean install. | 10:51 |
auronandace | insomniac_lemon: no, you can only update from lts to lts or from one release to the next | 10:51 |
cfhowlett | FlyingElvis: hmtl5 is supported. | 10:51 |
KM0201 | for now, adobe still has downloads for Linux flash.. so... no need to worry about it yet. | 10:52 |
FlyingElvis | cfhowlett: yes, again but id say most the internet relies on flash still | 10:52 |
KM0201 | i'm guessing some sites will begin o gravitate towards html5 | 10:52 |
blazemore | Today I come in here asking for help rather than offering! I can't seem to get fglrx to work under k/ubuntu 12.10 - I just get grey screen on bootup. | 10:52 |
FlyingElvis | so it is still safe to use flash under firefox? | 10:53 |
insomniac_lemon | cfhowlett, I don't want to do a fresh install, I have set up how I like it too many times. I just want my computer to function how I like it for a while :P | 10:53 |
bkc_ | blazemore: latest catalyst-driver from AMD (12.9) and also might need to set nomodeset in the kernel-parameter | 10:53 |
KM0201 | FlyingElvis: i use it... i've not heard of any vulnerabilities. | 10:53 |
FlyingElvis | ok good to know ty KM0201 | 10:53 |
insomniac_lemon | cfhowlett, why do you think I'm still using Natty? | 10:53 |
KM0201 | blazemore: sorry, i hate ATI, i don't allow them on my linux machines... nvidia is just so much easier... | 10:53 |
cfhowlett | insomniac_lemon: if you have your /home in a separate partition, your data will be preserved. | 10:53 |
cfhowlett | insomniac_lemon: be aware the support for natty is on the horizon and plan accordingly. | 10:54 |
MonkeyDust | insomniac_lemon natty support ends next week | 10:54 |
auronandace | insomniac_lemon: gnome2 is no longer supported, you are going to have to move on some day | 10:54 |
auronandace | insomniac_lemon: if you must have gnome2 then 10.04 desktop support lasts till april 2013 | 10:55 |
insomniac_lemon | auronandace, I am aware, I have been trying to use a VM as a test to using 12.04 LTS using Cinnamon as my GUI instead of Unity. | 10:55 |
insomniac_lemon | auronandace, wait, was 10.04 LTS? Why wasn't 11.04 LTS? | 10:56 |
KM0201 | unity isn't that bad once you get back to it. | 10:56 |
nimo_ | dr_willis, most modern nvidia cards use nvidia_current driver.... so maybe none work | 10:56 |
KM0201 | insomniac_lemon: no, 11.04 was a normal release, 10.04 was lts | 10:56 |
crizis | insomniac_lemon, lts'es get released every 2 years | 10:56 |
crizis | 6.06 (was delayed 2 months), 8.04, 10.04, 12.04... | 10:56 |
dr_willis | nimo_: very possible that older cards get phased out of the cuttent nvidia drivers | 10:56 |
auronandace | insomniac_lemon: 10.04 is lts, i told you they get released every 2 years | 10:56 |
insomniac_lemon | Oh, ok | 10:56 |
crizis | next one will be 14.04 | 10:56 |
jubei | can somebody tell me how I can stop the graphical UI like we used to do service gdm stop" | 10:56 |
KM0201 | and the one after that 16.04 | 10:56 |
jubei | what's the equivalent of gdm for 12.10? | 10:57 |
dr_willis | for an old skoop type desktop - i perfer lubuntu ;) | 10:57 |
crizis | jubei, lightdm | 10:57 |
auronandace | jubei: lightdm | 10:57 |
nimo_ | dr_willis, but the driver wont be enabled... | 10:57 |
akis | any idea why skanlite cannot scan images in grey/color mode (i take a smudged image) but it can scan perfectly at lineart mode. SimpleScan nca alos perfectly scan b/w and color images. any advise? | 10:57 |
insomniac_lemon | KM0201, yeah, I get it | 10:57 |
KM0201 | and the one aftr that will be 18.04 | 10:57 |
jubei | crizis, auronandace: thank you | 10:57 |
nimo_ | dr_willis, its not that it doesnt work..... it wont be enabled | 10:57 |
mikeconcepts | I'm seeking advice for blank screen after grub on 12.10 with kernels 3.5, 3.4 works | 10:58 |
dr_willis | nimo_: could be some card that confuses jocky. you could check the forums and askubuntu.com about that exact card/chipset | 10:58 |
jubei | anybody know how to get AMD (ATI) proprietary driver on 12.10 ? | 10:58 |
Ghaladan | How do I delete a directory from the command line? | 10:58 |
buzzinh | rmdir | 10:59 |
KM0201 | Ghaladan: the directory and all its contents? | 10:59 |
jubei | Ghaladan: you google it | 10:59 |
Ghaladan | Yes, the directory and all of its contents | 10:59 |
KM0201 | is it rmdir? | 10:59 |
KM0201 | i thought it was rm -R /path/to/directory | 10:59 |
dr_willis | Ghaladan: rm or rmdir. | 10:59 |
Ghaladan | missing operand | 10:59 |
dr_willis | depending on the details. | 10:59 |
jubei | Ghaladan: rm -fr (careful it will wipe everything under that path) | 10:59 |
Ghaladan | bah | 10:59 |
SharkMuttleworth | Ghaladan: You can find that information out from the man pages, you shouldn't need to ask here | 11:00 |
mikeconcepts | tried nomodeset with acpi=off and acpi_osi=Linux | 11:00 |
dr_willis | now would be a VERY good time to spend 20 min reading some bash beginner guides | 11:00 |
dr_willis | !terminal | 11:00 |
ubottu | The linux terminal or command-line interface is very powerful. Open a terminal via Applications -> Accessories -> Terminal (Gnome), K-menu -> System -> Konsole (KDE), or Menu -> Accessories -> LXTerminal (LXDE). Guide: https://help.ubuntu.com/community/UsingTheTerminal | 11:00 |
dr_willis | that factoid could use come cleanup i think ;) | 11:01 |
insomniac_lemon | I'm surprised the update manager doesn't have more functionality with version changes. It would be nice if you could upgrade to a different version of Ubuntu without doing Upgrades in between. Or maybe even the ability to downgrade the same way. | 11:03 |
MonkeyDust | dr_willis not for me, i use fall back/classic :) | 11:03 |
dr_willis | MonkeyDust: untill it gets removed... | 11:04 |
dr_willis | ;P | 11:04 |
=== themhz is now known as themhz_away | ||
dr_willis | ive used so many guis over the years it dosent matter much to me | 11:04 |
SharkMuttleworth | insomniac_lemon: The developers need to make the regular upgrade work correctly first... running before you can walk and all that | 11:04 |
iceroot | insomniac_lemon: its to hard to test all the possible upgrade paths, so we only support the upgrade to the next version or from lts to next lts | 11:05 |
ednorog | free shels? | 11:05 |
Dragonster82 | Hey is anyone able to help me with my Nvidia GT540M issue here? | 11:06 |
=== ivan_ is now known as Guest66799 | ||
KM0201 | Dragonster82: what issue is that? | 11:06 |
SharkMuttleworth | Dragonster82: http://www.sabi.co.uk/Notes/linuxHelpAsk.html#asktoask | 11:07 |
KM0201 | SharkMuttleworth: hehe | 11:07 |
thepreacher | Ok so its not life threatening, but just noticed that the background of my transparent conky window on ubuntu 12.10 randomly changes to white and then back to transparent again after some time. Any ideas what could be the culprit? | 11:08 |
the_dark_knight | hi, How do I get when my cronjob is complete? when I update MAILTO variable from crontab , I don't want the output. I just want it to mail the status, like success, failed. How do I do that? | 11:10 |
Dragonster82 | KM021: I am unable to install it properly, and I'm now stuck with only my intel graphics | 11:10 |
the_dark_knight | I want the cron to mail me the status of my jobs when complete, how do I do that? | 11:11 |
oepra | hello, i've just upgraded to kubuntu 12.10, and i'm now getting a black screen when i start vmware | 11:11 |
SharkMuttleworth | oepra: I suggest rolling back to a previous snapshot | 11:12 |
oepra | SharkMuttleworth: how? | 11:12 |
SharkMuttleworth | oepra: Do you not take snapshots in VMWare before you upgrade things...? | 11:13 |
yu | hello | 11:13 |
paolooo | hi @all, how do move my pidgin icon at the notification bar? | 11:13 |
Dragonster82 | Anybody? I've tried to install the nvidia graphic driver but to no avail, I'm now still stuck with my intel graphics | 11:13 |
oepra | SharkMuttleworth: snapshots of the virtual system? no | 11:13 |
yu | nice to meet everyone | 11:13 |
paolooo | hi @all, how do I move my pidgin icon at the notification bar? | 11:13 |
bkc_ | !ask | paolooo | 11:16 |
ubottu | paolooo: Please don't ask to ask a question, simply ask the question (all on ONE line and in the channel, so that others can read and follow it easily). If anyone knows the answer they will most likely reply. :-) See also !patience | 11:16 |
bkc_ | !patience | paolooo | 11:16 |
ubottu | paolooo: Don't feel ignored and repeat your question quickly; if nobody knows your answer, nobody will answer you. While you wait, try searching https://help.ubuntu.com or http://ubuntuforums.org or http://askubuntu.com/ | 11:16 |
yu | here can use chinesemy English is poor. | 11:16 |
yu | ? | 11:16 |
dr_willis | paolooo: move it where? | 11:16 |
paolooo | dr_willis: notificatio bar | 11:16 |
paolooo | dr_willis: notification bar | 11:17 |
insomniac_lemon | Does anyone know why the Drawer applet seems to have been wiped off the face of the planet? Last I saw it was in Gnome 2 in Natty, but it doesn't work for me. (upon reset or logging out and back in, it won't open anymore) | 11:21 |
SharkMuttleworth | insomniac_lemon: I thought applets only worked in GNOME 2? | 11:23 |
ex0a | how can i control what card does what when i run a dual gpu surroundview setup? | 11:24 |
insomniac_lemon | SharkMuttleworth, me too, but apparently in GNOME 3 they are there, but the panel menu now comes up with Alt+right click, not just right click | 11:24 |
dr_willis | ex0a: 2 cards with 2 x sessions? or a dualcard sli setup? or what exactly | 11:25 |
belgianguy | are there any recommendations on blogs that contain Ubuntu news? | 11:27 |
et` | Hi. I installed ubuntu over usb (usb stick created using the linuxlive usb creator). However, when ubuntu said it was done and i needed to restart to finish, it booted into windows, with no boot manager selection. did i miss something during the partitioning? can i fix this easily now? | 11:27 |
belgianguy | my regular tech sites dissapoint me lately | 11:27 |
crizis | belgianguy, http://www.omgubuntu.co.uk/ | 11:27 |
belgianguy | thx crizis! | 11:28 |
dr_willis | et`: tell the pc to boot from the usb via bios or some key at power on | 11:28 |
ex0a | dr_willis: well my goal is to eventually do a gpu passthrough for xen so that i can boot another OS on the pci-e card, while keeping ubuntu as the main os on my igpu | 11:28 |
insomniac_lemon | et`, you probably installed in on another drive? If so you need to boot into that (and possibly move it up in the boot order) | 11:28 |
crizis | belgianguy, http://www.webupd8.org/ | 11:28 |
MonkeyDust | belgianguy lxer.com | 11:28 |
ex0a | but as of right now, it's just a dual x session surround view but it pops up the DE on the secondary card and wont let me start another x session on the main one - i have to drop runlevel to use it | 11:29 |
belgianguy | thanks all, those all look neat | 11:29 |
belgianguy | I'm so happy with the Grooveshark integration btw | 11:30 |
et` | insomniac_lemon: there is only a single drive in that laptop, and in windows i see the partitions, the install created, so no | 11:31 |
et` | dr_willis: i already booted from usb & installed, but when i remove the usb key and reboot, i don't see a boot manager | 11:32 |
=== Dreadtower is now known as Breadflour | ||
insomniac_lemon | et`, I'm surprised you were able to install it on another partition without screwing up your windows MBR.... but yeah, I don't think the windows bootloader will see another OS unless it's on the same partition. | 11:33 |
insomniac_lemon | et`, or is it on the same partition as windows? | 11:33 |
=== Breadflour is now known as Dreadtower | ||
et` | insomniac_lemon: i expected the mbr to be screwed up (i expected to see grub, so i can boot linux or chainload windows, as in the dozens of other dual-boot machines i have done) | 11:35 |
insomniac_lemon | et`, but it didn't? That's odd. | 11:35 |
=== CrazyGir is now known as Guest12185 | ||
varikonniemi | how can i report a bug when the bug is that a package is missing? ubuntu-bug requires the package to be available | 11:37 |
IdleOne | !bugs | 11:38 |
ubottu | If you find a bug in Ubuntu or any of its derivatives, please file a bug using the command « ubuntu-bug <package> » - See https://help.ubuntu.com/community/ReportingBugs for other ways to report bugs. | 11:38 |
IdleOne | hmm | 11:38 |
IdleOne | you can report it at launchpad.net | 11:38 |
alexfpms | good morning (ugt), i have nvidia graphic card, in my Xorg.log there are a tons of (WW) warnings. Why and how can i correct this? http://pastebin.com/iHJnxbk6 | 11:42 |
samurai2 | hi there | 11:42 |
samurai2 | how to make output from a program can go into a folder in remote ubuntu machine? thanks | 11:43 |
dr_willis | samurai2: ssh can most likely be used that way. | 11:43 |
dr_willis | samurai2: sshfs would make remote box appear as a local folder | 11:44 |
WeThePeople | alexfpms, what is your font set to? | 11:44 |
alexfpms | WeThePeople, which one ? | 11:45 |
WeThePeople | alexfpms, system | 11:45 |
alexfpms | WeThePeople, default ubuntu | 11:45 |
samurai2 | dr_willis : I know that scp can be used to copy the file into remote folder, but how about if I run a program and has some output like : program_A --out root@remote:/folder. How do I do this? thanks :) | 11:46 |
alexfpms | WeThePeople, i installed 12.10 2 days ago | 11:46 |
alexfpms | WeThePeople, i have not yet personalized it yet | 11:46 |
alexfpms | WeThePeople, i have not personalized it yet | 11:47 |
dr_willis | samurai2: sshfs can mount a remote box to a local directhry, then 'command > sshfsdirectory/thefile' would put the info on the remote | 11:47 |
=== franz is now known as Guest54117 | ||
dr_willis | samurai2: or pipe the output to a ssh session thats just reading the data. | 11:47 |
samurai2 | dr_willis : I don't find any sshfs command in my ubuntu | 11:48 |
dr_willis | !info sshfs | 11:48 |
ubottu | sshfs (source: sshfs-fuse): filesystem client based on SSH File Transfer Protocol. In component main, is optional. Version 2.4-1ubuntu1 (quantal), package size 46 kB, installed size 132 kB | 11:48 |
osmosis | Good evening | 11:48 |
dr_willis | samurai2: its in the repos...... | 11:49 |
=== osmosis is now known as Guest62677 | ||
Guest62677 | somebosy here have had issues trying to commit a php file with subversion???? | 11:49 |
samurai2 | bash: !info: event not found | 11:49 |
WeThePeople | alexfpms, it might have to do with fglrx | 11:49 |
Guest62677 | I dont know if there's something else that I have to install | 11:49 |
alexfpms | WeThePeople, i have nvidia | 11:49 |
WeThePeople | alexfpms, does the distro boot into 12.10? | 11:51 |
WeThePeople | machine | 11:51 |
dr_willis | samurai2: install the sshfs package | 11:51 |
alexfpms | WeThePeople, off course since it the only one, fresh install | 11:52 |
fairuz | iirc, to use sshfs, the remote machine need openssh-server installed. | 11:54 |
Dragonster82 | Does anyone have any experience with the Ironhide power management not configured problem? | 11:55 |
hexramm | Hey guys | 11:56 |
Dragonster82 | Does anyone have any experience with the Ironhide power management not configured problem? | 11:56 |
alexfpms | WeThePeople, but my main problem is X which refreshes like 15fps | 11:56 |
the_dark_knight | hi guys, how do I check the last email, when it shows "you have new emil" on terminal? | 11:57 |
hexramm | anyone got any advise not all the buttons on my laptop are working. The one i am trying to get working is the one that stops ability to use the touch pad | 11:57 |
=== Dreadtower is now known as Breadflour | ||
KaKila | "sudo shutdown -P now" (or any other shutdown command) not shutting down but rebooting system fron local login. SSH login does shuts down. Ayn ideas why? | 11:58 |
Dragonster82 | Does anyone have any experience with the Ironhide power management not configured problem? | 11:58 |
MaxMuts | hey | 11:58 |
ravn | anyone know why the octave package is so old to ubuntu? | 11:58 |
MaxMuts | hey | 11:58 |
MaxMuts | sombody here | 11:59 |
Kartagis | no | 11:59 |
SharkMuttleworth | ravn: Ubuntu isn't a rolling release distribution, it doesn't update the software in a particular version of Ubuntu | 11:59 |
Kartagis | we are all gone | 11:59 |
MaxMuts | oke | 11:59 |
MaxMuts | i see | 11:59 |
MaxMuts | helo gone peaple | 11:59 |
Kartagis | MaxMuts: just ask your real question | 12:00 |
ravn | SharkMuttleworth: yes sure, but it is VERY old... | 12:00 |
MaxMuts | dont have | 12:00 |
MaxMuts | just wanted to talk | 12:00 |
^Lem^ | i think Ubuntu 12.10 should have been called Quirky Quetzal.. open gnome-terminal, resize the window, click somewhere else, all good. open a new tab in the gnome terminal, resize window, click elsewhere, watch window revert to previous size. bug report time | 12:00 |
fairuz | ravn: Maybe people stop maintaining it. | 12:00 |
SharkMuttleworth | ravn: Ubuntu won't have had anything to do with it most likely, it will have been packaged by Debian developers... So perhaps the maintainer of octave has gone awol | 12:00 |
blazemore | I'm using Kubuntu 12.10 at the moment but this problem is not specific to KDE. After installing the AMD driver from any source (upstream or the Ubuntu tool), rebooting causes just a black screen. I know the system is booting up fine because I hear the startup sound so I know KDE is working. Adding "nomodeset" to the kernel line in Grub dumps me to a login console, and I can't run startx because "no screens detected". Can someone explain a) How can I get t | 12:02 |
hexramm | anyone got any advise not all the buttons on my laptop are working. The one i am trying to get working is the one that stops ability to use the touch pad | 12:02 |
the_dark_knight | hi, how do I run my cronjobs even when the computer is turned off? | 12:02 |
=== Purian23|Afk is now known as Purian23|Work | ||
blazemore | the_dark_knight: I can't even... | 12:03 |
painlezz | hey guys. does anybody know how to fix this error, when trying to apt-get update or upgrade? apt-get upgrade Reading package lists... Error! E: Encountered a section with no Package: header E: Problem with MergeList /var/lib/apt/lists/archive.canonical.com_ubuntu_dists_precise_partner_binary-amd64_Packages E: The package lists or status file could not be parsed or opened. | 12:03 |
Oli | the_dark_knight: you can't. | 12:03 |
blazemore | the_dark_knight: You need to invent a computer which runs without electricity | 12:03 |
the_dark_knight | blazemore: Oli So will it be failed | 12:03 |
Oli | the_dark_knight: ? | 12:04 |
blazemore | the_dark_knight: What are you expecting will happen? Lets say your computer is off and completely unplugged. How do you expect it to run a cronjob? | 12:04 |
alexfpms | WeThePeople, but my main problem is X which refreshes like 15fps | 12:04 |
=== root is now known as Guest34500 | ||
the_dark_knight | blazemore: I was thinking if it can do the job when it is turned on next time | 12:05 |
=== ivan_ is now known as Guest69022 | ||
blazemore | the_dark_knight: Ah OK that's a more sensible question :-) | 12:05 |
blazemore | the_dark_knight: There's a tool called CronWhip which might be what you want. This information is specific to Arch, but here you go http://xyne.archlinux.ca/projects/cronwhip/ | 12:07 |
=== betinho is now known as kenlik | ||
Guest34500 | software for read and edit .doc files? | 12:07 |
=== Eric is now known as Guest15645 | ||
iceroot | Guest34500: libreoffice | 12:07 |
blazemore | LibreOffice Writer is included with Ubuntu, Guest34500 | 12:07 |
fiba | Раша есть ? | 12:08 |
IdleOne | !ru | fiba | 12:08 |
ubottu | fiba: Пожалуйста наберите /join #ubuntu-ru для получения помощи на русском языке. | Pozhalujsta naberite /join #ubuntu-ru dlya polucheniya pomoshi na russkom yazyke. | 12:08 |
MaxMuts | hey | 12:08 |
MaxMuts | hey | 12:08 |
fiba | join #ubuntu-ru | 12:08 |
MaxMuts | sombody sees this | 12:08 |
dr_willis | hmm | 12:09 |
WACOMalt | I just added a user, via useradd username sudo then passwd username | 12:12 |
WACOMalt | but the user when in terminal only has $ and no commands will run | 12:12 |
WACOMalt | http://www.blindmanstudio.com/dropbox/2012-10-22_0512.png this is the result in temrinal of this new user. please help. http://www.blindmanstudio.com/dropbox/2012-10-22_0512.png | 12:12 |
Oli | the_dark_knight: If you need to run something, for example, 356 time a year, you need a better task management system. Something like Celery would do it but you'll need to do some programming to get where you want. | 12:13 |
WeThePeople | does linux support ram disk? | 12:14 |
PatrickDickey | Has anyone ran into this? I upgraded to 12.10 through the Upgrade Manager. Nothing seemed to be wrong, but when I rebooted I don't have the top panel or side panel, and all of my windows don't have the top bar. | 12:14 |
NLNM | WACOMalt: a new user will have nothing in their home directory | 12:14 |
Oli | WeThePeople: /dev/shm is a ram disk, and you can create new tmpfs mounts if you want more. | 12:14 |
MonkeyDust | WeThePeople http://www.ubuntuka.com/ubuntu-ramdisk-ramdrive-easy-way/ | 12:14 |
WACOMalt | NLNM, its not that its empty, its a completely different shell and you notice it doesnt show my path in the prompt | 12:15 |
NLNM | ahh | 12:15 |
WACOMalt | NLNM, here is a comparison. normal sudo user, which works, on the right, new user on the left http://www.blindmanstudio.com/dropbox/2012-10-22_0513.png | 12:15 |
WACOMalt | oh here we go | 12:16 |
=== florin is now known as Guest37971 | ||
WACOMalt | I typed "bash" | 12:16 |
WACOMalt | any way to make bash the default rather than sh? | 12:17 |
PatrickDickey | WACOMMalt, bash is sh (well more or less) | 12:18 |
fairuz | /bin/sh is normally is a symbolic link to another shell e.g bash, or dash | 12:20 |
=== Breadflour is now known as Dreadtower | ||
PatrickDickey | fairuz, if he types ls -l /bin/sh will it show him what the link points to (bash or dash)? | 12:21 |
fairuz | Yes | 12:21 |
michealPW | Using Ubuntu 12.04, I cannot get supertux-editor to run properly. I download the latest binary package from their SVN (r5932) and run it with mono but I don't have any icons/labels on the buttons. Here's a screenshot: http://i46.tinypic.com/qn5wrt.png | 12:21 |
fairuz | On Ubuntu, it's pointed to bash. While on Android, for example, it's pointed to mksh | 12:21 |
PatrickDickey | WACOMalt, you can try that (type ls -l /bin/sh) and it will tell you whether you're using bash or another shell. | 12:22 |
fairuz | Or you can just do echo $SHELL | 12:22 |
* PatrickDickey tried using some other shells tcsh for a class. I liked bash better. | 12:22 | |
itai_michaelson | hi , can osx read ext4 ? | 12:24 |
WACOMalt | itai_michaelson, I think so itai_michaelson, but not entirely sure | 12:26 |
dr_willis | sh is the default system shell, bash is the default user shell, normally | 12:26 |
itai_michaelson | ok thanks | 12:26 |
Meris | itai_michaelson, not by default, ext2 and ext3 are readable with some GPL'ed addition. | 12:26 |
dr_willis | bash has a 'sh' mode | 12:26 |
PatrickDickey | itai_michaelson a quick Google search shows that it may be able to read it, but it can't write to it. | 12:27 |
michealPW | When I try to checkout the latest supertux source from SVN I get the following error ("Password for '(null)' GNOME keyring:") anyone know what it is? It says in the manual that "everybody is granted anonymous read-only access" :\ | 12:27 |
michealPW | It seems to want me to enter a password, which I don't have hehe | 12:27 |
PatrickDickey | michaelPW try your login password. gnome-keyring is on your computer -- not the SVN. | 12:28 |
michealPW | Oh | 12:28 |
michealPW | hehe thx Patrick :) | 12:28 |
PatrickDickey | No worries, and sorry for misspelling your name there. It's late in the morning for me (I'm a night shift worker). | 12:29 |
michealPW | Hrmm, it kind of worked. I got passed that authentication but then I get a 500 internal server error, something about the "OPTIONS" :\ | 12:29 |
michealPW | "svn: Server sent unexpected return value (500 Internal Server Error) in response to OPTIONS request for 'http://supertux.lethargik.org/svn/supertux/trunk/supertux'" | 12:30 |
PatrickDickey | michealPW do they have instructions on their site for how to checkout the files (and use SVN)? | 12:30 |
michealPW | Yea, that's what it told me to do (rofl) | 12:30 |
dr_willis | sounds aaalmost like an issue on their end. | 12:31 |
PatrickDickey | That's what I was thinking too. | 12:31 |
michealPW | I can get the PPA from Launchpad but that's the one I already have that doesn't work :( | 12:31 |
michealPW | Maybe I can get the source from launchpad and try to build it here, iunno maybe that will fix it? | 12:32 |
Farbro | how can i tell if my home directory is encrypted? can't remember if i activated it on installation... :) | 12:32 |
CestSebastian | hey guys, i'm using gnome panel, which looks like gnome 2 in ubuntu 12.10, after installation firefox kipped asking if i want to install certain website's as app, and accidentally installed a website. Now i can't remove it and there's the "website app" in the messages notification | 12:32 |
PatrickDickey | Do they have the source as a tarball (aside from the SVN version) on their site? | 12:32 |
itai_michaelson | hi, i just formated an extrernal harddrive to ntfs and now ubuntu wont let me write to it | 12:32 |
michealPW | No just instructions to pull from their svn. Then in the Ubuntu catagory they say there's an PPA on Launchpad with it but this is at the very top of that launchpad page: "NOTE: DUE TO MY RECENT SWITCH TO DEBIAN, THIS REPOSITORY IS NO LONGER MAINTAINED. NO NEW BUILDS WILL BE UPLOADED." | 12:33 |
michealPW | LOL bad news bears? :\ | 12:33 |
dr_willis | itai_michaelson: mount it with the right options, or use ntfs-config to enable write support | 12:33 |
PatrickDickey | itai_michaelson, do you have a Windows computer also? | 12:33 |
dr_willis | !ntfs | 12:34 |
ubottu | To view your Windows/Mac partitions see https://help.ubuntu.com/community/AutomaticallyMountPartitions - For write access, see !NTFS-3g or !FUSE | 12:34 |
PatrickDickey | michealPW, you could check the debian repositories for the latest version then. | 12:34 |
philip_ | hello, I need help with evolution calendar, it deleted my old events in my google calendar, but they are still there in evolution, is there a way to get them back to my google calendar? | 12:34 |
* PatrickDickey doesn't have an answer to that, but now I'm scared to open Evolution. LOL Sorry. | 12:35 | |
michealPW | Oh wait, this svn trunk is newer than the one I got, wth? This one's r6652 for Maverick, the one I have is r5932.. Maybe that's why mine's so broken? | 12:35 |
L3top | michealPW: sudo apt-get install svn; svn co http://path.to.svn/path/to/src | 12:35 |
michealPW | I didn't realize mine was old :( | 12:35 |
michealPW | Thx L3top let me try that mate! :) | 12:35 |
philip_ | there must be a way to get them back as they still are in evolution | 12:35 |
L3top | sorry | 12:36 |
L3top | michealPW: sudo apt-get install subversion | 12:36 |
michealPW | L3top: That got me passed that weird GNOME keyring thing, but I still get a 500 internal error :( | 12:38 |
paolooo | hi @all, I'm using the latest ubuntu... I want to have a theme like this one --> http://www.wikihow.com/images/9/91/1-32.png What should I do? | 12:38 |
L3top | what is the link | 12:38 |
L3top | michealPW: ^ | 12:38 |
arikbku | hi | 12:38 |
arikbku | is somebody there | 12:39 |
arikbku | please\ | 12:39 |
arikbku | i need help | 12:39 |
michealPW | http://supertux.lethargik.org/svn/supertux/trunk/supertux | 12:39 |
MonkeyDust | arikbku it works, you're in | 12:39 |
tyler_d | !ask | arikbku | 12:39 |
ubottu | arikbku: Please don't ask to ask a question, simply ask the question (all on ONE line and in the channel, so that others can read and follow it easily). If anyone knows the answer they will most likely reply. :-) See also !patience | 12:39 |
dr_willis | then state the question.... | 12:39 |
michealPW | Sorry L3top, http://supertux.lethargik.org/svn/supertux/trunk/supertux | 12:39 |
dr_willis | paolooo: thats just seems to be some dark theme, and a ugly wallpaper. on a classic gnome desktop from what i can tell | 12:40 |
michealPW | Oh I didn't notice there was a #supertux | 12:41 |
paolooo | dr_willis: I see it is the classic gnome theme | 12:41 |
michealPW | Maybe somebody knows where I can get the latest snapshot in there hehe! | 12:41 |
dr_willis | paolooo: classic gnome is not a 'theme' its a seperate x session you enable | 12:41 |
dr_willis | !classic | 12:42 |
ubottu | The default interface in Ubuntu 11.04 is !Unity. To switch back to regular !GNOME: log out, click your username, click the Session box at the bottom of the screen, and select "Ubuntu Classic". For 11.10, see !notunity | 12:42 |
L3top | michealPW: "The Subversion (SVN) repository is no longer in use. For the most recent code under development see the Git repository instead." http://supertux.lethargik.org/wiki/Download/Subversion | 12:42 |
=== dark3n|off is now known as dark3n | ||
dr_willis | !nounity | paolooo | 12:42 |
MonkeyDust | paolooo i use it and am happy with it | 12:42 |
ubottu | paolooo: Ubuntu 11.10 and higher use GNOME 3 with the !unity shell by default. To use GNOME Shell instead, install the "gnome-shell" package and investigate "gnome-tweak-tool". For GNOME Fallback mode, which is similar to GNOME 2, install "gnome-panel". Both packages will place entries in the Sessions dropdown. Using Natty? See !classic | 12:42 |
arikbku | does anyone sepak english | 12:43 |
arikbku | 192.168.1.1 | 12:43 |
Bashking_ | i speak it | 12:43 |
dr_willis | arikbku: most of us do. | 12:43 |
cloudgeek | hey i am looking for some freelancers/interns for app development , which IRC best suits for me , suggest any website my friends | 12:43 |
paolooo | dr_willis: ah I see. Thanks. | 12:43 |
PatrickDickey | arikbku yes, I do. And I write it also. what's with the local IP Address ? | 12:43 |
Bashking_ | check out fivver.com | 12:43 |
L3top | arikbku: Can you just ask a question? State the details of your problem instead of spamming the channel? | 12:43 |
paolooo | dr_willis: are you using classic gnome session too? | 12:43 |
MonkeyDust | paolooo I am | 12:44 |
dr_willis | paolooo: nope. i use unity | 12:44 |
* PatrickDickey is using xubuntu desktop because unity doesn't want to play nice today. | 12:44 | |
Hodapp | I have a VM on my office machine that is on Ubuntu 10.04 LTS; I left it upgrading to 12.04 over the weekend, and then seemingly the entire office lost power, so now an entire pile of packages is broken and I keep getting "Could not apply changes! Fix broken packages first." | 12:44 |
L3top | MonkeyDust: : have you checked out Ubuntu Gnome Remix? They are applying to be an official flavor. | 12:44 |
paolooo | @MonkeyDust: That's nice... | 12:45 |
Hodapp | I see the broken packages in Synaptic and I have no idea what I'm supposed to do to "fix" anything | 12:45 |
MonkeyDust | L3top i have read about it, but it's gnome-shell, IIRC | 12:45 |
michealPW | L3top: Ah, thx mate. So I should be using git, then? :( | 12:45 |
paolooo | @ dr_willis: ah I see | 12:45 |
PatrickDickey | Hodapp, you can try using sudo dpkg --configure -a in a terminal. | 12:45 |
michealPW | Ah, I see it now. | 12:46 |
paolooo | MonkeyDust: are you using 12.04 ubuntu? | 12:46 |
michealPW | LOL thx L3top! | 12:46 |
MonkeyDust | paolooo no, 12.10 | 12:46 |
L3top | yes michealPW... https://code.google.com/p/supertux/source/browse/ | 12:46 |
Hodapp | PatrickDickey: As far as I can tell, that did absolutely nothing. | 12:46 |
MonkeyDust | paolooo but i used classic in 12.04 too | 12:46 |
PatrickDickey | Hodapp, did it just go to a prompt again? | 12:46 |
michealPW | L3top: I think that's the old r5932 I have that doesn't work. The one from 2010 for Maverick is r66xx | 12:47 |
michealPW | :\ | 12:47 |
flexm | Is thre any way to install rootstock | 12:47 |
paolooo | MonkeyDust: I see, that's cool. so you have two computers? | 12:47 |
michealPW | Maybe git, though | 12:47 |
MonkeyDust | paolooo what is it you want to do or know? | 12:47 |
Hodapp | Yes, and returning to Synaptic indicates still a bunch of broken packages. | 12:47 |
josh123 | !op | 12:47 |
michealPW | Let me see if I can clone this git repository | 12:47 |
ubottu | Help! Channel emergency! (ONLY use this trigger in emergencies) - elky, Madpilot, tritium, Nalioth, tonyyarusso, PriceChild, Amaranth, jrib, Myrtti, mneptok, Pici, jpds, gnomefreak, bazhang, jussi, Flannel, ikonia, maco, h00k, IdleOne, bkerensa, nhandler or Jordan_U! | 12:47 |
michealPW | It has to have the latest one | 12:47 |
dr_willis | flexm: ppa, or source, if its not inn the repos | 12:47 |
flexm | :) | 12:48 |
michealPW | Oh that IS the git, just a web interface | 12:48 |
michealPW | I see, I see! :) | 12:48 |
flexm | dr_willis, what ppa | 12:48 |
dr_willis | !ppa | flexm | 12:48 |
ubottu | flexm: A Personal Package Archive (PPA) can provide alternate software not normally available in the offical Ubuntu repositories - Looking for a PPA? See https://launchpad.net/ubuntu/+ppas - WARNING: PPAs are unsupported third-party packages, and you use them at your own risk. See also !addppa and !ppa-purge | 12:48 |
Hodapp | Were this a single package, I don't expect that fixing it would be a problem, but when Ubuntu is in the midst of an upgrade, I really have no idea what "fix" even involves. | 12:48 |
michealPW | Yay, it's downloading! Thanks a lot, L3top :) | 12:48 |
L3top | michealPW: Last update: February 26, 2010 https://code.google.com/p/supertux/source/browse/README yeah... that IS the git... click the checkout link... | 12:48 |
paolooo | MonkeyDust: I want to know, which is better? classic gnome or the current ubuntu theme (the one with the launcher at the left sidebar) | 12:48 |
michealPW | Ah god so I did have the latest? :( | 12:48 |
L3top | !poll | paolooo | 12:49 |
ubottu | paolooo: Usually, there is no single "best" application to perform a given task. It's up to you to choose, depending on your preferences, features you require, and other factors. Do NOT take polls in the channel. If you insist on getting people's opinions, ask BestBot in #ubuntu-bots. | 12:49 |
michealPW | Damnit. So nobody has even worked on it since 2010? LOL it's my 3 year old's favorite game :( | 12:49 |
dr_willis | paolooo: those are not 'themes' | 12:49 |
MonkeyDust | paolooo depends on what you like more, i dont like unity, so i don't use it | 12:49 |
flexm | ubottu: !ppa-purge | 12:49 |
ubottu | To disable a PPA from your sources and revert your packages back to default Ubuntu packages, install ppa-purge and use the command: « sudo ppa-purge ppa:<repository-name>/<subdirectory> » – For more information, see http://www.webupd8.org/2009/12/remove-ppa-repositories-via-command.html | 12:49 |
Hodapp | If I right-click the item and mark for removal, that entails the removal of so many dependencies that I have no idea whether the item should be there or not. | 12:49 |
dr_willis | paolooo: they are different desktop/sessions. try them both. use what you like | 12:49 |
MIHAMAD | who are u | 12:50 |
paolooo | dr_willis: MonkeyDust: I see . How do I do that? | 12:50 |
drag0nius | whats some bandwidth monitor app/port specific? | 12:50 |
* PatrickDickey <---- | 12:50 | |
Hodapp | So I'm rather open to suggestions of how to repair this, even if it ends up as "Scrap the VM and download a new ISO". | 12:50 |
flexm | <----------------------------------------------- | 12:50 |
dr_willis | paolooo: install them. select the one to try at the login screen. like the factoids said | 12:50 |
PatrickDickey | You're doing it in a VM, Hodapp? | 12:50 |
MonkeyDust | paolooo install classic, logout, select classic, login | 12:50 |
Hodapp | PatrickDickey: Yes. Had I known the power were going to go out, I'd gladly have snapshotted it. | 12:51 |
dr_willis | paolooo: thers other desktops also like kde, lxde, xfce, | 12:51 |
L3top | Hodapp: what is the broken package? | 12:51 |
dr_willis | paolooo: you could get the different live cd's and try them all. see what you like first, then install the ones you want into your system | 12:52 |
PatrickDickey | paolooo which desktop is better is a matter of opinion. Normally I like Unity, but I also use XFCE on occasion (like right now). | 12:52 |
Hodapp | L3top: libc-dev-bin, libc6-dbg, libc6-dev, libnih1, python-louis. The broken filter also lists libc6 and ubuntu-minimal, but I can't tell if they're broken or not. | 12:52 |
=== laura is now known as Guest15929 | ||
dr_willis | paolooo: you can have several, or all of them. installed at the same time. ;) | 12:53 |
PatrickDickey | dr_willis, did they finally get it to where you can install Gnome 3 next to Unity? | 12:53 |
IdleOne | !notunity | 12:54 |
ubottu | Ubuntu 11.10 and higher use GNOME 3 with the !unity shell by default. To use GNOME Shell instead, install the "gnome-shell" package and investigate "gnome-tweak-tool". For GNOME Fallback mode, which is similar to GNOME 2, install "gnome-panel". Both packages will place entries in the Sessions dropdown. Using Natty? See !classic | 12:54 |
dr_willis | PatrickDickey: been doable for the last 2-3 releasea | 12:54 |
PatrickDickey | I thought so, but I wasn't sure. The last time I checked it was slated for the future. | 12:54 |
Hodapp | alright, guess I'll just start downloading a new ISO. | 12:55 |
=== Dreadtower is now known as Breadflour | ||
qubit | is there a standardized way of adding multiple IPs to an interface *without creating an interface alias*? | 12:57 |
qubit | all the docs i'm finding are for creating interface aliases | 12:57 |
Oli | qubit: to what end? What is the disadvantage of aliasing? | 12:57 |
PatrickDickey | Hodapp, when you run the iso in the VM, you *should* get an option to upgrade 12.04 to 12.04 (or 12.04 to 12.10 depending on which iso you use). That would be the option I would recommend. | 12:57 |
qubit | Oli: disadvantage, you can only have 254 of them | 12:57 |
qubit | plus you have to pick the alias number before hand | 12:58 |
=== Breadflour is now known as Dreadtower | ||
Bashking_ | hpla say[]\ | 12:58 |
PatrickDickey | qubit, how many IP's do you want to tie to one interface? | 12:58 |
qubit | PatrickDickey: could be upwards of several hundred (~500) | 12:59 |
dr_willis | 0_o | 12:59 |
Bashking_ | THAT o FACE NEEDS AN EYE PATCH | 12:59 |
* PatrickDickey judging by dr_willis reply, I'm not the only one confused by that. | 12:59 | |
Oli | qubit: Can an interface belong to more than one subnet? (completely unsure - but that would explain the limit of 254) | 13:00 |
qubit | so I'm guessing no, there is no standard way and I'll have to just hook into if-up | 13:00 |
dr_willis | alias an alias to an aliss. ;) | 13:00 |
rockworldmi | hi all. | 13:00 |
rockworldmi | wer can i find firewall option in unity? | 13:00 |
qubit | Oli: technically it can, but that's not the issue. it's a kernel limitation. the kernel only lets you have 254 interface aliases | 13:01 |
rockworldmi | or do i nneed to install third party one myself... | 13:01 |
Hodapp | PatrickDickey: I was considering just doing a fresh install. | 13:01 |
PatrickDickey | Hodapp, that works also. You'll lose whatever data is in the VM, unless you back it up first though. | 13:01 |
Hodapp | PatrickDickey: I'm well aware. | 13:01 |
PatrickDickey | rockworldmi you can install gufw and it will help you to configure the firewall. | 13:02 |
Hodapp | not much is on here but locally-compiled versions of god-knows-what and some SVN garbage. | 13:02 |
rockworldmi | PatrickDickey: thanks ...:) | 13:02 |
michealPW | rockworldmi: Your "firewall" is already built-in to your kernel, it's called Netfilter. What you're looking for is more likely a graphical interface to Netfilter. There's a lot out there you can try, search the Ubuntu Software Center. | 13:02 |
michealPW | gufw I think is what I use, let me check the about hehe | 13:02 |
* PatrickDickey can't remember the name of the other firewall option. Firebug or something like that. | 13:02 | |
yellabs-r2 | hello all | 13:02 |
rockworldmi | michaelni: ohh kk | 13:03 |
michealPW | Yea, I use gufw ;) | 13:03 |
michealPW | Firestarter, PatrickDickey ? :) | 13:03 |
rockworldmi | thanks i will install gufw | 13:03 |
yellabs-r2 | i have 12.04 recent upgrades, but now software centre keeps crashing, any tip is welcome to overcome this problem .. | 13:03 |
rockworldmi | :D | 13:03 |
PatrickDickey | If I remember right, gufw is what the Ubuntu Manual project talks about. | 13:03 |
PatrickDickey | That's right michealPW. | 13:03 |
Hodapp | Are most of these ultimately just tools to interface with iptables? | 13:03 |
michealPW | The command-line ufw really isn't bad, either, it's really intuitive. | 13:03 |
confrey | hi everybody | 13:03 |
L3top | Yes Hodapp. | 13:03 |
michealPW | Hodapp: Yep. IPTables is part of the Netfilter, all of these are just graphical frontends for Netfilter :P | 13:03 |
rockworldmi | hope they will install it by default in next version :D | 13:04 |
dlynes_laptop | If I add comments to an expired ticket, does it reopen the ticket? | 13:04 |
michealPW | Patrick: As far as I know, Canonical made ufw and probably made Gufw too :P | 13:04 |
PatrickDickey | dlynes_laptop it depends on the system, but yes most of them will reopen the ticket. | 13:04 |
confrey | why is still present this annoying thing, in Unity, I save some settings about desktop (I think related to compiz) but to restore them at reboot I have to launc 'unity' ? | 13:05 |
michealPW | I'm not sure about Gufw, though. I'm pretty sure Canonical made ufw, though hehe | 13:05 |
Hodapp | I should take a look at ufw. I've never bothered to learn iptables properly, and every time I try to find/ask how to do something in iptables, I end up getting 9 different answers that are all wrong. | 13:05 |
dlynes_laptop | PatrickDickey, sorry...I'm talking about bugs.launchpad.net, specifically | 13:05 |
SharkMuttleworth | Hodapp: But if you learn IPTables, it will apply across any Linux. Whereas only Ubuntu really uses UFW | 13:05 |
SharkMuttleworth | I don't see the point of UFW | 13:05 |
PatrickDickey | Ahh. I'm not sure if it reopens the ticket, but I think that it will send an email to the others in it. | 13:05 |
michealPW | It's not as complicated as it seems. I had a really good guide to Netfilter, hrmm | 13:06 |
michealPW | Here's one, I bookmarked a couple hehe | 13:07 |
michealPW | Hodapp: http://www.tldp.org/LDP/LGNET/103/odonovan.html | 13:07 |
dlynes_laptop | michealPW, iptables is quite simple...not as simple as ipchains, but for basics, it's quite simple...for more complicated stuff, there's shorewall | 13:07 |
SharkMuttleworth | Shame nothing is as good as PF on OpenBSD | 13:07 |
Hodapp | hmm... I should start a download of some distro that will run on my MK802 in the meantime | 13:07 |
Hodapp | though I don't know if I want Ubuntu there. | 13:07 |
rockworldmi | SharkMuttleworth: that's true ...but also it sont have GUI and and its good for servers not home users ;)O | 13:07 |
yellabs-r2 | i have 12.04 recent upgrades, but now software centre keeps crashing, any tip is welcome to overcome this problem .. | 13:08 |
dlynes_laptop | rockworldmi, not true. pfSense is the gui | 13:08 |
SharkMuttleworth | A firewall doesn't need a GUI though. The sort of use who needs a GUI probably wouldn't understand the rules in a firewall anyway | 13:08 |
michealPW | Hodapp: I Bookmarked this page, too http://www.techrepublic.com/article/linux-101-configuring-and-managing-iptables-to-improve-network-security/5997057 | 13:09 |
PatrickDickey | yellabs-r2 does it send an error report? I ask, because you might find an answer on the bug. | 13:09 |
michealPW | The other is just man iptables hehe! | 13:09 |
yellabs-r2 | it does, but i cant send it | 13:09 |
rockworldmi | SharkMuttleworth: ok.. | 13:09 |
Hodapp | SharkMuttleworth: A firewall may benefit from a GUI, the same as with any other tool for expressing configuration. | 13:09 |
yellabs-r2 | is there any other way to get it ? | 13:09 |
michealPW | Firewalls don't need a GUI perpetually, but it helps in the initial setup for new users who know what they want but don't know the Linux tools. | 13:10 |
PatrickDickey | yellabs-r2, you could try on bugs.launchpad.net and see if there's a bug for it. | 13:10 |
michealPW | Having a firewall GUI perpetually running doesn't make much sense, once you set it up you shouldn't touch it except to check logs every now and then, Iunno? | 13:10 |
yellabs-r2 | yes, i tried several options already, but the same result | 13:10 |
michealPW | But screw learning the different CLI utilities and trying to remember iptables' switches and arguments. Running ufw or firestarter or whatever just works :P | 13:11 |
dlynes_laptop | michealPW, pfSense is a thin client gui for interfacing to pf on bsd | 13:11 |
Hodapp | What a firewall _really_ doesn't need, though, is substantially dumbed-down tools, whether that's GUI or commandline, like the ones some consumer routers use. | 13:11 |
michealPW | My router's crazy. Pages and pages of jargon I have no idea wth it's talking about. | 13:12 |
michealPW | hehe | 13:12 |
michealPW | So much more functionality/complexity than I need for a home router/modem haha | 13:12 |
Hodapp | My problem isn't with jargon, it's with interfaces that just plain do not work. The router/modem I received for my DSL just plain does not work sometimes. | 13:12 |
Hodapp | You'll click a link - on the router page itself - and get timeouts or 404s. | 13:12 |
rockworldmi | well i just needed GUI for apps to allow network acees or not :D | 13:12 |
michealPW | i have the opposite problem. | 13:12 |
caB00T | Anyone read "Assembly Language Step By Step, Third Edition" or is using Insight? | 13:12 |
dlynes_laptop | Hodapp, yeah...just really crappy firmware | 13:12 |
=== wcchandler is now known as WCCHANDLER | ||
BluesKaj | Hiyas all | 13:13 |
michealPW | Mine's a badass router, hehe. I'm just too ignorant when it comes to networking to know how to use it well :P | 13:13 |
michealPW | I just use it as a firewall haha | 13:13 |
michealPW | Basically | 13:13 |
* PatrickDickey uses a Cisco 2514 router and a Cisco Catalyst 2500 switch for his network. | 13:13 | |
rockworldmi | hehe k | 13:13 |
michealPW | It's a TP-link | 13:13 |
Hodapp | I did my best to just set up that Westell router to pass all traffic through to an OpenWrt router I use. | 13:13 |
dlynes_laptop | caB00T, never, but you might try asking on #asm | 13:13 |
caB00T | Thank you very much dlynes_laptop, was just listing trough channels. | 13:14 |
caB00T | :) | 13:14 |
dlynes_laptop | caB00T, might help if you knew which particular cpu you wanted to target, too | 13:14 |
dlynes_laptop | caB00T, or microprocessor for that matter | 13:14 |
Hodapp | Most DSL modems will let you use them basically as bridges, such that the DHCP request from the router will get passed on and the router will receive the Internet IP address, but this one flat-out refused to let me do that. | 13:14 |
dlynes_laptop | reply otherwise you're going to be asking a bunch of vague questions, and nobody'll be of much help | 13:14 |
dr_willis | rockworldmi: last i looked. linyx firewalls dont block on a per-app basis. but ive not used firewalls in a long time | 13:15 |
dlynes_laptop | caB00T, ^^^^^ | 13:15 |
rockworldmi | ok. | 13:15 |
dr_willis | rockworldmi: very opposite of how windows does ir | 13:15 |
Hodapp | Windows firewall is such a damn toy. | 13:15 |
rockworldmi | dr_willis: HMM | 13:15 |
Hodapp | like near everything else I've touched on that OS when trying to use it as a server. | 13:16 |
PatrickDickey | caBOOT, I have the first edition of that book. By Jeff Duntemann? | 13:16 |
caB00T | dlynes_laptop, it's for x86, for PC, I just have a problem with Insight, the software. | 13:16 |
* PatrickDickey thinks I just showed my age | 13:16 | |
caB00T | Great, how do I install Insight...? :p | 13:16 |
rockworldmi | lol | 13:16 |
dlynes_laptop | caB00T, ah....never used it. I've only used TASM, MASM, 6502/6510 assemblers | 13:17 |
caB00T | http://www.contrapositivediary.com/?p=1396 found stuff here but doesn't work for me. | 13:17 |
=== captiankirk is now known as orionsbelt | ||
Hodapp | and here I am wanting to learn ARM assembly. | 13:17 |
caB00T | That's awesome Hodapp, it's the future in a way. :) | 13:17 |
rockworldmi | caB00T: i think FreeBSD has inbuit assembler capacity and the have it in handbook | 13:17 |
dlynes_laptop | Hodapp, There's always gas on the Raspberry Pi | 13:17 |
Hodapp | caB00T: At some point I started to take stock of just how many ARM devices I am developing on. | 13:18 |
Bashking_ | dat pie | 13:18 |
* PatrickDickey never got into Assembly. I got stuck in dead languages.... COBOL, Pascal, FORTRAN, RPG/400..... | 13:18 | |
rockworldmi | caB00T: assembly is not like C ..that you try programmes by copy paste :P | 13:18 |
dlynes_laptop | rockworldmi, remind me to never work on C code written by you :) | 13:18 |
Hodapp | let's see... TI Stellaris, Raspberry Pi, all 5 of the Android devices I develop on, and I also have a Stellaris Launchpad shipping soon. | 13:18 |
caB00T | I know all that, I am a programmer, I just can't follow the book I am reading cuz of software being abandoned. ;\ | 13:18 |
rockworldmi | dlynes_laptop: i dont :D hehehe | 13:19 |
michealPW | Wait, I wonder if I can just do apt-get build-dep supertux | 13:19 |
michealPW | :\ | 13:19 |
michealPW | Bah, didn't do anything. I guess it's not a dependency issue? :\ | 13:19 |
PatrickDickey | yellabs-r2, have you tried googling ubuntu software-center crashes 12.04? | 13:20 |
yellabs-r2 | sure | 13:21 |
orionsbelt | when you download somthing like unetbootin with ubuntu what application is good to launch it ? otherwise how to do it in the terminal? | 13:21 |
yellabs-r2 | and tried several offered solutions | 13:21 |
yellabs-r2 | but no luck sofar | 13:21 |
PatrickDickey | caBOOT, http://askubuntu.com/questions/14837/how-can-i-install-insight-debugger might give you a start. | 13:21 |
=== Kitar|st_ is now known as Kitar|st | ||
=== blazemore is now known as gaben | ||
PatrickDickey | orionsbelt, if you download a .deb file (unetbootin), it will install using the software center. Then you start the application afterwards. | 13:22 |
caB00T | Thank you PatrickDickey. :) | 13:22 |
yellabs-r2 | installed the updates, that seems to have triggered the error | 13:22 |
yellabs-r2 | so it has to do with the new package of software centre | 13:22 |
dlynes_laptop | caB00T, btw...if you're targeting Linux, you can use gas and gdb; if you're using Windows, you can use MASM and Developer Studio | 13:23 |
dr_willis | orionsbelt: you dident download the windows version by mistake did you? | 13:23 |
orionsbelt | ok thanks | 13:23 |
dlynes_laptop | caB00T, all of which are free | 13:23 |
yellabs-r2 | really messy error, should not be on such a fantastic system | 13:23 |
yellabs-r2 | :P | 13:23 |
caB00T | Alright, thanks. I am trying to get this particular one to work so I can follow a book. | 13:23 |
L3top | Can you pastebin the error yellabs-r2 | 13:23 |
caB00T | But I suppose it doesn't matter. | 13:23 |
PatrickDickey | yellabs-r2 do you have the "Proposed updates" option selected in Software Settings? | 13:23 |
yellabs-r2 | L3top, thats part of the problem, cant create an report | 13:24 |
L3top | yellabs-r2: do you have any PPAs installed? | 13:24 |
dlynes_laptop | caB00T, ah...thought you were just wanting to use that one because it was free | 13:24 |
yellabs-r2 | yes plenty | 13:24 |
Azzle-Dazzle | is it possible to downgrade after an upgrade ? | 13:24 |
L3top | yellabs-r2: well that will be the source of the problem. | 13:24 |
PatrickDickey | yellabs-r2 you can try running it in a terminal, and it will give you a bunch of messages. You could pastebin that. | 13:24 |
yellabs-r2 | would be an good idea , for future release to add an option to save report to disk | 13:24 |
L3top | !ppa | 13:25 |
ubottu | A Personal Package Archive (PPA) can provide alternate software not normally available in the offical Ubuntu repositories - Looking for a PPA? See https://launchpad.net/ubuntu/+ppas - WARNING: PPAs are unsupported third-party packages, and you use them at your own risk. See also !addppa and !ppa-purge | 13:25 |
yellabs-r2 | okey , running from bash | 13:25 |
=== florin is now known as Guest44358 | ||
=== alinmear is now known as alin|mobile | ||
rigo | if i stop the download with MC can i contunue it later? so "append" works fine? | 13:26 |
yellabs-r2 | hmm, running from bash as root, no problems , strange | 13:27 |
PatrickDickey | yellabs-r2 try running it from bash as your user (just type software-center). | 13:27 |
=== luriz is now known as Luriz | ||
PatrickDickey | rigo, if you stop a download using a torrent or some type of manager, it will pick up where you left off. But, if you're just doing a download through a browser, probably not. | 13:29 |
dr_willis | not all ftp servers support resume, not sure how mc handles it | 13:29 |
rigo | no no. i download the 15gb file from my server to my local machine with midnight commander and through ftp | 13:30 |
rigo | i can stop it with: keep file | 13:31 |
=== dpac|away is now known as dpac | ||
rigo | i would be happy if i could continue the ftp download where it was stopped. | 13:31 |
the_dark_knight | how do i get rid of the unmet dependencies error http://www.bpaste.net/show/jOyXO0hjijDnRNLtXm5u/ | 13:31 |
dr_willis | wget might be able to do it rigo | 13:31 |
rigo | can i also log in with uname and pw with wget? (if yes say only yes and i read after.. :) ) | 13:32 |
dr_willis | wget has support for user/pass, but ive never used it that way | 13:33 |
dr_willis | you can most likely set up mc to use wget also | 13:33 |
rigo | im not sure that midnightcommander-s ftp feature is able to continue, however there is an option "Append" i would be happy if it would work.. | 13:33 |
Azzle-Dazzle | Guys, Whats the best way to backup my stuff ready to do a fresh install ? | 13:34 |
dr_willis | i dont think append = resume | 13:34 |
rigo | im not sure either.. | 13:34 |
dr_willis | Azzle-Dazzle: copy your impornant files to a external usb, or cloud. reinstall | 13:34 |
Azzle-Dazzle | What about all the addons and crap i downloaded ? or will I just have to re install them ? | 13:35 |
dr_willis | clarify what stuff you mean. | 13:35 |
dr_willis | your users home has all their 'files' normally | 13:35 |
dr_willis | back it up, restore it.. | 13:35 |
=== szal_ is now known as szal | ||
Azzle-Dazzle | I cant quite remember lol I know i had to make several configuration changes in certain files and folders to make things work as they do now :) | 13:36 |
Azzle-Dazzle | and theres been some addons like gnome 3 and some extensions and other tweaks too. | 13:36 |
zxy_64-2 | hi, i cannot do ecryptfs-mount-private, after the computer was forcefuly shut down. Any help ho to do it without recovering it as root, and creating the same user again | 13:36 |
zxy_64-2 | and copying files back to the user | 13:36 |
dr_willis | anything you installed via the package manager would neeed to be reinstalled | 13:36 |
zxy_64-2 | i geT: mount: Operation not permitted | 13:37 |
* PatrickDickey nope... Unity is still borked.... No panels and no top bars on any windows. | 13:37 | |
Azzle-Dazzle | Ok, ill suss it out somehow, Can someone recommend a good distro for me ? Im kinda a linux noob, Im using ubuntu at the mo but feel its time for a change. | 13:38 |
Azzle-Dazzle | id like something lightweihght and fast | 13:38 |
Azzle-Dazzle | ive not been using it to its full potential really | 13:38 |
dr_willis | !lubuntu | Azzle-Dazzle | 13:38 |
ubottu | Azzle-Dazzle: lubuntu is Ubuntu with LXDE instead of !GNOME as desktop environment, which makes it extremely lightweight. See https://wiki.ubuntu.com/Lubuntu - /join #lubuntu for lubuntu support. | 13:38 |
=== ant2 is now known as antonpiatek | ||
dr_willis | you can easially install sever different desktops at the same time | 13:39 |
josy1982 | what is better unity or gnome shell | 13:39 |
=== laura is now known as Guest84104 | ||
Azzle-Dazzle | thanks dr_willis !! | 13:39 |
=== captiankirk is now known as orionsbelt | ||
dr_willis | josy1982: try them both. decide for yourself | 13:40 |
Azzle-Dazzle | ive got about 10 different desktops already, I cant decide which i like most lol | 13:40 |
josy1982 | please tell me | 13:40 |
dr_willis | theres nothing to ttell josy1982 its subjective... | 13:41 |
dr_willis | josy1982: try them both. decide for yourself........ | 13:41 |
gaben | josy1982: Which is better, a kick in the face or a kick in the groin? | 13:42 |
dr_willis | some peopleee hate both. ;) | 13:42 |
tales2010 | Is there anyway to specify a package that's available in a newer version of ubuntu in a older version?? I mean, I'd like to install wkhtmltopdf > 0.9.0 in ubuntu 10.04, but the one that apt-get installs is older than that version. Newer version of ubuntu (12.04) installs a version that I want. Is it possible to specify a different option in sources.list ? | 13:43 |
dr_willis | !backports | tales2010 | 13:44 |
ubottu | tales2010: If new updated Ubuntu packages are built for an application, then they may go into Ubuntu Backports. See https://help.ubuntu.com/community/UbuntuBackports - See also !packaging | 13:44 |
SharkMuttleworth | tales2010: You can just download a binary of wkhtmltopdf from their website, it doesn't really need packaging anyway. I'm using it on a server | 13:44 |
dr_willis | tales2010: or find a ppa | 13:44 |
SharkMuttleworth | You really don't need a package for it, just download the binary and shove it in /opt | 13:44 |
tales2010 | ok thanks | 13:45 |
rigo | i'll never get the files with wget. the directorynames are full with special characters... | 13:46 |
neoman4426 | My trackpad and wireless (at least. haven't checked if wired still works, but it shows up in the network manager, which the wireless doesn't) have stopped working since the upgrade to 12.10. Plugging in a mouse works. Both trackpad and wireless worked in 12.04, in the Windows partition, and in 12.10 live session. Any ideas? | 13:46 |
dr_willis | rigo: this is on a local lan? | 13:47 |
dr_willis | !info wput | 13:48 |
ubottu | wput (source: wput): tiny wget-like ftp-client for uploading files. In component universe, is optional. Version 0.6.2-3 (quantal), package size 109 kB, installed size 456 kB | 13:48 |
rigo | i dont have ssh access to the server where from i want to download the files. | 13:48 |
dr_willis | wput can sendd fro the server to the other box. ;) if it had a ftp server also | 13:49 |
rigo | perhaps i need to order a remote desktop with ssl. the server runs 2010r2 i think. | 13:49 |
dr_willis | rigo: theres a fuse ftp fs also.. makea the ftp server 'mount' to a local diiirectory | 13:49 |
dr_willis | for transfering 15gb i would think rsync would be best | 13:50 |
rigo | can i? i dont konw how. i only know the way in windoze... :) | 13:50 |
=== alin|mobile is now known as alinmear | ||
=== wN_ is now known as wN | ||
T3X | What is the best software to recover file on formated pen drive? | 13:50 |
dr_willis | we dont know many details of your setup rigo , so we cant really give more then general suggestions | 13:51 |
rigo | right and i dont need more than general suggestions cause i want to learn :) | 13:51 |
rigo | and thanks for the help! | 13:51 |
dr_willis | !undelete | 13:51 |
ubottu | Some tools to recover lost data are listed and explained at https://help.ubuntu.com/community/DataRecovery - Recovering deleted files on !ext3 filesystems can be virtually impossible, although methods that might work is some cases are described at at http://www.xs4all.nl/~carlo17/howto/undelete_ext3.html and http://projects.izzysoft.de/trac/ext3undel | 13:51 |
rigo | im just sad that the worldbest mc cant continue the broken downloads. :( | 13:51 |
dr_willis | rigo: try it with a smaller file as a test. perhaps it can if the ftp server supported resumes | 13:52 |
rigo | i'll read after fuse and mounting ftp sites. | 13:52 |
=== zhurai-tsuki is now known as zhurai | ||
irlm | hello everyone | 13:53 |
irlm | welcome to the jungle :) | 13:53 |
KaKila | Anybody with AMD FirePro M2000 under ubuntu/debian? | 13:54 |
=== BlackJack is now known as Dreaman | ||
cnf | hi, is there a way to get maclike multitouch gestures working on 12.10? | 13:57 |
=== qwerty is now known as Guest19667 | ||
SharkMuttleworth | cnf: https://wiki.ubuntu.com/Multitouch/TouchpadSupport | 14:00 |
Cristen | Hi everyone, i'm new to ubuntu, how do you rename only a part of filename ? here's what I got atm : find . -iname "*snapper-rock[^s]*" -exec rename {} I wanna rename all the files containing the word "rock" with the same filename but using the word "rocks" instead. | 14:01 |
Cristen | Any ideas ? | 14:01 |
dr_willis | Cristen: i tend to use 'qmv' from the renameutils package for complex renameing | 14:02 |
cnf | uhm | 14:02 |
dr_willis | but its not a cli only type 'tool' like find is. ;) | 14:02 |
dr_willis | there may be some other tools in that package to make it easier | 14:02 |
cnf | SharkMuttleworth: there is no less convoluted way? | 14:02 |
Cristen | thanx dr_willis but I wish I could do that the hard way | 14:02 |
=== dpac is now known as dpac|away | ||
=== Youri is now known as YBook | ||
SharkMuttleworth | cnf: That's not particularly convoluted | 14:03 |
cnf | are you kidding me? | 14:03 |
yellabs-r2 | i think i have the ubuntu software-center crash solved for now, very simple, untick the "new applications in starter" in the menu and its fine | 14:03 |
yellabs-r2 | no crash yet | 14:03 |
=== lizzin is now known as Guest80348 | ||
cnf | SharkMuttleworth: i have no idea how to make any of that do anything useful | 14:05 |
yellabs-r2 | cnf ? is this you mark ? | 14:05 |
=== Fike_ is now known as Fike | ||
cnf | yellabs-r2: sorry? | 14:06 |
engehap | hi all | 14:07 |
engehap | i have a problem with bridged interfaces | 14:07 |
engehap | i've bridged 2 interfaces | 14:07 |
engehap | but when try to use this bridge to connect 2 networks | 14:07 |
yellabs-r2 | ah , you are quoting .. i guess | 14:08 |
engehap | the arp request and replys donn't get throw the bridge | 14:08 |
cnf | ok, lets start with something specific | 14:08 |
cnf | how do i correct the scrolling direction on the touchpad? | 14:08 |
compdoc | engehap, maybe pastebin your conf files | 14:08 |
engehap | compdoc what do you mean | 14:08 |
compdoc | engehap, pastebin.org to show us your setup | 14:09 |
cnf | or switch desktop with a 3 finger swipe, maybe? | 14:09 |
engehap | http://pastebin.com/Cs3B5MU1 this is the interfaces file | 14:10 |
MonkeyDust | cnf maybe this link is useful (i don't use touchpad, tho) https://help.ubuntu.com/community/SynapticsTouchpad | 14:11 |
yellabs-r2 | cnf , whats the setup , as in hardware ? | 14:11 |
compdoc | engehap, are you sure you can set up a bridge that way | 14:11 |
cnf | yellabs-r2: thinkpad touchpad | 14:11 |
engehap | compdoc also used these commands http://pastebin.com/VSxLztf1 | 14:12 |
compdoc | engehap, ok, I see that you can | 14:12 |
engehap | compdoc i have the same conf running on another machine | 14:12 |
yellabs-r2 | cnf, i does work out of the box , no ? | 14:12 |
cnf | yellabs-r2: uhm, no? | 14:12 |
cnf | it doesn't respond to any gesture i know, and scrolling is in the wrong direction | 14:13 |
yellabs-r2 | hmm, i got two thinkpads, they both work, whats the version ( T60 ) | 14:13 |
cnf | T430s | 14:13 |
engehap | compdoc on the bridge i recive traffic and arp requests from both interfaces but no replys | 14:14 |
compdoc | engehap, I think you have one thing wrong | 14:14 |
cnf | MonkeyDust: that doesn't really say much | 14:14 |
billkd | having issues with pulseaudio, dummy output is only device and I can't get it to work at all, even at login screen. | 14:14 |
engehap | compdoc which is?? | 14:15 |
billkd | having issues with pulseaudio, dummy output is only option and can't get ito work. | 14:15 |
compdoc | engehap, I use bridges for qemu-kvm, but not as you have done, but I think you need this at least: http://pastebin.com/t6BsHe8f | 14:16 |
* L3top removes pulse audio... solves all pulse audio problems. | 14:16 | |
billkd | using quantal | 14:16 |
michealPW | YAY! | 14:16 |
lotus | hey, I turned my computer on today and my dual monitor setup is cloning instead of giving me extra workspace | 14:16 |
engehap | compdoc ok i will check | 14:16 |
billkd | but I want to keep pulseaudio because many packages depend on it. | 14:16 |
cnf | hmz, frustrating :/ | 14:16 |
lotus | I tried starting arandr up, but the monitors cannot be dragged alongside eachother | 14:16 |
michealPW | Thx everyone for their help. Got the latest supertux and supertux-editor v0.3.3 compiled and installed, working perfectly! :) | 14:16 |
rigo | can someone tell me what can i do with this? https://www.midnight-commander.org/changeset/e04291c56d75628832130e895af0ec2684f96082/ | 14:17 |
slackerboy | !pastebin | 14:17 |
ubottu | For posting multi-line texts into the channel, please use http://paste.ubuntu.com | To post !screenshots use http://imagebin.org/?page=add | !pastebinit to paste directly from command line | Make sure you give us the URL for your paste - see also the channel topic. | 14:17 |
cnf | can't even change scroll directions! | 14:17 |
rigo | how/what? | 14:17 |
lotus | any ideas on how I can make my monitors not be clones? | 14:17 |
z2s8 | hi my new ubuntu doesn't come back from suspend any idea to solve? | 14:17 |
yellabs-r2 | cnf, i hope so | 14:17 |
billkd | oohow can I fix pulseaudio without removing? | 14:17 |
yellabs-r2 | lost connection , hold on | 14:18 |
MonkeyDust | lotus try arandr | 14:18 |
dr_willis | lotus: what video chipset | 14:18 |
lotus | my monitors randomly started cloning eachother today instead of giving me more workspace -- arandr won't let me move the monitor to it's proper place | 14:18 |
booh- | Is it possible to install pfsense and update the freebsd kernel after that? The integrated nic isn't detect with the last release of pfsense but it is with the beta... so I plan to install lthe release but upgrade the kernel. (I can't add nic... it's ITX motherboard, only 1 slot) | 14:18 |
lotus | erg | 14:18 |
lotus | sorry | 14:18 |
lotus | arandr isn't giving me the ability to drag the monitor, MonkeyDust | 14:18 |
lotus | dr_willis: ati I think, let me double check | 14:18 |
billkd | I use pulseaudio in user mode, default config. Tryed removing folder to see if it would regenerate it did but problem remained any ideas on how to fix? No updates available so cannot update. | 14:19 |
L3top | billkd: what depends on pulse? Many things will attempt to USE pulse if it exists... but sudo apt-get remove --dry-run pulseaudio should not reveal ANYTHING important that has to go with it. | 14:19 |
lotus | ati/amd dr_willis | 14:19 |
dr_willis | the fglrx drivers have their iwn control center tool i thought lotus | 14:19 |
billkd | not removing it. Hw can I fix pulseaudio, not jusrt by using alsa? | 14:20 |
L3top | billkd: that command will not remove it btw... it just simulates what it would do if you ran without dry run | 14:20 |
michealPW | Yea, they do | 14:20 |
lotus | dr_willis: ahh, look at that :) | 14:20 |
Bombo | what nvidia cards does the nvidia-173 and the nvidia-96 and the nvidia-current package support? how do i find out? | 14:20 |
michealPW | ccc, I'm not sure what exactly it's called, the binary. try aticonfig | 14:20 |
michealPW | hehe | 14:20 |
yellabs-r2 | cnf : is this your first ubuntu ? | 14:20 |
L3top | billkd: alsa is what is controlling your sound. Pulse is a layer on top that attempts to configure alsa for you... it is superlative and unnecessary | 14:20 |
billkd | That's pointless | 14:21 |
billkd | I want to fix pulseaudio! | 14:21 |
billkd | let's see | 14:21 |
billkd | oh yeah, like ubuntu-desktop isn't important? | 14:21 |
L3top | Im sorry... I thought you wanted audio to work... | 14:21 |
michealPW | Yea, PulseAudio just a layer ontop of ALSA. Added complexity for the fail! :) | 14:21 |
billkd | I want pulseaudio to work | 14:21 |
michealPW | What's your problem with PA, billkd? | 14:21 |
dr_willis | billkd: thats a metapackage ;-) | 14:21 |
L3top | ubuntu desktop is listed as an rdepend... it does not remove ubuntu-desktop. | 14:21 |
L3top | look I am not fighting with you. | 14:21 |
L3top | Good luck. | 14:21 |
michealPW | I find PulseAudio breaks ALSA games. I'm not an expert, no idea what's going on. But when I run a lot of older linux games, they fall apart with a bunch of ALSA errors. | 14:22 |
=== dext is now known as Dext | ||
billkd | I'm not trying to fight. I'm trying to fix pulseaudio. | 14:22 |
yellabs-r2 | cnf , you still here ? | 14:22 |
dr_willis | time to restate and clarify the sound issues i think | 14:22 |
cnf | yellabs-r2: my first with X | 14:22 |
michealPW | billkd: So, what's the problem with PulseAudio you're having? | 14:22 |
L3top | again... if working audio is not your goal... I cant help you. You want to fight about the need for pulse... cant help you. | 14:22 |
yellabs-r2 | cnf : i was reading this http://andym3.wordpress.com/2012/05/27/fixing-natural-scrolling-in-ubuntu-12-04/ | 14:22 |
billkd | the only device displayed is dummy output, and I cannot actually fix pulse. I tryed removing the .pulse directory, fixing things by chowning the folders to the correct users, but nothing. | 14:22 |
cnf | i normally don't touch X based stuff | 14:22 |
yellabs-r2 | cnf , but i dont know if its to technical for you | 14:23 |
slackerboy | any idea why conky does not het refreshed with desktop wallpaper in xfce ? | 14:23 |
Joserick | hi | 14:23 |
slackerboy | http://imagebin.org/232832 | 14:23 |
dr_willis | billkd: could be the system is not seeing the card at all. | 14:23 |
billkd | it is since i'm using my console screenreader. | 14:24 |
billkd | after killing pulse | 14:24 |
dr_willis | so alsa works. | 14:24 |
billkd | but orca and speech-dispatcher don't work | 14:24 |
lotus | dr_willis: thank you, that did it. | 14:24 |
billkd | aand if I reconfigure speech-dispatcher to use alsa it will talk over itself | 14:25 |
billkd | and be unstable | 14:25 |
yellabs-r2 | cnf : http://andym3.wordpress.com/2012/05/27/fixing-natural-scrolling-in-ubuntu-12-04/ | 14:25 |
cnf | yes, i saw | 14:25 |
yellabs-r2 | ok, got connection problems at the moment sorry | 14:25 |
cnf | it seems so, yes | 14:26 |
erictr1ck | trying to upgrade to 12.10 and am stuck on file 1605 in the "Getting new packages" step. My other two machines upgraded just fine on the same network. Any suggestions? | 14:26 |
billkd | so how can I fix pulseaudio? | 14:27 |
IdleOne | erictr1ck: how long has it been stuck? | 14:27 |
yellabs-r2 | cnf : here an other article about it http://askubuntu.com/questions/203018/natural-scrolling-not-working-for-horizontal-scroll-how-to-fix-this | 14:27 |
slackerboy | 5http://imagebin.org/232832 | 14:27 |
slackerboy | http://imagebin.org/232832 | 14:27 |
yellabs-r2 | cnf : thats two day's old , so should be up to date | 14:27 |
yellabs-r2 | cnf : i hope it solves a part of the problem, good luck ! | 14:28 |
billkd | so how can I fix pulseaudio? | 14:28 |
billkd | so how can I fix pulseaudio? | 14:28 |
IdleOne | repeat it a few more times, maybe someone will know. | 14:28 |
dr_willis | or test it with a newly made user | 14:29 |
dr_willis | !pulse | 14:29 |
ubottu | PulseAudio is a sound server intended as a drop-in replacement for !ESD - See https://wiki.ubuntu.com/PulseAudio for information and installation instructions | 14:29 |
erictr1ck | IdleOne: about an hour and a half now | 14:29 |
=== florin is now known as Guest34600 | ||
dr_willis | i rarely mess withsound issues. | 14:30 |
rigo | so no idea? | 14:30 |
michealPW | Yay, I'm so happy I got the latest supertux-editor working. Now I can migrate my son over to the new SuperTux and I can start making him some levels for the new one :) | 14:30 |
cnf | hmz :/ | 14:30 |
rigo | is this feature added to MC already or do i have to install it manually? | 14:30 |
IdleOne | erictr1ck: that seems like way too long. I would restart the computer at this point but you may be stuck with an unbootable install. | 14:30 |
rigo | https://www.midnight-commander.org/changeset/e04291c56d75628832130e895af0ec2684f96082/ | 14:30 |
=== dark3n is now known as dark3n|off | ||
OerHeks | rigo i get a warning about wrong certificates. sorry, won't open it. | 14:31 |
billkd | how can I fix pulseaudio? | 14:31 |
michealPW | I remember on Ubuntu 7.04 when PulseAudio was new and we had to manually replace the ESound Daemon with it... At that time it made no sense at all to me. Perfectly working ESD and we rip it out to put in a bug-riddled PulseAudio that still needed a tonne of work :\ | 14:31 |
slackerboy | !pastebin | 14:32 |
ubottu | For posting multi-line texts into the channel, please use http://paste.ubuntu.com | To post !screenshots use http://imagebin.org/?page=add | !pastebinit to paste directly from command line | Make sure you give us the URL for your paste - see also the channel topic. | 14:32 |
michealPW | Still in 12.04 people are having Pulse problems? hehehe crazyness. The change for sake of change is nuts on these systems hehe | 14:32 |
=== mosno2 is now known as mosno | ||
billkd | 12.10 | 14:32 |
michealPW | Ouch, you're in 12.10 billkd? | 14:32 |
cnf | yellabs-r2: doesn't work well, but at least it works | 14:32 |
billkd | yep and trying to fix it. Now, don't go tell me to just remove the package. | 14:32 |
IdleOne | billkd: why did you uninstall it? | 14:32 |
michealPW | No I wont, billkd. I wish I could help you but I'm not sure how to fix it, mate. Do you have any front-ends for it, like if you open your HUD and type "pulse" does it find a PulseAudio Manager? | 14:33 |
PatrickDickey | !pulse | 14:33 |
ubottu | PulseAudio is a sound server intended as a drop-in replacement for !ESD - See https://wiki.ubuntu.com/PulseAudio for information and installation instructions | 14:33 |
michealPW | I have a settings manager I installed with apt-get to try and fix my problems (Mine were easy, it just set my HD audio output as default and I have nothing but analog so I just switched it in the manager and sound seemed to work fine) | 14:33 |
billkd | you mean the dash? | 14:34 |
PatrickDickey | billkd, do other applications work with your sound card? | 14:34 |
billkd | installing paprefs | 14:34 |
michealPW | Yea, the dash or whatever it's called. I use KDE so Iunno. | 14:34 |
michealPW | Yea that's it I think, paprefs. | 14:34 |
cnf | hmm, ok so 3 finger swipe to switch desktop... | 14:34 |
cnf | anyone an idea how to get that done? | 14:34 |
billkd | KDE doesn't work with orca and plus it's a resource ho. | 14:34 |
yellabs-r2 | what wrong with my network , grrr | 14:34 |
yellabs-r2 | going to reset my network, bye all | 14:35 |
michealPW | What's Orca, is that an on-screen text-to-speech agent? | 14:35 |
michealPW | I have no need for that kind of stuff. There isn't an alternative KDE app that provides that functionality (Off-topic, sorry hehe) | 14:35 |
* PatrickDickey Orca used to be the first annoying whale that I killed when I'd install ubuntu. | 14:35 | |
michealPW | LMAO! | 14:35 |
michealPW | Nice | 14:35 |
PatrickDickey | I'd log in, and it would start up automatically. So I'd have to uninstall it. | 14:36 |
erictr1ck | IdleOne, thats what I was afraid of. is there any way to download an upgrade package instead of dowsnloading the full release and doing a frsh install? | 14:36 |
SharkMuttleworth | PatrickDickey: Now the most annoying thing is the Amazon search | 14:36 |
gothaggis|work | hello, I have 2 servers of the same type that I am trying to install Ubuntu on. Both of them install Ubuntu just fine, however once the system is rebooted, it say no operating system. If i leave the ubuntu disk in the cd drive and select 'boot from first hard disk' it boots just fine into ubuntu. how do i fix this? I've installed ubuntu on other servers and haven't run into this issue | 14:36 |
gothaggis|work | before. | 14:36 |
PatrickDickey | billkd if other applications work properly, then the problem is with the accessibility features not Pulse. | 14:36 |
PatrickDickey | SharkMuttleworth only when it recommends Windows 8 Pro. ;-) | 14:37 |
billkd | no pulse doesn't work i'm using alsa in a TTY | 14:37 |
billkd | with espeakup | 14:37 |
IdleOne | erictr1ck: no, the upgrade package would be the full .iso | 14:37 |
billkd | kernel module for console speech | 14:37 |
michealPW | LOL the Amazon search is brutal. I'll never agree that it's not simply a shameless ad ;) | 14:38 |
billkd | so how can I fix the pulse audio? | 14:39 |
PatrickDickey | billkd do you have an actual desktop, or are you doing everything through a console? | 14:39 |
billkd | I do have the unity desktop but i'm on irc through a console with espeakup. | 14:39 |
billkd | I can get someone to read the screen in the desktop to fix pulse if required. | 14:40 |
michealPW | So wait, you're "talking" and espeakup is typing to IRC for you? | 14:40 |
samuel_ | Hi everybody :) | 14:40 |
michealPW | That would be pretty badass, hehe | 14:40 |
billkd | no, espeakup is telling me what your saying. | 14:40 |
compdoc | michealPW, brutal? | 14:40 |
billkd | I cannot see the screen otherwise. | 14:40 |
michealPW | That's pretty cool, billkd | 14:40 |
BluesKaj | billkd, you could try pavucontrol , it's GUI for pulseaudio , there you can choose your input and output settings | 14:40 |
lionchen | hello everybaby | 14:40 |
billkd | k hang on | 14:40 |
PatrickDickey | Well, I would go into Unity and then into System Settings. Then sound. Start with the obvious, and make sure that the right set of hardware is selected, and use "Test Speakers" to see if they work. | 14:41 |
michealPW | Oh maybe pavucontrol is what I used, iunno. I just search in the K start-menu-thingy | 14:41 |
=== matt_ is now known as Guest12932 | ||
mah454 | Hello | 14:41 |
michealPW | compdoc: Yes. An ad built-into your operating system.. "Brutal" is the only thing that comes to mind :P | 14:41 |
billkd | the only option is dummy output! | 14:41 |
PatrickDickey | michealPW sudo apt-get remove unity-lens-shopping | 14:41 |
compdoc | michealPW, I havent tried 12.10, so I thought maybe it slowed things to a crawl or somthing | 14:42 |
samuel_ | I'd need some help with ACPI and Ubuntu 12.04 (lightdm) | 14:42 |
PatrickDickey | billkd in your console, type lspci and see if your sound card is listed there. | 14:42 |
billkd | it is | 14:43 |
L3top | but sudo aplay -l isn't I am guessing. | 14:44 |
erictr1ck | IdleOne, oh ok, so if i download and install the full iso it will give me the option to upgrade in addition to doing a clean install? | 14:44 |
billkd | it is, because pulse isn't on right now. When it is dummy output is only option. | 14:44 |
fd5788 | hello | 14:44 |
=== dark3n|off is now known as dark3n | ||
L3top | billkd: you could generate an asound.conf. That might override whatever pulse is breaking. | 14:44 |
billkd | how? | 14:45 |
IdleOne | erictr1ck: I believe it does give you the option to upgrade provided it can see the old install, but you have already started the upgrade process so it might not. | 14:45 |
L3top | I am not really sure, because as you know, I just remove the problematic and unnecessary piece of software. | 14:45 |
=== dark3n is now known as dark3n|off | ||
L3top | billkd: Give me the output of sudo aplay -l in a pastebin. | 14:45 |
cnf | right, so scrolling (mostly) works | 14:45 |
cnf | anyone an idea how to make side swiping to switch desktop work? | 14:46 |
billkd | wgetpaste isn't available in the rpository | 14:46 |
michealPW | Bah | 14:46 |
billkd | repository | 14:46 |
IdleOne | erictr1ck: that said, you can do a clean install without losing any of your data. just make sure that you set your /home when you reach the partitioning section of the install. | 14:46 |
L3top | !pastebinit | billkd | 14:46 |
ubottu | billkd: pastebinit is the command-line equivalent of !pastebin - Command output, or other text can be redirected to pastebinit, which then reports an URL containing the output - To use pastebinit, install the « pastebinit » package from a package manager - Simple usage: command | pastebinit -b http://paste.ubuntu.com | 14:46 |
samuel_ | I'd like the computer to automatically shutdown when nobody is logged in (lightdm) and the power button is pressed, but still display the confirmation menu when someone is logged in | 14:46 |
dummy | hi, does anyone can recommend me a external wlan-antenna for my laptop that is compatible with linux? | 14:48 |
billkd | paste.ubuntu.com/1297636 | 14:48 |
IdleOne | dummy: ask in ##hardware | 14:48 |
dummy | IdleOne, thx, i will. | 14:48 |
PatrickDickey | billkd http://ubuntuforums.org/showthread.php?t=1845904 sounds almost exactly like your problem. | 14:49 |
billkd | how can I read that? Lynx or something? | 14:49 |
samuel_ | I have played with the files in /etc/acpi, without success so far... | 14:49 |
=== shantorn is now known as furian | ||
Archimede669 | ciaoooooooooooo | 14:50 |
billkd | perhaps if you could give me the solution | 14:50 |
billkd | without linking | 14:50 |
woercel | asdf | 14:50 |
woercel | asdf | 14:50 |
woercel | asdf | 14:50 |
FloodBot1 | woercel: Please don't flood; use http://paste.ubuntu.com to paste; don't use Enter as punctuation. | 14:50 |
L3top | where do you want me to put this billkd? | 14:51 |
michealPW | That link doesn't seem to end with a sound conclusion. | 14:52 |
samuel_ | thanks for your help :) | 14:52 |
michealPW | Some good tips and useful information, but no conclusion. billkd did you say you tried removing ~/.pulse and also ~/.asound directories and restarted? | 14:52 |
billkd | just .pulse not .asound will try | 14:53 |
billkd | if that doesnn't work then what? | 14:53 |
L3top | here... billkd I will give you a link you can wget and a sed to replace the values. We will start with the simple template... unless you want to do something else. | 14:53 |
harnen | \whois harnen | 14:53 |
billkd | okay | 14:54 |
Toph2 | i'm in a terminal and know how to navigate through the file system on the drive I'm in. However, I have 3 drives, so how do I address them through the terminal I'm in? | 14:54 |
billkd | sda sdb sdc | 14:54 |
PatrickDickey | Toph2 are they mounted? | 14:55 |
billkd | what is the link? | 14:55 |
MonkeyDust | Toph2 type mount to see where they are mounted, then use cd to go there | 14:55 |
Toph2 | PatrickDickey,,, yes | 14:55 |
L3top | billkd: wget http://svn.linuxmce.org/trac.cgi/export/26592/branches/LinuxMCE-1004/src/BootScripts/templates/asound.conf.backup | 14:56 |
PatrickDickey | Toph2 then follow MonkeyDust's instruction. | 14:56 |
billkd | what is the link? | 14:56 |
billkd | got it | 14:56 |
BluesKaj | doesn't nautilus have a places option where other drives are listed ? | 14:56 |
L3top | billkd: sed "s#%MAIN_CARD%#0#g" asound.conf.backup > /etc/asound.conf | 14:56 |
L3top | billkd: this is a very basic sort of one size fits all to begin with. We can get more complicated if that doesn't work. | 14:57 |
genii-around | BluesKaj: "<Toph2> i'm in a terminal" | 14:57 |
L3top | billkd: also, how are you actually connecting to audio, analog spdif or hdmi? | 14:57 |
Toph2 | Mongolski,,, for example one drive is : /dev/sda5 on /media/5325bc13-cb11-4f0c-97bd-d17dec04d6c4 so my cd command would look like how? | 14:58 |
MonkeyDust | Toph2 cd /media/53 [tab] | 14:58 |
billkd | repeat link | 14:58 |
billkd | it went away | 14:58 |
harnen | \join #ubuntu | 14:58 |
Toph2 | Mongolski,,, ok,, thanks | 14:58 |
Toph2 | MonkeyDust,,, | 14:58 |
Mongolski | :D | 14:59 |
BluesKaj | genii-around, ok thanks | 14:59 |
billkd | fine, then. | 14:59 |
L3top | billkd: wget http://svn.linuxmce.org/trac.cgi/export/26592/branches/LinuxMCE-1004/src/BootScripts/templates/asound.conf.backup | 15:00 |
L3top | billkd: sed "s#%MAIN_CARD%#0#g" asound.conf.backup > /etc/asound.conf | 15:00 |
PatrickDickey | L3top, he left. | 15:00 |
* L3top loves boxing to help people | 15:01 | |
axl__ | hey guys, I don't know much about bash scripting | 15:01 |
* PatrickDickey has just decided that he hates cronjobs. | 15:01 | |
axl__ | but I want to write a one line conditional script for a command line | 15:01 |
axl__ | that pivots which command i run based on an environment variable | 15:02 |
MonkeyDust | axl__ there's also #bash | 15:02 |
axl__ | MonkeyDust: | 15:02 |
axl__ | got it | 15:02 |
jrib | PatrickDickey: are you cheating on cron with anacron? | 15:03 |
=== atrius_away is now known as atrius | ||
PatrickDickey | lol nope. Just trying to set up an hourly cron job with crontab -e. And it's not running. or if it is, it's not doing what it's supposed to. | 15:04 |
jrib | PatrickDickey: paste your line | 15:05 |
nishttal2 | hello ppl.. i am having an issue with display.. i have a server with onboard VGA .. and 2 GTX 570 cards... i have a monitor hooked up to the onboard VGA.. the system boots fine.. but i get a blank screen after grub.. it picks up the GTX card as display out.. how can i change that? | 15:06 |
Hatori | !info ltsp | 15:06 |
ubottu | Package ltsp does not exist in quantal | 15:06 |
PatrickDickey | 0 * * * * python /home/patrickdickey/Documents/TunnelBrokerUpdater/TunnelBrokerUpdater.py | 15:06 |
=== Sickki_ is now known as Sickki | ||
PatrickDickey | I've tried it with and without the python at the beginning. | 15:07 |
Profoss | PatrickDickey: try 00 | 15:07 |
PatrickDickey | So, 00 * * * * ? | 15:07 |
jrib | PatrickDickey: redirect stdout and stderr somewhere and take a look | 15:07 |
PatrickDickey | The script is supposed to write to a log file. | 15:08 |
Profoss | PatrickDickey: that's what I've got | 15:08 |
Profoss | don't know if that fixes your problem though | 15:08 |
jrib | PatrickDickey: that's fine that it is supposed to write to a log file. Is it writing to the log file? Redirect stdout and stderr somewhere and take a look | 15:08 |
L3top | axl__: can you be less ambiguous about what you want to do? Why does it have to be one line? | 15:08 |
jrib | #ubuntu-golf I wonder how well that would work | 15:09 |
axl__ | L3top: it has to be a one liner because I am running this on a server someplace else, and the interface I have needs me to keep this to on line | 15:09 |
L3top | axl__: if it is a script, then running the script will be one line. Anyway... what are you wanting it to do based on what? | 15:10 |
cnf | how do i change the hotkey for switching desktops in xfce? | 15:11 |
axl__ | L3top: there is a env variable that is set, which holds the branch name of my code repository | 15:11 |
axl__ | but those are just details | 15:11 |
axl__ | i want to run a different command depending on the value of the branch name | 15:11 |
PatrickDickey | jrib and Profoss it's not even running the script. I think I have something misspelled in the pathname. But, it won't run anyhow, as it was created in Python 2 and 12.10 uses Python3. So I need to fix it first. But, thanks for the help. :) | 15:12 |
L3top | axl__: if [[ "$ENV_VARIABLE" == "this_condition" ]]; then command; else command; fi | 15:12 |
axl__ | L3top: thanks i am going to try that. very useful | 15:12 |
jrib | PatrickDickey: you can install python2 on 12.10 and then just explicitly call python2 | 15:12 |
axl__ | L3top: awesome! that works | 15:13 |
PatrickDickey | Thanks jrib. I may try that when I wake up. Eventually I'll probably port it to python 3, just to be safe. | 15:13 |
humbolt | when I install a library under /opt/obe/lib, which obe needs to build, how can I tell ./configure that the lib lives in that directory (/opt/obe/lib)? | 15:14 |
jrib | PatrickDickey: yes, about time to do that :) | 15:15 |
zetheroo | anyone have experience with enabling TRIM support on an SSD in Ubuntu? | 15:15 |
* PatrickDickey knew I should have chose Python 3 when I created the script.. LOL Ooops. | 15:16 | |
dr_willis | zetheroo: saw some info on it at the askubuntu.com site. just had to edit the fstab options i recall | 15:16 |
zetheroo | dr_willis: I just found this ... was that what you saw? ... looks pretty involved :P | 15:17 |
zetheroo | http://askubuntu.com/questions/18903/how-to-enable-trim | 15:17 |
=== dpac|away is now known as dpac | ||
dr_willis | zetheroo: most of its allready enabled by default these days i belive | 15:17 |
dr_willis | i just had to change a fstab entry for / | 15:18 |
zetheroo | dr_willis: any way to see if it's already enabled? | 15:18 |
nibuius | hi | 15:19 |
dr_willis | zetheroo: that url gave some commands to test it looks like. i just added tge discard option in fstab | 15:20 |
zetheroo | ok | 15:20 |
cnf | hmz | 15:20 |
cnf | don't seem to find a single WM that doesn't piss me off | 15:20 |
dr_willis | write your own. ;-) | 15:21 |
MonkeyDust | cnf why not create one yourself? | 15:21 |
dr_willis | then be mad at yourself | 15:21 |
=== Youri is now known as YBook | ||
MonkeyDust | cnf-DE | 15:22 |
Profoss | dr_willis: YAWM? :P | 15:23 |
dr_willis | jwm+rox-filer ;-) | 15:23 |
cnf | MonkeyDust: because work won't pay me for that | 15:23 |
designbybeck | I still have a broken GRUB. I installed LinuxMint Cinnamon first, then 12.10 64bit. 12.10 boot once, then I did a "sudo update-grub" and it shows 12.10, but when rebooting the GRUB doesn't look like the new GRUB it has LinuxMint Cinnamon grub | 15:23 |
dr_willis | but does it boot? | 15:24 |
azcv | I have some issus with 12.10.Can someone help me?When open an app with root(gksu) it opens without global menu and overlay scrolbars. | 15:25 |
=== root____1 is now known as souravaj | ||
=== souravaj is now known as SouravAj | ||
vickytomar__ | ikonia: are you there? | 15:26 |
dr_willis | azcv: try gksudo gedit vs. gksu gedit | 15:26 |
ikonia | vickytomar__: yes ? | 15:26 |
ElixirVitae | Hi! | 15:26 |
vickytomar__ | ikonia : could you please help me regarding the same issue. | 15:26 |
ikonia | vickytomar__: I told you what to do | 15:26 |
vickytomar__ | ikonia : i am at the same state you left me. i mean how to reset the graphic card | 15:27 |
ikonia | vickytomar__: you ask the channel to (I think someone explained how to do it for you the other day) | 15:27 |
azcv | dr_willis;it's the same with gksudo,gksu or only sudo | 15:27 |
vickytomar__ | ikonia : yes some one L3top told me that don't worked for me. | 15:27 |
ikonia | vickytomar__: then ask the channel again | 15:28 |
* L3top remembers nic, not problem. | 15:28 | |
vickytomar__ | ikonio : i am asking ... please help me | 15:28 |
=== seednode_ is now known as Seednode | ||
ikonia | L3top: xorg, hardcode vesa | 15:29 |
vickytomar__ | L3top : the solution you provided for resetting the graphic card don't worked for me ... please help me | 15:29 |
ikonia | L3top: you gave detailed instructions about stopping X and doing a --configure | 15:29 |
vickytomar__ | ikonia : i did that | 15:29 |
L3top | ah yes... if you specified vesa in xorg.conf then you are using the vesa driver. lspci -nnk | grep VGA -A3 what module does it say is in use? | 15:30 |
L3top | vickytomar__: you never explained WHY you wanted to use the vesa driver. I was just telling you how you could specify it. | 15:30 |
ikonia | L3top: lspci doesn't show you what module is in use | 15:30 |
ikonia | L3top: I asked him to force it to vesa to run a test as his X display is hanging | 15:30 |
L3top | Kernel driver in use: fglrx_pci | 15:31 |
ikonia | L3top: that won't show if it's actually being used in X | 15:31 |
vickytomar__ | ikonia : sudo service lightdm stop | 15:32 |
vickytomar__ | then | 15:32 |
vickytomar__ | Xorg -configure | 15:32 |
vickytomar__ | then | 15:32 |
FloodBot1 | vickytomar__: Please don't flood; use http://paste.ubuntu.com to paste; don't use Enter as punctuation. | 15:32 |
vickytomar__ | sudo service lightdm start | 15:32 |
L3top | I see... well then that is very misleading ikonia ;) | 15:32 |
vickytomar__ | FloodBot1 : ok thanks | 15:32 |
azet | hi | 15:32 |
ikonia | L3top: it wouldn't be the first time lspci has miss-leading output in fairness | 15:32 |
azet | does someone have a kickstart (kickseed) file with UEFI/EFI boot partitions, that actually works with ubuntu? | 15:33 |
=== KanerixWolfe is now known as Kanerix | ||
L3top | vickytomar__: before you start lightdm you must change the Driver to vesa, and copy it from ~/xorg.conf.new to /etc/X11/xorg.conf | 15:33 |
vickytomar__ | ikonia / L3top : i am getting you plz tell me what to do | 15:33 |
ikonia | vickytomar__: ask the channel - not me, I'm busy doing other things | 15:33 |
vickytomar__ | L3top : i did that exactly same as you told me | 15:33 |
bashking_ | cocks | 15:33 |
=== milind is now known as abyss42 | ||
rolling2k | 5576211112896739 0414 885 APPROVED! BANK: | MASTERCARD | SUNTRUST | DEBIT | GOLD PREMIUM | UNITED STATES | USA | 840 | | 15:34 |
L3top | vickytomar__: grep "vesa" /etc/X11/xorg.conf | 15:34 |
ElixirVitae | If I were to (re)install GRUB2, I can use a flash drive with LiveCD as well, no? | 15:34 |
vickytomar__ | L3top : vesa was already there i didn't need to replace any thing | 15:35 |
zetheroo | dr_willis: got it working! :D | 15:35 |
diverdude | Is it really not possible to install opencv from ubuntu repos ? | 15:35 |
L3top | vickytomar__: you wont tell me what you are trying to do or why, wont tell me the equipment you are using is, wont give me output of commands... and insist you be helped. I want your system to work, and work great... but I am not fighting you for information. | 15:36 |
dr_willis | !info opencv | 15:36 |
ubottu | Package opencv does not exist in quantal | 15:36 |
dr_willis | !find opencv | 15:37 |
ubottu | Found: libopencv-calib3d-dev, libopencv-calib3d2.3, libopencv-contrib-dev, libopencv-contrib2.3, libopencv-core-dev, libopencv-core2.3, libopencv-dev, libopencv-features2d-dev, libopencv-features2d2.3, libopencv-flann-dev (and 17 others) http://packages.ubuntu.com/search?keywords=opencv&searchon=names&suite=quantal§ion=all | 15:37 |
vickytomar__ | L3top : i am using Toshiba satellite L305 and i need to reset my driver coz my X window hangs whenever i tries to create/delete any file from home folder | 15:38 |
chaplata | Hello: dell c840 10.4 lts and a pcmcia card for wi fi - just run trough all the troubleshooting steps from the help menu in the ubuntu itself. I do not intend to upgrade, because everything is perfect. i think when i was installing it i put a ranodm network configuration for the install, every help will be highly appreciated | 15:38 |
=== gaben is now known as blazemore | ||
L3top | vickytomar__: What are you trying to delete from your home folder... what is the output of lspci -nn | grep VGA what is the output of grep "vesa" /etc/X11/xorg.conf | 15:39 |
L3top | vickytomar__: I doubt your system lock is related to X btw in this case. | 15:40 |
dr_willis | chaplata: err.. whats the actual problem? | 15:40 |
L3top | vickytomar__: you are making a diagnosis and asking for a solution that is not likely applicable to the root problem. | 15:40 |
vickytomar__ | L3top : i am trying to delete any file i created(when the system was working properly) using gedit.. and sending you o/p for those commands in a while. | 15:40 |
chaplata | can not connect wireless\ | 15:41 |
vickytomar__ | L3top : problem is not only with gedit i can't not delete / create file at home through any application X window gets gang and at that moment i can switch b/w VT terminals | 15:42 |
L3top | vickytomar__: I understand your system is locking, it is incredibly unlikely that X is responsible for that lock. | 15:43 |
chaplata | __>dr willis do you have any clue | 15:43 |
vickytomar__ | L3top : one more thing after my pc gets ganged then i need a restart and after restarting again i can see the file i was trying to create. | 15:43 |
vickytomar__ | L3top : and if i tries to delete then then file gets deteted | 15:44 |
Azzle-Dazzle | guys im back ! how can i make a fresh install of Lubuntu without a dvd disc or usb flash drive ? | 15:44 |
Captain_Claw | Hi, can someone help me with a ubuntu 12.04 q? | 15:44 |
blazemore | What's the question Captain_Claw | 15:44 |
L3top | vickytomar__: MUCH more likely that something is hozed with a /bin or /sbin directory... the fs sounds screwy. I do not what ganged is... and you are going to have to try a little harder on your sentence structure. I am sure you are better at English than I am in your native language... but I do not understand a lot of what you mean. | 15:45 |
chaplata | >><Azzle-Dazzle> you can do the netboot | 15:45 |
Captain_Claw | blazemore: in the panel, when i open a new firefox window, it uses the same icon .. how do i get it to use a separate icon? | 15:45 |
FilipeMaia | Hi. Is there a package with nvcc? | 15:45 |
Azzle-Dazzle | UNetbootin ? | 15:46 |
poseidon | I'm using the vpn client built into ubuntu to connect to a vpn; however, it doesn't resolve dns once connected | 15:46 |
blazemore | Captain_Claw: Sorry that's just Unity, it does what it does and you can't change it | 15:46 |
vickytomar__ | L3top : oh! sorry my mistake that is hanged | 15:46 |
=== seednode_ is now known as Seednode | ||
poseidon | When I connect to the same vpn on windows, dns resolves | 15:46 |
Azzle-Dazzle | Ive tried but during the install its just handing on detecting filesystems, I configured it exactly liked i did with ubuntu live cd | 15:46 |
poseidon | any suggestions for troubleshooting? | 15:46 |
bazhang | File nvcc found in cmake-data, libboost1.49-dev, libboost1.50-dev, robot-player-doc FilipeMaia | 15:46 |
blazemore | poseidon: What DNS server do you have set? | 15:46 |
chaplata | <Azzle-Dazzle> you download a netbootable edition so called network boot - you need a cable connection and unfortunately some cd or 35mb free on a flashdrive | 15:47 |
crazydip | is there a way to change the order of scopes in a lens (in unity's dash)? | 15:47 |
poseidon | blazemore: is there a place to set them in the vpn? | 15:47 |
L3top | vickytomar__: hung... and no problem... I just want to understand clearer. Yes... you will want to make this happen (again the video driver is not going to be responsible for this) and then reboot and look at /var/log/syslog or dmesg.log to see what is causing the crash. | 15:47 |
FilipeMaia | I tried apt-get install nvidia-cuda-toolkit but I get "Package nvidia-cuda-toolkit is not available, but is referred to by another package." | 15:47 |
Azzle-Dazzle | chaplata - will my external hdd do the job ? | 15:47 |
chaplata | how can you reset completetly the network settings - zero, nada, niente on 10.4 | 15:47 |
chaplata | <Azzle-Dazzle> yes should be capable | 15:48 |
Azzle-Dazzle | ok Ill look into it now | 15:48 |
L3top | !info boinc-nvidia-cuda | 15:48 |
ubottu | boinc-nvidia-cuda (source: boinc): metapackage for CUDA-savvy BOINC client and manager. In component multiverse, is optional. Version 7.0.27+dfsg-5 (quantal), package size 14 kB, installed size 107 kB | 15:48 |
vickytomar__ | L3top : :) ok | 15:48 |
alexis_ | hello | 15:48 |
alexis_ | ubuntu 12.10 is a fast os ? | 15:48 |
MonkeyDust | alexis_ i'm happy with it | 15:49 |
Bombo | is there a htop package in ubuntu? i tried apt-get install htop but that doesn't seem to exist, is it called differently? | 15:49 |
alexis_ | good | 15:49 |
chaplata | <azzle-dazzle> http://cdimage.ubuntu.com/netboot/12.04/ | 15:49 |
MonkeyDust | alexis_ if you want benchmarks, visit phoronix.com | 15:49 |
jrib | Bombo: it's htop | 15:49 |
blazemore | Bombo: htop is in main - try running a sudo apt-get update | 15:49 |
MonkeyDust | alexis_ keep it in the channel, please | 15:50 |
chaplata | i need some complete network reset command | 15:50 |
alexis_ | ubuntu 12.10 is fast like mint 13 ? | 15:51 |
tboat | hey any server gurus around? | 15:51 |
MonkeyDust | tboat there's also #ubuntu-server | 15:52 |
Bombo | jrib blazemore: i did update first, but then i get 'E: Unable to locate package htop' | 15:52 |
tboat | thank you will head there :) | 15:52 |
bobweaver | Is there anyone hear that is using 12.10 and is using it on a older computer like a pentM | 15:52 |
jrib | Bombo: pastebin output of your « sudo apt-get update » and the contents of your /etc/apt/sources.list | 15:52 |
jrib | bobweaver: ask your actual question please | 15:52 |
blazemore | bobweaver: Bad idea - there's no 2d support for Unity in 12.10 | 15:52 |
chaplata | i need a reset of all known network settings on my ubuntu, can someone help me here | 15:53 |
dr_willis | lubuntu for older hardware | 15:53 |
alexis_ | monkeydust: my laptop is dell -intel Pentium ubuntu 12.10 is good for me ? | 15:53 |
bobweaver | blazemore, correct I have a older computer and it will not boot at all Whete is this LLVM stuff ? | 15:53 |
FilipeMaia | What's the correct way to upgrade from 12.04 to 12.10? | 15:54 |
jrib | !notes | FilipeMaia | 15:54 |
ubottu | FilipeMaia: Ubuntu 12.10 (Quantal Quetzal) release notes can be found here http://ubuntu.com/getubuntu/releasenotes/12.10 | 15:54 |
jrib | FilipeMaia: the release notes explain | 15:54 |
bobweaver | tries all the grub stuff till I was blue in the face and still can not get this thing to boot up | 15:54 |
MonkeyDust | alexis_ i'm not familiar with dell, i'm no help | 15:54 |
FilipeMaia | ok, thanks | 15:54 |
bobweaver | tried * | 15:54 |
dr_willis | Captain_Claw: ask in the channel plwase | 15:54 |
Bombo | jrib: http://paste.ubuntu.com/1297806/ | 15:55 |
bobweaver | So I guess the Question: is HOW to start LLVM ? | 15:55 |
jrib | chaplata: maybe you should explain why you want to do that (ask the channel) | 15:55 |
alexis_ | i need t instal a fast os | 15:55 |
FilipeMaia | The release notes assume a graphical interface. I only have a command line | 15:55 |
alexis_ | ubuntu 12.10 is a fast os ? | 15:55 |
bazhang | !lubuntu > alexis_ | 15:55 |
ubottu | alexis_, please see my private message | 15:55 |
Captain_Claw | dr_willis: Okay .. When I open a new firefox window, it uses the same icon. Any way to get it to use a separate icon? | 15:55 |
bobweaver | just worked on one of the older cpu (older then on I am talking about) though it was slow it atleast still worked | 15:55 |
jrib | Bombo: htop is in universe. You'll need to enable the universe repository | 15:55 |
jrib | !repos | Bombo | 15:55 |
ubottu | Bombo: The packages in Ubuntu are divided into several sections. More information at https://help.ubuntu.com/community/Repositories and http://www.ubuntu.com/project/about-ubuntu/components - See https://wiki.ubuntu.com/RecommendedSources for the recommended way to set up your repositories | 15:55 |
chaplata | >jrib i want to connect to wi fi but it doesn't work i mean the status bar is showing a connection, but i ping and i open ffox and it still doesnt show any comnection | 15:56 |
FilipeMaia | jrib: How can I do it from the command line? Do I just manually change /etc/apt/sources.list and then update and upgrade? | 15:56 |
dr_willis | Captain_Claw: you mean 2 firefox icons on the left side panel? | 15:56 |
bobweaver | So Am I right in thinking that anything over 4 years old is not going to boot ? ] | 15:56 |
drx_ | picture folder directory unmounted how i can mount it back? | 15:56 |
bobweaver | 12. 10 | 15:56 |
jrib | FilipeMaia: no. See the release notes (server section) | 15:56 |
Captain_Claw | dr_willis: yeah :) | 15:56 |
dr_willis | bobweaver: for older hardware try lubuntu | 15:56 |
bobweaver | dr_willis, I do not like lxde, I like unity. any other ideas ? | 15:57 |
dr_willis | Captain_Claw: as far as i know you dont. | 15:57 |
mbeierl | bobweaver, xubuntu? | 15:57 |
jpg | Does anyone have info on 12.10 for PowerPC? | 15:57 |
Captain_Claw | hmm :( | 15:57 |
dr_willis | bobweaver: whats your exact system specs | 15:57 |
jrib | !ppc | jpg | 15:58 |
ubottu | jpg: PowerPC. Formerly used by Apple for the Macintosh line of computers. Variants are now used in popular gaming consoles. PPC was a fully supported Ubuntu architecture up to and including edgy. It is now a community port, see https://wiki.ubuntu.com/PowerPCFAQ | 15:58 |
FilipeMaia | jrib: it tells me no new release found, but i'm still running 12.04 | 15:58 |
jrib | FilipeMaia: what tells you? What did you do? | 15:58 |
FilipeMaia | jrib: I did do-release-upgrade | 15:58 |
FilipeMaia | jrib: No new release found | 15:58 |
bobweaver | mbeierl, again I like unity. dr_willis it is a dell d610 with a pent M and 1 gig of ram | 15:58 |
drx_ | i'm new to ubuntu picture folder directory unmounted how i can mount it back? | 15:58 |
mbeierl | bobweaver, I use ubuntustudio as a variant (as I use it for audio), and it seems to avoid a lot of the compisiting desktop in favour of processing power | 15:58 |
mbeierl | bobweaver, but I cannot help with unity, just putting alternatives out there | 15:59 |
jrib | FilipeMaia: edit /etc/update-manager/release-upgrades . By default LTS releases will only look for upgrades to other LTS releases | 15:59 |
=== jacob_ is now known as Guest30935 | ||
bobweaver | mbeierl, what DE is that using ? | 15:59 |
dr_willis | bobweaver: try thr 12.04 lts with unity2d | 15:59 |
bobweaver | xcfe ?? | 15:59 |
mbeierl | bobweaver, xfce | 15:59 |
FilipeMaia | jrib: thanks | 15:59 |
bobweaver | dr_willis, For real though any computer that is over 5 years old is not going to run Ubuntu 12.10 ? | 16:00 |
mbeierl | bobweaver, I second dr_willis suggestion for unity2d on older hw | 16:00 |
jrib | bobweaver: 12.10 isn't the issue; unity 3d is :) | 16:00 |
bobweaver | mbeierl, I could change libunity and dee and everything to make a unity 2d ? for 12.10 ? | 16:01 |
cnf | what's the best way to remap capslock to control in unity? | 16:01 |
bobweaver | I tried that and it worked but crashy crah crah crah | 16:01 |
Bombo | jrib: worked, thx :) | 16:01 |
jrib | cnf: should be some options in keyboard preferences | 16:01 |
jrib | Bombo: no problem | 16:01 |
bobweaver | s|crah|crash | 16:01 |
cnf | jrib: indeed, there is | 16:02 |
cnf | thanks | 16:02 |
mbeierl | bobweaver, I have not started to play with 12.10 yet, so I don't know how well unity2d works there, sorry. Looks like unity is starting to draw a line in the sand about hardware, I'd say | 16:03 |
jrib | cnf: if you're a vim user, let me plug https://github.com/alols/xcape | 16:03 |
cnf | jrib: i'll have a look at it later | 16:03 |
mbeierl | bobweaver, Isn't unity2d a desktop log in option? Or a meta-package | 16:04 |
vickytomar__ | L3top : i made my Pc hung and now i can see the log file to what to do next | 16:04 |
mbeierl | bobweaver, I don't think you would need to change libunity by hand - there's a greeter option for it - or there was in 12.04... | 16:05 |
L3top | Look through those huge logs for obvious errors, panics... | 16:05 |
bobweaver | mbeierl, If you instead attempt to wrest The pistol from the hand Then I would not be able to Equate my life with sand | 16:05 |
=== alinmear is now known as alin|mobile | ||
bobweaver | mbeierl, there is no unity 2d because libunity will not work | 16:05 |
islandmonkey | bobweaver: Lolwut ^^ | 16:05 |
bobweaver | islandmonkey, it was about drawing the line in the sand | 16:06 |
ebisinep | how do i do a dreamscene on ubuntu | 16:06 |
dr_willis | http://www.omgubuntu.co.uk/2012/08/unity-2d-removed-from-ubuntu-12-10 | 16:06 |
bobweaver | thanks dr_willis | 16:07 |
chaplata | how do you reset on an enduser distribution or on any distro the network settings of the computer - the same way for exmple when you use the repair option on windows - i have my statusbar is showing that i am connected to the wi fi but there is no traffic | 16:07 |
islandmonkey | ebisinep: What's that? | 16:07 |
islandmonkey | Oh he's laft | 16:07 |
cnf | hmm, how do install custom fonts? | 16:08 |
dr_willis | bobweaver: tried basic tests like pinging your router and dns servers? | 16:08 |
vickytomar__ | L3top : i can't see any thing ... i don't know how to check that what you are asking for | 16:08 |
islandmonkey | cnf: Just click on the font you wish to install | 16:08 |
Odd-rationale | cnf: you should be able to double click a ttf file | 16:08 |
mbeierl | bobweaver, so I am getting confused then with what has changed in 12.10. As mentioned, unfortunately, I don't have it yet, so I cannot confirm the existence of a working 2d | 16:08 |
cnf | hmm, cool | 16:08 |
ex0a | i just upgraded to 12.10 and i'm getting: Path `/boot/grub' is not readable by GRUB on boot. Installation is impossible. Aborting. | 16:08 |
dr_willis | oops that was for chap | 16:08 |
frosty | int aaa(char *s, char *t) { | 16:08 |
frosty | for ( ; *s == *t; s++, t++) | 16:08 |
frosty | if (*s == '\0' ) | 16:08 |
frosty | return 0; | 16:08 |
frosty | return *s - *t;int aaa(char *s, char *t) { | 16:08 |
FloodBot1 | frosty: Please don't flood; use http://paste.ubuntu.com to paste; don't use Enter as punctuation. | 16:08 |
frosty | for ( ; *s == *t; s++, t++) | 16:08 |
mbeierl | bobweaver, oh: http://askubuntu.com/questions/134346/why-is-unity-2d-being-discontinued | 16:09 |
alexis_ | guyz | 16:09 |
mbeierl | bobweaver, I should do a little reading before spewing off about 2d. Apparently it is really gone, gone, gone from 12.10 and I cannot help there at all | 16:09 |
alexis_ | ubuntu 12.10 is fast OS ? | 16:09 |
cnf | hmm | 16:09 |
vickytomar__ | L3top : i can't see any thing there in logs ... i don't know how to check that what you are asking for | 16:09 |
cnf | install failed | 16:09 |
islandmonkey | alexis_: It depends what computer you have | 16:10 |
jpds | alexis_: Install it and see? | 16:10 |
=== `mOOse` is now known as m00se | ||
wstearns | can you still copy the ttf into a .fonts directory in your home? | 16:10 |
bobweaver | Seems to me that they fired there QT person that is it that is the only reason for the switch. Not to pay for the Unity 2d | 16:10 |
dr_willis | alexis_: yes... happy now? | 16:10 |
dr_willis | wstearns: yes | 16:10 |
wstearns | then that should work for cnf | 16:10 |
wstearns | That's how I've always handled fonts. :-) | 16:10 |
bobweaver | so I know that it is GONE for good that cool. But HOW DO I start LLVM ? | 16:11 |
vickytomar__ | any one please help --my X-window gets hung whenever i tries to create/delete file from Home folder. | 16:11 |
dr_willis | wstearns: thats what the font installer does. | 16:11 |
wstearns | dr_willis, they needed an app for that? | 16:11 |
bobweaver | I will ask in #ubuntu-unity | 16:11 |
vickytomar__ | any one please help --my X-window gets hung whenever i tries to create/delete file from Home folder. | 16:11 |
dr_willis | bobweaver: if your system had the right specs and dtivers it would use it. | 16:11 |
cnf | wstearns: k, it's only one of the font files | 16:11 |
ex0a | anyone know what causes this after upgrade to 12.10?: Path `/boot/grub' is not readable by GRUB on boot. Installation is impossible. Aborting. | 16:11 |
cnf | the rest seems to work | 16:12 |
opcode0 | ubuntu is now shareware? O_O | 16:12 |
islandmonkey | !patience | vickytomar__ | 16:12 |
ubottu | vickytomar__: Don't feel ignored and repeat your question quickly; if nobody knows your answer, nobody will answer you. While you wait, try searching https://help.ubuntu.com or http://ubuntuforums.org or http://askubuntu.com/ | 16:12 |
wstearns | cnf, could be something with the file then. Copy it and then see if it appears in a dropdown. | 16:12 |
cnf | now to find why my zsh config gives me strange color escape codes | 16:12 |
islandmonkey | opcode0: No it isn't | 16:12 |
dr_willis | vickytomar__: sounds more like a hardware issue with the hd. | 16:12 |
mbeierl | bobweaver, I'm following this with interest. good luck! | 16:12 |
bobweaver | thanks mbeierl | 16:12 |
vickytomar__ | dr_wilis : hd is working fine i can delete and create file at other directories like my data partition | 16:13 |
damnthingwontwor | ok, well i didnt take anyones advice and decided to try unetbootin again, but its still stuck, someone here must have used it before ? | 16:13 |
bobweaver | mbeierl, kinda makes you think. what is going to run on arm ect ? | 16:13 |
dr_willis | vickytomar__: monitor dmesg logs for errors. | 16:13 |
=== damnthingwontwor is now known as aaron | ||
vickytomar__ | dr_willis : even from ~/Download or ~/Documents | 16:13 |
vickytomar__ | dr_willis : i am with logs but don't know how to read them | 16:14 |
=== aaron is now known as Guest54477 | ||
islandmonkey | damnthingwontwor: What's still stuck? | 16:14 |
islandmonkey | aaron: What's still stuck? | 16:14 |
dr_willis | io error is showing hd or fileststem issues vickytomar__ | 16:14 |
Azzle-Dazzle | sorry, got banned for guest name lol, yeah its still stuck, i dont know why tho. | 16:15 |
soee | guys any idea why kernel update always stops here: update-initramfs: Generating /boot/initrd.img-3.5.0-18-generic ? | 16:15 |
mbeierl | bobweaver, I really don't know. I've been playing with the raspberry pi and using a debian image there. | 16:16 |
vickytomar__ | dr_willis : if i post that portion of log file to pastbin could you please see that for me | 16:16 |
islandmonkey | Azzle-Dazzle: What's still stuck? | 16:16 |
Azzle-Dazzle | the lubuntu install, which is being installed via UNetbootin | 16:17 |
islandmonkey | Azzle-Dazzle: You mean by that that you used UNetbootin to make a live USB of Ubuntu and install from there? | 16:18 |
illovae | avelldiroll: :0 | 16:19 |
Azzle-Dazzle | yes, only i didnt have usb drive so i chose hard disk, which i assume is my hard drive ? lol.... anyway it asked me to reboot and select unetbootin from the bootloader menu, which im now in,,, using live version trying to install | 16:19 |
jester122 | Hello. Could anybody help me with upstart script? Here is it: http://dpaste.org/RwTOw/ It fails on line 11 with "can't cd to" error. What could be wrong? | 16:19 |
dangerousdave | did this uninstall? http://pastie.org/5098916 | 16:19 |
islandmonkey | Azzle-Dazzle: You can't install it while it's on your HDD. I did that when I was a Linux noob about 14 months ago and I was confused why the install wouldn't run | 16:20 |
Kakarot0 | IdleOne: | 16:20 |
IdleOne | Kakarot0: ? | 16:20 |
vickytomar__ | dr_willis : there nothing like io error the two line of error i can see only after making my pc hung | 16:20 |
vickytomar__ | dr_willis :Oct 22 21:17:16 vicky-Satellite-L305 kernel: [ 1469.972908] sd 6:0:0:0: [sdb] Test WP failed, assume Write Enabled | 16:20 |
islandmonkey | Azzle-Dazzle: You need to have it on some sort of external media | 16:20 |
Azzle-Dazzle | wouldnt it have loaded on to my external drive ? | 16:21 |
vickytomar__ | Oct 22 21:17:16 vicky-Satellite-L305 kernel: [ 1469.977544] sd 6:0:0:0: [sdb] Asking for cache data failed | 16:21 |
illovae | avelldiroll: ok wrong channel, let me retry... | 16:21 |
L3top | jester122: try http://dpaste.org/ADRYm/ | 16:21 |
Azzle-Dazzle | the only option in the unetbootin menu was hard disk and the partition "/" it would not let me select any other | 16:22 |
vickytomar__ | dr_willis : [sdb] Test Wp failded , assume Write Enabled | 16:22 |
vickytomar__ | [sdb]Asking for cache data failed . what does these messages means. | 16:22 |
islandmonkey | Azzle-Dazzle: Hold on, let me install UNetbootin and have a look (ain't used it in a long time) | 16:22 |
Azzle-Dazzle | islandmonkey - thank you :) ive also had an idea lol, if i just copy the lubuntu.iso file onto the root of my external drive, couldnt i select it from the boot menu and install that way ?? | 16:23 |
islandmonkey | Azzle-Dazzle: Nope | 16:24 |
L3top | vickytomar__: sudo fdisk -l and: mount in a pastebin please | 16:24 |
=== vincent is now known as Guest53400 | ||
pradeep | how cn i install vmware workstation on ubuntu12.10? | 16:24 |
Azzle-Dazzle | islandmonkey - it wasnt that great of an idea then was it lol | 16:24 |
islandmonkey | Azzle-Dazzle: Not really | 16:24 |
pradeep | ?? | 16:25 |
islandmonkey | Azzle-Dazzle: Well all I can say is that is your external HDD plugged in properly? Also make sure it's empty | 16:25 |
Azzle-Dazzle | islandmonkey - if i cant do it, i will just do another fresh install of ubuntu 12.04 as i already have that burned to disc, | 16:25 |
Azzle-Dazzle | islandmonkey - its not empty, its got about 200gb left (outta 1tb) | 16:25 |
islandmonkey | pradeep: ???? | 16:25 |
islandmonkey | Azzle-Dazzle: It needs to be empty | 16:26 |
pradeep | vmware waorkstation installation process | 16:26 |
vickytomar__ | L3top : http://pastebin.com/e2RyCuMb | 16:26 |
islandmonkey | Azzle-Dazzle: Looks like you will have to do a clean install of 12.04 | 16:27 |
Azzle-Dazzle | islandmonkey - theres no way i can format it, my entire life is on there lol, ill just have to go back to ubuntu | 16:27 |
pradeep | ?? | 16:27 |
vickytomar__ | L3top : http://pastebin.com/e2RyCuMb | 16:27 |
pradeep | tc guys byee...:) | 16:28 |
dr_willis | you caan setup grub2 on a external hd to boot an iso file. ;) | 16:31 |
L3top | vickytomar__: how did you end up with 6 partitions /boot /media/important and /home on the latter three, partitions 3 and 4 off physical sector? I would boot to a live disk and fsck partitions 1,2,4 and 5 (eg fsck /dev/sda4). | 16:31 |
dr_willis | but he left.. | 16:31 |
L3top | I have to go vickytomar__ bb in a couple hours. | 16:32 |
molqr | hey all ! a program launches a window which i then have to manually right click on and then select Always on Top .. can i not do this automatically from the command line when i issue the command | 16:33 |
=== Youri is now known as YBook | ||
dr_willis | molqr: compiz/ccsm has a feature called 'window rules' where you can set that based on windoow title, or other ids | 16:34 |
dr_willis | molqr: ive not seen a generic cli way to do that in ages. i seem to recall years back some 'kstart' command for kde that did it | 16:34 |
OerHeks | long time ago i used devilspie for that. | 16:35 |
molqr | dr_willis: ok. | 16:35 |
dr_willis | i like to set the file copy dialog to be always on top and 'sticky' so i can keep an eye on it | 16:35 |
OerHeks | !devilspie | 16:35 |
ubottu | devilspie is a tool that can perform actions on windows when running applications. Actions include resizing, positioning, pinning etc. Use the package gdevilspie to configure from GUI, or see usage information at https://help.ubuntu.com/community/Devilspie | 16:35 |
molqr | OerHeks: thanks. | 16:36 |
dr_willis | the ccsm rules and devilapie have similer feature sets ;) | 16:36 |
OerHeks | dr_willis, ah thnx, i used it for forcing an app to open on 2nd screen. | 16:38 |
* dr_willis recalls the old days of buttons in the title for sticky/alwaysontop/pinned/ ;) | 16:38 | |
ex0a | i just upgraded to 12.10 and i'm getting: Path `/boot/grub' is not readable by GRUB on boot. Installation is impossible. Aborting. | 16:39 |
ex0a | nothing i've read has helped fix it | 16:39 |
piero | Hi! I had an radeon 6xxx series but now I deactived so I'm using my intel igp (core i5 3500) but unity isn't starting.. everything I have is a wallpaper. lightdm starts normally.. where can I start to investigate it? thanks | 16:39 |
ex0a | i'm stuck with no bootloader atm | 16:39 |
=== blazemore is now known as gaben | ||
=== gaben is now known as kim-jong | ||
=== kim-jong is now known as pomf | ||
Thegarden | Anyone knows about fail2ban ? com pv | 16:43 |
ex0a | what about it Thegarden ? | 16:43 |
dr_willis | Thegarden: many sites and docs on using it. | 16:43 |
=== dpac is now known as dpac|away | ||
Walker__ | bwaha, im bored | 16:45 |
=== matt_ is now known as Guest58796 | ||
wilee-nilee | ex0a, This a standard msdos setup or a uefi? | 16:47 |
ex0a | wilee-nilee: what? | 16:48 |
wilee-nilee | ex0a, Partition types, if it is a standard set up I would chroot in a deal with it that way. It is a bit difficult to tell from your description if the upgrade was sucessful at all. | 16:50 |
wilee-nilee | a=and | 16:50 |
researcher123 | how to upgrade BIOS in Ubuntu 12.10? | 16:50 |
=== Thegarden is now known as edve | ||
wilee-nilee | researcher123, I doubt you can a disc is allowed for most modern bios to boot from. | 16:51 |
researcher123 | ok | 16:51 |
ex0a | wilee-nilee: i'm dual booted win7 and ubuntu, using fakeraid which has complicated the install of grub to the point of breaking | 16:51 |
ex0a | wilee-nilee: http://paste.ubuntu.com/1297935/ | 16:52 |
wilee-nilee | ex0a, Ah raid I know nothing there. | 16:52 |
gatuus | I'm human!! | 16:52 |
jrib | gatuus: exactly what a bot would say. | 16:52 |
gatuus | hahaha | 16:52 |
cdunlap | Is this a good channel to ask about install issues with 64-bit 12.10? | 16:53 |
iceroot | cdunlap: yes | 16:53 |
wollowizard | hi, do you know how I can mount (with udisks) a device to a specific direcory? | 16:54 |
cdunlap | I just blew away a 32-bit 12.04 and installed 64-bit 12.10 but now when I get to the login prompt, it won't take me to a DE, just back to the login Prompt. If I type the wrong password, it tells me so I don't think it is a passwd issues | 16:54 |
=== kubuntu is now known as Guest98988 | ||
wollowizard | Is there something like this? /usr/bin/udisks --mount /dev/sda2 /media/alfredo/WindowsPartition | 16:55 |
=== seednode_ is now known as Seednode | ||
dr_willis | cdunlap: x or compiz is crashing back to the login screen | 16:55 |
=== xubuntu is now known as Guest7058 | ||
dr_willis | wollowizard: you could just make a fstab entry. or a soft link | 16:56 |
cdunlap | dr_willis: ok, through the guest acct I used the updater to make sure the packages were up to date. it did do some compiz updates. | 16:56 |
dr_willis | cdunlap: whats your video chipset? | 16:57 |
dr_willis | cdunlap: has the user ever logged in? tried the conole? | 16:58 |
dr_willis | console | 16:58 |
cdunlap | dr_willis: I haven't tried the console yet | 16:58 |
cdunlap | just the guest acct is the only thing that will get to the DE | 16:58 |
three18ti | !patience | 16:59 |
ubottu | Don't feel ignored and repeat your question quickly; if nobody knows your answer, nobody will answer you. While you wait, try searching https://help.ubuntu.com or http://ubuntuforums.org or http://askubuntu.com/ | 16:59 |
=== [1]MarcelT3 is now known as MarcelT3 | ||
cdunlap | dr_willis: I can get a terminal window in the guest acct | 17:00 |
dr_willis | wonder how the guestsettings differ.. | 17:00 |
quint | take a look at this image http://imageshack.us/scaled/landing/51/screenshot121022125354p.png why is it that it shows a different size value with du -h for something that is exactly identical in size? very confused. could someone shed some light on that? | 17:00 |
dr_willis | try to 'su yourusername' | 17:00 |
=== florin is now known as Guest64458 | ||
=== pomf is now known as blazemore | ||
cdunlap | dr_willis: says not permitted | 17:01 |
dr_willis | id login at the console. check who owns your. .Xauthority file | 17:02 |
dr_willis | perhaps just rename it. and try again | 17:02 |
cdunlap | dr_willis: ok | 17:02 |
dr_willis | another test.. make a new user. | 17:03 |
dr_willis | sudo adduser billgates | 17:03 |
=== szal_ is now known as szal | ||
dr_willis | and see if he works | 17:03 |
=== felipeal` is now known as felipealmeida | ||
cdunlap | just get not permitted from the guest. | 17:04 |
cdunlap | dr_willis: trying to get the console right now | 17:04 |
diverdude | Hello, when i do ifconfig i can i see i have eth0, great. However when i go to the network connection applet there is no wired connections. How can i find my wired connection in the network connections applet? | 17:04 |
TJ- | diverdude: Network Manager won't manage any interface you have specifically configured in /etc/network/interfaces | 17:04 |
dr_willis | from the console logins.. not the guest account | 17:04 |
jrib | quint: I don't know. If you want some insight, you could read the source for du | 17:05 |
cdunlap | ok, It just let me login with my useracct from the console | 17:05 |
=== korben is now known as Guest95563 | ||
diverdude | TJ-: mm ok... when i look in that file it says among other things auto eth0. is that the reason? | 17:05 |
quint | jrib: i figured it out, different block size. | 17:05 |
quint | for some reason.. | 17:06 |
OerHeks | cdunlap, see the solution of Actionparsnip >>> https://answers.launchpad.net/ubuntu/+source/lightdm/+question/197479 | 17:06 |
diverdude | TJ-: it also says iface eth0 inet dhcp | 17:06 |
jrib | quint: ah. -b is not what I thought it was :) | 17:06 |
cdunlap | Oerheks: I will look at it now, thanks | 17:06 |
OerHeks | !rootirc | caj | 17:07 |
ubottu | caj: It's not technically our business, but we'd like to tell you that IRC'ing as root is a Very Bad Idea (tm). After all, doing anything as root when root is not needed is bad, and especially bad with software that connects to the Internet. | 17:07 |
TJ- | quint: The files may be sparse or otherwise have additional blocks. See "man du" and "--apparent-size" | 17:07 |
bibi23 | hi, does anyone know where I can find apparmor logs? thx | 17:08 |
quint | TJ-: that's got it | 17:08 |
quint | TJ-: thank you! | 17:08 |
TJ- | quint: You're welcome | 17:08 |
diverdude | TJ-: also it says on almost every command i make "Unable to resolve host pelletserver" and its very slow...what does that mean? | 17:08 |
dr_willis | diverdude: your pcs name iis 'pelletserver' ? | 17:09 |
TJ- | diverdude: Any reference with "auto" or "iface" to an interface will cause N.M. to ignore it since it doesn't want to undo something you've done manually. To have N.M. manage the interface, simply comment out or otherwise remove those sections that configure the interface, from /etc/network/interfaces | 17:09 |
diverdude | dr_willis: yes i believe it is | 17:10 |
diverdude | TJ-: ok, thx i did that now and im restarting | 17:10 |
TJ- | diverdude: "unable to resolve...." is caused when the local name of the PC isn't in "/etc/hosts" - it ought to resolve to 127.0.1.1 | 17:10 |
diverdude | TJ-: ahh ok...i might have accedently deleted that | 17:11 |
cdunlap | dr_willis/Oerheks: no go on that last suggestion. I think it has to do with the /home partition. It was encrypted on the 12.04 install and I didn't format it on the 12.10 installation | 17:11 |
cdunlap | Could that be it? | 17:11 |
teskew | with 12.10, after installing konsole, it won't launch from either the launcher or through unity super menu. anyone else experiencing this? | 17:11 |
bravo1 | ciao | 17:11 |
TJ- | diverdude: On this PC the "/etc/hosts" starts off ... "127.0.0.1localhost" then " 127.0.1.1XPSm1530" where /etc/hostname contains "XPSm1530" | 17:12 |
JasonF | I'm having issues with locking my screen in Ubuntu 12.10 -- logs are here: https://gist.github.com/16546cac43cea2af3d92 | 17:12 |
teskew | nevermind. if someone is having trouble with Konsole launching, see bug #1068451 | 17:14 |
cdavis | Now that I see how Firefox integrates with Unity after clickign install I would like to remove it, how does one do that? | 17:14 |
ubottu | Launchpad bug 1068451 in konsole (Ubuntu) "konsole app is not accessible via Unity" [Medium,Fix committed] https://launchpad.net/bugs/1068451 | 17:14 |
wad | Locking the screen... doesn't. How should this work? I can't seem to find any screen savers either. | 17:15 |
JasonF | wad: https://gist.github.com/16546cac43cea2af3d92 Having the same issue. | 17:15 |
wad | ok | 17:15 |
JasonF | wad: gnome-screensaver-command -a works for me though | 17:15 |
JasonF | wad: as a workaround, I'm using that, and aliased it to "lock" in my profile. | 17:16 |
wad | ok | 17:16 |
* wad looks | 17:16 | |
wad | I don't have a screensaver installed. | 17:16 |
JasonF | wad: that's in the gnome-screensaver package, I believe. Was already installed on my system. | 17:16 |
wad | Where did you get that gnome screensaver? | 17:16 |
wollowizard | ok, I've created an entry in /etc/fstab but I get the following error: mount: only root can mount /dev/sda2 on /media/WindowsPartition/ Instead if I remove the line, it gets mounted well in "Mounted /org/freedesktop/UDisks/devices/sda2 at /media/WindowsPartition" | 17:16 |
soee | can someone help me with fixind this problem: http://pastebin.com/hVD6mWee ? | 17:16 |
JasonF | wad: Version: 3.6.0-0ubuntu1 | 17:17 |
JasonF | wad: for Ubuntu 12.10 | 17:17 |
wad | Found it. Installing. Thanks. | 17:17 |
wad | I'm on 12.04 LTS. | 17:17 |
JasonF | I just did the update to 12.10 | 17:17 |
wollowizard | if I'm mounting to the same place, why do I need to be root if I specify the place in fstab? | 17:17 |
JasonF | but it's possible yours is broken just because you didn't have the screensaver installed. | 17:17 |
wad | I'm going to hold off on that update for now. | 17:17 |
wad | Yeah, that's probably it. | 17:17 |
wad | Where do you configure the screensaver? | 17:18 |
JasonF | wollowizard: the "user" option in fstab allows users to mount that given filesystem. | 17:18 |
JasonF | wad: I dunno. I always manually choose "lock" | 17:18 |
OWNSyouAll | Hey i upgraded to 12.10 and on unity when i try to change the date/clock in the top right to show the "Date and month" i get "Date format not supported" | 17:18 |
Azzle-Dazzle | back again :) The ubuntu install finished, But theres some weird glitch before the log in screen appears, I believe its to do with my graphics driver, It wont let me activate the recommended one, its gives me this error http://pastebin.com/d9waA8vf | 17:20 |
wollowizard | JasonF, I tried, but I get this: Mount failed: Error mounting: mount exited with exit code 1: helper failed with: | 17:20 |
wollowizard | Unprivileged user can not mount NTFS block devices using the external FUSE | 17:20 |
wollowizard | library. Either mount the volume as root, or rebuild NTFS-3G with integrated | 17:20 |
wollowizard | FUSE support and make it setuid root. Please see more information at | 17:20 |
wollowizard | http://tuxera.com/community/ntfs-3g-faq/#unprivileged | 17:20 |
FloodBot1 | wollowizard: Please don't flood; use http://paste.ubuntu.com to paste; don't use Enter as punctuation. | 17:20 |
TJ- | Azzle-Dazzle: "DEBUG: dpkg: error: dpkg status database is locked by another process" ... suggests you have Software Center or some other package manager open at the same time | 17:21 |
Azzle-Dazzle | One sec, Need to reboot to finish updating, It might work after this :) | 17:21 |
=== lizzin is now known as Guest30807 | ||
p0is0n | hey guys | 17:23 |
leeping | Hi there, I'm running into a strange error message when trying to boot my new box using an Ubuntu LiveCD. I photographed my screen and it's here: https://dl.dropbox.com/u/5381783/ata.JPG | 17:23 |
p0is0n | does anyone have a few mins to give me a hand with some network settings on ubuntu server? | 17:23 |
JasonF | wollowizard: ah. FUSE is a special case. I'm not sure how to solve that for you. | 17:23 |
leeping | I suspect a hardware problem (particularly with the motherboard). Has anyone experienced this before? | 17:25 |
=== Bruno is now known as Guest27739 | ||
bekks | leeping: Looks like a broken harddisk. | 17:25 |
morf | hi, quick question... it seems to me my keyring password is changing itself... is there some bug you maybe heard about? | 17:26 |
leeping | bekks, it appears that way except i've disconnected all of my hard drives | 17:26 |
leeping | I've also disabled the ATA controllers in the BIOS (to the best of my ability) | 17:26 |
riverless | Hi, is there anyone here that have successive run a vmware workstation + load vm at boot? | 17:26 |
riverless | I try this to getting handled by the rc.local script or thru init.d script, without success | 17:27 |
wilee-nilee | The works as addressing the channel with a question on your problem. riverless morf | 17:27 |
wilee-nilee | channel* | 17:27 |
riverless | wilee-nilee: huh? | 17:28 |
morf | don't understand him either | 17:28 |
wilee-nilee | morf, I have not seen a bug as you describe it myself. | 17:28 |
morf | thx... :/ | 17:28 |
wilee-nilee | !help | 17:28 |
ubottu | Please don't ask to ask a question, simply ask the question (all on ONE line and in the channel, so that others can read and follow it easily). If anyone knows the answer they will most likely reply. :-) See also !patience | 17:28 |
Polaco | hello guys, i need some help with ppa repositories and authenticated packages. Am i in the correct channel? | 17:28 |
wilee-nilee | trying to not sick the bot on you. ;) | 17:29 |
=== Polaco is now known as polaco | ||
riverless | wilee-nilee: but it was a question? I dont get my vmware vm to load. | 17:29 |
p0is0n | i've just changed from ubuntu desktop 12.04 to server 12.10, i can't access my machine by hostname, only IP. This worked fine on my old install. Can anyone help? | 17:29 |
TJ- | leeping: I'd suspect that ata2 is the secondary ATA port on the primary ATA controller. And I'd guess that the DVD drive is attached to it | 17:29 |
wilee-nilee | riverless, We were typing at the same time your second question worked I did not see it as I posted. | 17:30 |
leeping | TJ-, would you suggest that I try attaching the DVD drive to another ATA port and seeing if the error message is any different? | 17:30 |
p0is0n | leeping, also make sure it's jumpered correctly as master/slave/cs ? | 17:30 |
=== newbie is now known as Guest12826 | ||
leeping | p0is0n, oh! That's a good point, it's been such a long time that I completely neglected that. | 17:31 |
TJ- | leeping: Is it an IDE drive on a PATA interface? If so, I'd double-check the jumpers | 17:31 |
p0is0n | leeping, especially if you removed/changed disks, it might have altered the expected behaviour | 17:32 |
=== Cantide is now known as Frankencleshihi | ||
teamcoltra|mba | Is there a way to make the "tail" command "live"? ie it shows me the last 5 errors in my error log, and when a new error is generated it shows me that without me having to re-run the command | 17:32 |
=== Frankencleshihi is now known as Cantide | ||
TJ- | teamcolt-: yes, just pipe content | 17:33 |
leeping | TJ-, it's brand new hardware, and connected to the motherboard via a SATA cable. | 17:33 |
TJ- | teamcolt-: oh sorry, I misread. Use the "-f" switch which 'follows' the file | 17:33 |
riverless | wilee-nilee: okey.. :) | 17:33 |
TJ- | leeping: OK, so SATA drives... can you confirm that ata2 is the DVD drive? no other drives connected? | 17:34 |
riverless | Is there anywhere I could see if the shell script I try to run have been touched while booting? My /var/log/messages don't say anything about this? | 17:34 |
polaco | hello guys, i need some help with pap repositories and authenticated packages. The context: I'm automating part of my infrastructure with puppet and need to install postgresql-9.2. Postgresql-9.2 is not yet in the official repos, so i have to add the ppa ppa:pitti/postgresql to have postgresql-9.2. The question: after adding the ppa via add-apt-repository, i get the "The following packages cannot be authenticated" error, but the apt-key list command returns | 17:34 |
polaco | that the key was added. Whats wrong? | 17:34 |
leeping | TJ-, no other drives are connected. | 17:35 |
p0is0n | i've just installed server version 12.10, but i can't access my machine by hostname, only IP. This worked fine on my old install of desktop 12.04. Can anyone help with this? I'm a bit of a ubuntu noob. | 17:35 |
wilee-nilee | polaco, YOu need to add the key was it in the error | 17:35 |
leeping | TJ-, I will try to connect the DVD drive to a different port and see if the error comes out different. | 17:36 |
polaco | if u need to simulate my error, run the commands: sudo apt-add-repository -y ppa:pitti/postgresql and then sudo /usr/bin/apt-get -q -y -o DPkg::Options::=--force-confold install postgresql-9.2 | 17:36 |
azzledazzle | whats the command to make swap space ? I cant remember from my last install. | 17:36 |
polaco | the error doesn't show any key | 17:36 |
wilee-nilee | polaco, That command adds the key, are you sure the PPA is set for your release. | 17:37 |
maveze | Hi, anyone know where is a channel for .deb packing? | 17:37 |
jrib | maveze: #ubuntu-packaging and #ubuntu-motu | 17:38 |
maveze | jrib, thanks | 17:38 |
fairuz_ | I have this error when installing AMD driver. [Error] Kernel Module : Failed to build fglrx-8.982 with DKMS. Any pointers? Thanks | 17:38 |
wilee-nilee | polaco, I have not seen a -y used is all | 17:38 |
=== florin is now known as Guest49179 | ||
wilee-nilee | polaco, http://www.ubuntuupdates.org/ppa/pitti_postgresql | 17:39 |
=== Youri is now known as YBook | ||
polaco | sorry about the missing -y | 17:40 |
polaco | i borrowed the command from my shell and tested without the -y | 17:40 |
=== Guest95563 is now known as korben | ||
polaco | but puppet sends a -y | 17:40 |
polaco | i ll check the link, thx @wilee-nilee | 17:41 |
=== morphis is now known as morphis|away | ||
leeping | TJ-, the system successfully booted up using a USB key. :) Thank you | 17:42 |
TJ- | leeping: So is it a bad DVD drive? | 17:42 |
hank_625 | the best video ever haha :D http://youtu.be/-lREclAupn0 | 17:43 |
xangua | !ot | hank_625 | 17:43 |
ubottu | hank_625: #ubuntu is the Ubuntu support channel, for all Ubuntu-related support questions. Please use #ubuntu-offtopic for other topics (though our !guidelines apply there too). Thanks! | 17:43 |
richwestcoast | hey guys, i have ubuntu server running on VirtaulBox. Would it be possible to supply the virtual ubuntu internet, and use it as my gateway? | 17:43 |
bekks | Sure. | 17:44 |
richwestcoast | at. the. same. time. | 17:44 |
richwestcoast | lol | 17:44 |
richwestcoast | in my head it shouldnt work | 17:44 |
bekks | In my reality, it works. :) | 17:44 |
richwestcoast | hmm | 17:44 |
pandragon | anybody worked with ubuntu precise, linksys wusb11, and a nook simple touch? | 17:45 |
p0is0n | last try.. i've just installed server version 12.10, but i can't access my machine by hostname, only IP. This worked fine on my old install of desktop 12.04. Can anyone help with this? I'm a bit of a ubuntu noob. | 17:45 |
TJ- | richwestcoast: Sure, that works. You configure the VM to forward everything to the gateway router, and give all network devices the IP of the VM as their default gateway | 17:46 |
bekks | p0is0n: Please define "cant access my machine" - from where do you try to connect how? | 17:46 |
=== qos is now known as qos|away | ||
p0is0n | bekks, i can't ping or ssh by hostname. I can do both by IP just fine. | 17:46 |
p0is0n | Would installing samba help advertise my hostname correctly? | 17:47 |
michealPW | Finally got my custom Unity Launchers for SuperTux2 working, heehe | 17:47 |
bekks | p0is0n: From _where_ do you try to ping and ssh? | 17:47 |
michealPW | And for the supertux2-editor | 17:47 |
bekks | no, samba will not help. | 17:47 |
michealPW | These .desktop files are neato | 17:47 |
p0is0n | from my windows machine, using cmd or putty | 17:47 |
richwestcoast | TJ- thanks, im gonna have another look at this and let you know if i get stuck | 17:47 |
richwestcoast | ;) thanks for the assurance it will work | 17:47 |
bekks | p0is0n: did you check the hosts file on your windows, to reflect the correct name and IP of your Ubuntu box? | 17:47 |
phear | hey whats up everone | 17:48 |
diverdude | Hello. i have written a server program in c++ which i would like to be able to boot on startup. however i need it to boot after all network connections have been established. Its a very simple application requiring no input parameters. How do i set this up ? | 17:48 |
TJ- | richwestcoast: rather obviously, the VM's host has to be booted first :p | 17:48 |
ajacom | how do i specify the mounting location when using udisks = | 17:48 |
phear | you can use fluxbox | 17:48 |
ajacom | ? | 17:48 |
jrib | !upstart | diverdude | 17:48 |
phear | you can use fluxbox then edit .fluxbox/startup | 17:48 |
ubottu | diverdude: Upstart is meant to replace the old Sys V Init system with an event-driven init model. For more information please see: http://upstart.ubuntu.com/ | 17:48 |
p0is0n | bekks, I never had to do this on my previous installation (12.04 desktop) it always just worked with the hostname. it is the same static IP though, could the hosts file still contain the old data? | 17:48 |
phear | yes and upstart or cron work well | 17:48 |
bekks | p0is0n: Sure. | 17:48 |
richwestcoast | yeah, its running through my windows pc... so i was wondering if i surrender up my internet on my windows machine. the Vm will lose its connection and yea... | 17:49 |
bekks | p0is0n: Thats why I said "check" ;) | 17:49 |
phear | Anyone in the Lafayette, LA area? just moved here and looking for dev/server work | 17:49 |
TJ- | diverdude: Add an upstart config file in /etc/init/ that has the prerequisite "start on started networking" or similar | 17:49 |
p0is0n | bekks, nothing in there but the defaults for localhost. | 17:50 |
p0is0n | I know I can add it, but I am not sure why it worked before. | 17:50 |
diverdude | TJ-: can you show me an example of what this looks if i need to start the file /home/bdi/proj/server ? | 17:51 |
bekks | p0is0n: So how o you expect your Windows pc to know the IP of the name of your Ubuntu box? | 17:51 |
bekks | p0is0n: Did you check the DNS settings and host entries on your router? | 17:51 |
p0is0n | bekks, my router has the correct IP and hostname listed in DHCP. I just changed from 12.04 to 12.10 tonight, and it used to work from any machine in the house | 17:52 |
p0is0n | bekks, never had to configure anything last time. | 17:53 |
diverdude | TJ-: ? | 17:53 |
TJ- | diverdude: Look at the existing upstart config files in /etc/init/ ... e.g. /etc/init/mountall-net.conf or search for all files using a similar construct: "grep 'start.* net' /etc/init/*" | 17:53 |
michealPW | The Minimize/Restore animation on KDE 4.9.2 seems sluggish and choppy :\ | 17:53 |
gibcat | how do i make gnome-terminal always start with options --window --maximize ? location of the config please. | 17:53 |
michealPW | Is it for anyone else? I've got the latest fglrx drivers and direct rendering working fine.. Is this just how Plasma-desktop is, or?? | 17:54 |
michealPW | KWin, I guess. | 17:54 |
bekks | p0is0n: I doubt that, strongly. The DHCP entries do not enforce correct DNS resolve entries. As a quick fix, configure the windows hosts file with the correct ebtry for your Ubuntu box. | 17:54 |
michealPW | gibcat: Did you check in the default profile settings? Open a gnome-terminal and it's in your File | Edit options. Edit -> Profile, or something. I'm pretty sure you can set the starting window size/position in there. | 17:54 |
p0is0n | bekks, thanks. I can do that for now. it honestly did used to work with the hostname on every machine previously and i hadn't changed a single network setting. this is why i'm a bit confused. I was using desktop version before and I had samba installed, I could connect to my machine to access files by hostname too. | 17:56 |
=== eric is now known as Guest95438 | ||
diverdude | TJ-: ahh nice... i can see it says PID=$(status mountall 2>/dev/null | sed -e '/start\/running,/{s/.*,[^0-9]*//;q};d')... would i need that for just starting /home/bdi/proj/server ? | 17:56 |
polaco | wilee-nilee: I'm using ubuntu 12.04 (precise) fro adding the pitti repository, and it doest support ubuntu precise. I don't know whats wrong | 17:57 |
polaco | wilee-nilee: *it does support | 17:57 |
alket | what is that | 17:58 |
alket | How to add facebook on unity ? Web apps ? | 17:58 |
gibcat | I did check the Edit|Profile. You can set geometry, but I need set the startup window maximized | 17:59 |
x_link | Hi | 17:59 |
x_link | I really need some help. | 17:59 |
ajacom | I'm getting pretty slow performance with an intel i7-3770k . should i install special drivers or anything? how can i check if everything's ok in that department ? | 17:59 |
x_link | I just got a account on ww.viaplay.se, so I can watch some movies an series. | 17:59 |
wilee-nilee | polaco, Here is the deb to download but you are on your own I have only led you here. http://www.ubuntuupdates.org/package/pitti_postgresql/precise/main/base/postgresql-9.2 | 17:59 |
diverdude | TJ-: ? i am in doubt about these 2 lines: PID=$(status mountall 2>/dev/null | sed -e '/start\/running,/{s/.*,[^0-9]*//;q};d') | 17:59 |
diverdude | [ -n "$PID" ] && kill -USR1 $PID || true | 17:59 |
bekks | ajacom: PRetty slow performance of what? | 17:59 |
ajacom | bekks, applications | 18:00 |
x_link | But when I try to watch a video I just get "Install Miscrosoft Silverlight". So I install it via Firefox and Firefox is restarted after that. But when I try to play a movie/serie after that it doesn't work. | 18:00 |
x_link | It still says "Install Microsoft Silverlight" | 18:00 |
ajacom | bekks, micro-freezes and such | 18:00 |
x_link | I'm using 8.04. Could somebody please help me with this? | 18:00 |
bekks | ajacom: And how do you measure apps being slow? | 18:00 |
wilee-nilee | polaco, In other words I have no idea what your doing, I just found a package. | 18:00 |
bekks | ajacom: And what are micro-freezes? | 18:00 |
polaco | wilee-nilee: hahahahha ok ok | 18:00 |
SolarisBoy | something like microwaves probably | 18:01 |
ajacom | bekks, micro means small and sporadic. a freeze means that the computer is apparently not responding, similar to being "frozen" | 18:01 |
polaco | wilee-nilee: I'm adding the repository and trying to install postgres, but apt-get complains that the package is unathenticated | 18:01 |
wilee-nilee | polaco, hehe you know how it is I don't want to brick you, that is your responsibility. ;) | 18:01 |
polaco | wilee-nilee: no problem! :) | 18:01 |
bekks | ajacom: Well. I do know the meaning of both words pretty well, but I have no clue what do you mean by "microfreeze" in terms of information technology. | 18:01 |
slackerboy | is there any command line tool for imagebin as "pastebinit" ? | 18:02 |
p0is0n | ajacom, im using a 2600k no 'microfreezes' | 18:02 |
ajacom | bekks, than that should be enough to explain my problem | 18:02 |
bekks | ajacom: So how do you measure apps being slow? Compared to which other result? | 18:02 |
fbbdev | Please I need help!!! How can I force unity to use the llvmpipe driver? I'm using ubuntu 12.10 | 18:02 |
ajacom | p0is0n, did you install drivers or other software ? | 18:02 |
ajacom | bekks, compared to windows 8 which i have in dual boot | 18:03 |
p0is0n | ajacom, cpu doesn't need drivers. what graphics card do you have.. | 18:03 |
bekks | ajacom: So you are comparing apples and bananas. | 18:03 |
ajacom | p0is0n, integrated. Intel HD Graphics 4000 | 18:03 |
bekks | ajacom: There are no similarities between these OS, so you cant compare the performance of totally different apps. | 18:04 |
fbbdev | Any hint? | 18:04 |
TJ- | diverdude: The particulars of the commands inside the upstart file will be specific to each daemon, those will be things you need to choose depending on how your daemon runs. There's lots of documentation and examples of creating minimal upstart files, especially on the upstart web-site | 18:05 |
p0is0n | ajacom, you may need drivers for your onboard graphics. im using an ati card so can't compare. I suspect that is likely your issue. | 18:05 |
p0is0n | bekks, i seem to have fixed my issue :) | 18:05 |
ajacom | thanks p0is0n | 18:05 |
Froward | fbbdev: did you google | 18:05 |
fbbdev | Froward: yes I did | 18:06 |
bekks | ajacom: I have a i5-2500 too, with Intel graphics too. No special driver needed or even available. | 18:06 |
ajacom | bekks, i'll hang on then. see if I keep getting these | 18:07 |
slackerboy | !pastebin | 18:07 |
ubottu | For posting multi-line texts into the channel, please use http://paste.ubuntu.com | To post !screenshots use http://imagebin.org/?page=add | !pastebinit to paste directly from command line | Make sure you give us the URL for your paste - see also the channel topic. | 18:07 |
bipul | !tor | 18:07 |
ubottu | Tor is a program to route connections through several servers for anonymity. It is in Ubuntu's repositories, but the Tor Project recommends using their Tor packages due to past issues with Ubuntu's. For setup info, see option (2) of https://www.torproject.org/docs/debian.html.en | To use Tor on freenode, see !tor-sasl | 18:07 |
Froward | fbbdev: http://askubuntu.com/questions/197771/how-do-i-enable-llvmpipe-rendering-in-unity | 18:08 |
bipul | !tor -sasl | 18:08 |
=== fernando is now known as Guest19546 | ||
bipul | !tor-sasl | 18:08 |
ubottu | freenode blocks connections from Tor users on its regular servers. Users registered with nickserv can connect to freenode's Tor hidden service instead; see http://freenode.net/irc_servers.shtml#tor for instructions. For help, ask in #freenode. | 18:08 |
bipul | !ns-2 | 18:09 |
bazhang | /msg ubottu bipul | 18:09 |
=== polaco_ is now known as polaco | ||
L3top | !info i965-va-driver | bekks this is not a kernel module but a lib which tends to bring awesomesauce, esp if you are using a vaapi capable ap... but a general enhancement. | 18:10 |
ubottu | bekks this is not a kernel module but a lib which tends to bring awesomesauce, esp if you are using a vaapi capable ap... but a general enhancement.: i965-va-driver (source: intel-vaapi-driver): VAAPI driver for Intel G45 & HD Graphics family. In component universe, is extra. Version 1.0.17-1 (quantal), package size 141 kB, installed size 675 kB | 18:10 |
fbbdev | Froward: thank you! | 18:10 |
bipul | bazhang, ? | 18:10 |
bekks | L3top: What do you talk about? | 18:10 |
bazhang | bipul, /msg ubottu | 18:10 |
bazhang | bipul, dont keep using the !commands | 18:11 |
bipul | bazhang, ok :) | 18:11 |
L3top | bekks: for intel gpus. It tends to solve weirdness issues, and provides vaapi support... that is all. It is a nice compliment. | 18:11 |
bekks | L3top: I have no issues with my intel graphics. :) | 18:11 |
bekks | L3top: But thanks for that hint. | 18:11 |
L3top | bekks: all it was intended to be ;) | 18:12 |
=== branant_ is now known as branant | ||
azzledazzle | whats the default desktop that comes with ubuntu 12.04? | 18:14 |
wilee-nilee | unity | 18:14 |
tottto-drummond | azzldazzle unity | 18:14 |
azzledazzle | thanks wilee-nilee :D | 18:15 |
ajacom | frozen again | 18:15 |
ajacom | while exploring files | 18:15 |
ASHER1 | Hey i want please explain how i change options in DNS? | 18:15 |
wilee-nilee | azzledazzle, It is on top of gnome 3 though as a plugin in compiz. | 18:15 |
uzver | ajacom, nvidia card & nouveau& | 18:16 |
uzver | ajacom, *? | 18:16 |
ajacom | uzver, not that i know of | 18:16 |
azzledazzle | ive no idea, its a fresh install and i havent modded it yet - wilee-nilee | 18:16 |
masturbation | hello, im trying to unlock the second core of my sepron 140 but when i anable the second core in bios i cant start ubuntu because it shows up a kernel panic message. | 18:17 |
=== adrianrly is now known as adrianrly|OFF | ||
ASHER1 | ? | 18:18 |
ajacom | Error opening file '/media/SHARED/Dropbox/FileZilla/bookmarks.xml': Input/output error | 18:18 |
richwestcoast | can i share none pppoe internet connections? | 18:18 |
dr_willis | !ics | 18:19 |
ubottu | If you want to share the internet connection of your Ubuntu machine with other machines in the network see https://help.ubuntu.com/community/Internet/ConnectionSharing | 18:19 |
* wilee-nilee thats a nick that gets an instant ignore, lol | 18:19 | |
richwestcoast | but does the connection have to be pppoe? | 18:19 |
=== adrianrly|OFF is now known as adrianrly | ||
dr_willis | i imagine you can share most eny connection.... | 18:19 |
richwestcoast | hmm ok | 18:19 |
richwestcoast | ty | 18:19 |
dr_willis | why would it be limited to just pppoe | 18:20 |
richwestcoast | im from afrika man i dont know | 18:20 |
ASHER1 | someone please can help me how i fix dns? | 18:20 |
emptythevoid | Does anyone have DeVeDe installed on 12.10? If so, could you pm me? I need some help with a possible bug | 18:20 |
richwestcoast | all we had over there is adsl/pppoe | 18:20 |
slackerboy | is there any command line tool for imagebin as "pastebinit" ? | 18:20 |
L3top | ajacom: I would run fsck on that partition (must not be mounted). | 18:20 |
dr_willis | emptythevoid: ive used it befor. but not on a pc right now | 18:20 |
wilee-nilee | ASHER1, Share your problem in the form of a question. | 18:21 |
ASHER1 | i want to know what i need to do in DNS | 18:21 |
ajacom | fsck: fsck.exfat: not found // fsck: error 2 while executing fsck.exfat for /dev/sda3 | 18:21 |
dr_willis | ASHER1: try setting a new dns server like googles. 8.8.8.8 ? | 18:21 |
L3top | ajacom: this is a fat32 drive? | 18:22 |
L3top | er partition | 18:22 |
ajacom | L3top, exfat | 18:22 |
dr_willis | ajacom: try 'fsck.<tab>' | 18:22 |
dr_willis | to show all fsck commands | 18:22 |
ajacom | dr_jesus, fsck.cramfs fsck.ext3 fsck.ext4dev fsck.msdos fsck.vfat | 18:22 |
ajacom | fsck.ext2 fsck.ext4 fsck.minix fsck.nfs | 18:22 |
ajacom | bah. dr_willis | 18:22 |
rolling2k | !ops rolling2k is here | 18:23 |
ASHER1 | i have 4 computer and i put address 10.0.0.4 and try to up from ip later and i no see address web | 18:23 |
dr_willis | ASHER1: and 10.0.0.4 is? | 18:23 |
ASHER1 | yes | 18:24 |
ajacom | should i just try to convert that partition to ntfs instead of that annoying exfat which has just given me trouble ? | 18:24 |
diverdude | TJ-: so basically all i need to do is insert exec /home/bdi/projects/mybinary and thats it? | 18:25 |
masturbation | hello, im trying to unlock the second core of my sepron 140 but when i anable the second core in bios i cant start ubuntu because it shows up a kernel panic message. | 18:28 |
mha | Are any apparmor v2.4 compatibility patches required for modern Ubuntu versions; re: compiling a 3.6 kernel? | 18:29 |
=== z2s8 is now known as Guest17153 | ||
panzersajt | Hy! Is there any way to try out Weston on Ubuntu 12.10 with Nvidia card? | 18:32 |
uzver | panzersajt, with xwayland i think u can | 18:34 |
KiLuMnaTi | anyone here use Mixxx with a dj console on ubuntu 12.10 | 18:37 |
alim | KiLuMnaTi: I do | 18:37 |
tmuxer | clear | 18:37 |
zoopp | Hello, by reading the SMART data of my HDD I can see that there's a bad sector pending relocation. Is there any way to force it to relocate now? | 18:37 |
zoopp | I'm running on a live session | 18:38 |
malkauns | why doesn't ubuntu 12.10 remember my keyboard shortcuts?? | 18:39 |
deadmund | zoopp: I don't think you can explicitly tell it to relocate now. I think the hdd firmware does that (not even the driver) | 18:39 |
dr_willis | its smarter then we are. ;) | 18:39 |
deadmund | zoopp: Why do you want to? | 18:40 |
deadmund | dr_willis: what? Clearly malkauns remembers his shortcuts. I'd say in this case he is smarter than ubuntu | 18:40 |
malkauns | :P | 18:40 |
zoopp | deadmund: I'm trying to move a partition in order to resize another one and when it needs to write on the bad sector it stops with an I/O error. | 18:40 |
constant_change | 1st time user, am I visible | 18:40 |
zoopp | deadmund: Due to this I'm stuck on a live session. | 18:40 |
deadmund | zoopp: I don't think there is any workaround. My advice is to spend your time getting your data off that (failing) hdd | 18:41 |
deadmund | constant_change: yes | 18:41 |
constant_change | tks deadmund | 18:41 |
deadmund | constant_change: wlks | 18:41 |
zoopp | deadmund: I have backed up important data so I don't worry about that. | 18:42 |
KiLuMnaTi | can you connect to ubuntu remotely? is it turned on by default | 18:42 |
slackerboy | !ssh | KiLuMnaTi | 18:43 |
ubottu | KiLuMnaTi: SSH is the Secure SHell protocol, see: https://help.ubuntu.com/community/SSH for client usage. PuTTY is an SSH client for Windows; see: http://www.chiark.greenend.org.uk/~sgtatham/putty/ for it's homepage. See also !scp (Secure CoPy) and !sshd (Secure SHell Daemon) | 18:43 |
deadmund | zoopp: Well then, maybe you can try writing 0's to the hdd using if=/dev/null of=/dev/<hdd number> | 18:43 |
KiLuMnaTi | ubottu is it turned on by default | 18:43 |
deadmund | KiLuMnaTi: connecting TO ubuntu is not set up by default | 18:43 |
ubottu | KiLuMnaTi: I am only a bot, please don't think I'm intelligent :) | 18:43 |
zoopp | deadmund: would that actually help? It will take a lot of time to finish such an operation.. | 18:44 |
akamaus | hi anyone. I've installed kubuntu-12.04 on my laptop and now I'm hearing some periodic noise every ten seconds or so when on battery power. It seems to be hdd related. I remember old talks about ubuntu killing hdd drives because of too agressive default power saving settings. Is it still relevant issue? | 18:44 |
deadmund | zoopp: I have no idea. It's what I would do out of curiosity! | 18:44 |
slackerboy | KiLuMnaTi: you need to install the openssh server package on the machine, you want to access | 18:44 |
zoopp | deadmund: I created a fake partition on the free space with the bad block on it. I'll try running badblocks on that partition. | 18:45 |
deadmund | zoopp: sounds fun. How do you know where the bad spot is? | 18:45 |
zoopp | deadmund: I've tried several times to move another partition on that free space and it always stopped after about 30 GBs of data copying with an I/O error so I guess it must be there. | 18:46 |
dr_willis | akamaus: actually i recall it was ubuntu letting the hds use the hds default settings causing the issue ;) but i dont think its an issue any more | 18:47 |
dr_willis | akamaus: the nosie is from the hd? or the speakers? | 18:47 |
deadmund | zoopp: ahh, isee | 18:47 |
dr_willis | akamaus: there was a powersaveing issue with some intel audio chips that caused them to 'sleep' then makkke a popping noise when woke up/reactivated | 18:48 |
akamaus | dr_willis, I can't say for sure, but it reminds me hdd headers parking sound a lot. | 18:48 |
akamaus | dr_willis, well, I have an Intel audio and video integrated chips on this laptop | 18:49 |
=== JoFo_ is now known as JoFo | ||
dr_willis | akamaus: i dont even know if the intel audio is still a known issue. you could try a live cd. see if it makes the noise. that way the hd is not in use. ;) | 18:51 |
=== alin|mobile is now known as alinmear | ||
dr_willis | get a ssd ;) best investment i ever did. | 18:51 |
valnour | dr_willis: AGREED. Love my SSD. | 18:52 |
akamaus | dr_willis, I've just remembered of hddparm -B 254. Clicks seems to have stopped. | 18:52 |
akamaus | dr_willis, I will ! But I want it to be a free decision, not result of a hdd failure :) | 18:53 |
dr_willis | ive not had to toy with hddparm in years. ;) | 18:53 |
diverdude | is this correct? ./my_program 2> stderror_file 1> stdoutput_file ? | 18:53 |
dr_willis | isent it &2 and &1 ? | 18:54 |
diverdude | ah ok | 18:54 |
dr_willis | or am my bash skills getting old | 18:54 |
=== furian is now known as shantorn | ||
diverdude | is this correct then :) ? ./my_program &2> stderror_file &1> stdoutput_file | 18:54 |
theadmin | diverdude: No, the first one was right, lol | 18:54 |
dr_willis | try it and see ;) | 18:54 |
theadmin | dr_willis: You use & when you direct stuff *to* this stream, not from it | 18:54 |
dr_willis | i forget whenyou use the &# thing | 18:54 |
akamaus | diverdude, I believe your first variant was correct | 18:55 |
diverdude | Can i start an upstart job with this command then? ./my_program 2> stderror_file 1> stdoutput_file | 18:55 |
dr_willis | when in doubt try it out! | 18:55 |
jrib | dr_willis: 2>&1 | 18:55 |
trism | diverdude: upstart jobs should already log to /var/log/upstart/jobname.log | 18:56 |
akamaus | you need pounds only if you're redirecting to another descriptor | 18:56 |
diverdude | trism: ahhh by default? so i dont need to specify it? | 18:56 |
trism | diverdude: as long as you don't set console none I think | 18:56 |
diverdude | trism: hmm i dont even know how to set that? | 18:57 |
KiLuMnaTi | can you connect to remote desktop in ubuntu 12.10 is it turned on by default? | 18:57 |
Dako300 | I have a website in apache2 running on Ubuntu (Inside of a VM) and I can access it through the Windows host via the internal IP address (192.168.1.200) but I cannot access it from my external IP address. The router is port forwarded and I think it is an apache problem | 18:57 |
trism | diverdude: it is a directive in the upstart .conf file (see /etc/init/ssh.conf for instance, since sshd can leak fds) | 18:57 |
diverdude | trism: so does upstart both log std err and std out automatically? | 18:57 |
SolarisBoy | can you connect to the port (external) successfully on the web port? have you checked apache logs error/access? | 18:58 |
trism | diverdude: I believe it should be both, though easiest way as dr_willis mentions is to try it and see | 18:58 |
Dako300 | IT never spits out any errors except the FQDN which I changed to localhost bu ti will check | 18:59 |
FLeiXiuS | Why would a live cd report mountall: failed? | 18:59 |
=== jd is now known as Guest81229 | ||
SolarisBoy | maybe check access log if you think apache is denying it. | 18:59 |
FLeiXiuS | During bootup. | 18:59 |
SolarisBoy | but definately check that you can get to the port from outside. | 18:59 |
theadmin | FLeiXiuS: I'd say it's a bad image, did you verify SHA1 or MD5-sums? | 18:59 |
SolarisBoy | you may need to adjust the apache acl to allow traffic as well | 19:00 |
FLeiXiuS | theadmin, It's squashfs image I'm working on based off the a legit ISO | 19:00 |
akamaus | wow, "smartctl -A /dev/sda | grep Load_Cycle" shows 30000 for me, and the laptop is just a month old. | 19:00 |
Dako300 | taht may be it because I got SSH working on it perfectly and I followed the same system for apache | 19:00 |
diverdude | trism: mmm yeah but its difficult because i am unsure as of how to setup my upstart job...i have read the getting started...but im still in doubt. I have this so far: http://bin.cakephp.org/view/884477686 but then i got in doubt about how to setup logging | 19:00 |
eligio | buona sera! | 19:01 |
eligio | !list | 19:01 |
ubottu | eligio: No warez here! This is not a file sharing channel (or network); read the channel topic. If you're looking for information about me, type « /msg ubottu !bot ». If you're looking for a channel, see « /msg ubottu !alis ». | 19:01 |
trism | diverdude: that should be it, I believe it defaults to 'console log' (on 12.04+ that is, upstart logging didn't exist earlier), I'm messing with it now to verify | 19:01 |
Dako300 | where exactly are the logs for apache? | 19:02 |
diverdude | trism: will it automatically create the log file? | 19:02 |
trism | diverdude: it will, if there is output, otherwise it doesn't create one | 19:02 |
SolarisBoy | Dako300: they generally end up in /var/log/apache2 on ubuntu by default | 19:02 |
SolarisBoy | Dako300: but it is user defined. i would check /var/log/apache2 first | 19:03 |
Dako300 | okay | 19:03 |
penguinhead | hello | 19:03 |
diverdude | trism: ah ok...and if my application for example segfaults, will it somehow block the system | 19:03 |
diverdude | trism: or will it just die quietly | 19:03 |
=== alan_ is now known as Guest55139 | ||
crak | hi all | 19:05 |
crak | i need help with my apache2 fcgi suexec | 19:05 |
trism | diverdude: should just die quietly unless you specify respawn (I'm certainly no upstart expert though) | 19:05 |
Dako300 | i am searching for external IP addresses and all I see are internal ones in access,log and error.log | 19:06 |
crak | after upagrading to 12.10 my apache2 does not execute .php any more | 19:06 |
diverdude | trism: ah ok...its possible to upstart with respawn in a loop? | 19:06 |
Dako300 | did you install libmodphp5 | 19:06 |
crak | is anyone here that has experiences with apache2 and suexec fcgi? | 19:06 |
crak | Dako300: no | 19:06 |
Dako300 | or something lke that | 19:06 |
crak | Dako300: i do not want to use libmodphp5 | 19:06 |
Dako300 | that may be the problem | 19:06 |
crak | Dako300: i want to use libapache2-mod-fcgid | 19:07 |
Dako300 | to my knowledge that is the only way to execute PHP in apache2 | 19:07 |
crak | Dako300: no | 19:07 |
Dako300 | oh well then didnt you have to activate it in apache2 (a2enmod) | 19:07 |
trism | diverdude: yes, seems like the default respawn count is 10 within a 5 second period and otherwise dies (if you add the respawn directive that is), see the cookbook, which has quite a bit of info http://upstart.ubuntu.com/cookbook/#respawn | 19:08 |
crak | Dako300: u mean i need to install it even if i don't want to use it? | 19:08 |
tzanger | good afternon. Are there any known issues installing 12.10 x86-64 on either systems with nvidia graphics or systems with large (24GB) amounts of memory? I cannot get it to install, ubi-partitioner barfs and that's as far as I can get. The drive I'm installing to is a standard 320G SATA drive, and 10.04 works just fine on this system | 19:08 |
Dako300 | a2enmod comes with apache2 | 19:08 |
crak | Dako300: i know | 19:09 |
tzanger | before I give up and just install Debian I thought I should ask here | 19:09 |
Dako300 | then what is it? | 19:09 |
penguinhead | tzanger MD5 checksum? | 19:09 |
penguinhead | did u check? | 19:09 |
diverdude | trism: hmmm no log has been created :( I dont think my process was executed | 19:09 |
tzanger | penguinhead: yeah, the MD5 is correct | 19:09 |
=== Youri is now known as YBook | ||
actionParsnip | tzanger: 24Gb RAM isn't a lot | 19:10 |
Dako300 | I may have found my problem. Does apache2 need port 80 open with TCP/UDP or just UDP | 19:10 |
FLeiXiuS | Dako300, http is TCP 80. | 19:10 |
trism | diverdude: how about if you start it with: sudo start jobname;, not sure how much help I'd be debugging your start on conditions | 19:10 |
actionParsnip | Dako300: HTTP uses TCP | 19:10 |
penguinhead | try removing RAM to 4G | 19:10 |
penguinhead | then installing, then replacing RAM | 19:11 |
FLeiXiuS | Dako300, HTTPS = TCP 443 | 19:11 |
tzanger | actionParsnip: that and nvidia are the only things I can think of that are unusual | 19:11 |
Dako300 | I may have fixed it | 19:11 |
actionParsnip | tzanger: the 304 driver is now in the repos, should make the chip run ok | 19:11 |
kostkon | tzanger, but you said that your problem occurs during the partitioning process? | 19:11 |
penguinhead | what about upgrading from 10.04? | 19:12 |
tzanger | kostkon: well at the screen after I click "continue" | 19:12 |
tzanger | it waits a long time then says ubi-partman fails with error code 10. I flip to a console and can see the drive there just fine | 19:12 |
tzanger | penguinhead: different HDD | 19:12 |
kostkon | tzanger, I don't think it's a nvidia or ram problem | 19:13 |
=== alinmear is now known as alin|mobile | ||
kruptos | I upgraded to Ubunutu 12.10 automatically from 12.04 and I've lost sound. Can someone help me out? | 19:13 |
maxmahem | I'm having a problem upgrading. I'm out of space on /boot. Turns out I have a lot of old kernals there. I go to remove them w/ apt-get purge old-kernal-package but that fails because of an unment dependancy on a different kenrnal package. Fixing that dependancy seems to fail, because I'm out of space on /boot. Suggestions? | 19:13 |
penguinhead | tried installing text mode. i agree with kostkon - neither of those should be the prob | 19:13 |
diverdude | trism: hmm job name is the name of the conffile right? so like gigecamserver is the job name for gigecamserver.conf | 19:13 |
tzanger | kostkon: me either, but as I said, those are the only "unusual" things I can think of. it's a standard i7 system otherwise that runs linux great | 19:13 |
kostkon | tzanger, is the hdd clean? | 19:14 |
=== eixV is now known as EIXv | ||
jrib | maxmahem: try removing the current and a few old ones (leave latest working kernel) | 19:14 |
penguinhead | do a manual partition | 19:14 |
trism | diverdude: yes | 19:14 |
tzanger | kostkon: yep, I dd if=/dev/zero of=/dev/sda bs=512 count=1000 after to make sure it wasn't something goofy there, and when that still failed I manually created a single primary partition | 19:15 |
tzanger | penguinhead: I can't get that far | 19:15 |
tzanger | after you click "Continue" it spins then fails | 19:15 |
maxmahem | jrib: trying to do that, but the apt-get purge is failing because of another kernal dependancy that is unmet. I was hesitant to just outright delete them. | 19:15 |
jrib | maxmahem: yes, I did not mean to delete them manually. Try using dpkg then to remove some old kernels | 19:15 |
=== k1l_ is now known as k1l | ||
diverdude | trism: hmmm im getting unknown job error when i try sudo start gigecamserver | 19:16 |
kostkon | tzanger, are you using a usb stick. i would recommend you to format it and then create again a new live usb. | 19:16 |
penguinhead | tzanger, tried 10.04 on your new HDD, then upgrade? | 19:16 |
tzanger | penguinhead: that can't be a serious suggestion | 19:16 |
diverdude | trism: and i just checked that my conf file has same owner and rights as all the other conf files | 19:17 |
penguinhead | why not? | 19:17 |
KM0201 | seems like a long way to go abou that tzanger ... i'd try the alternate cd | 19:17 |
tzanger | kostkon: yes, tried two different usb sticks, both with usb-creator-gnome and also unetbootin, doesn't seem to be the issue | 19:17 |
KM0201 | penguinhead: kinda like removing the engine to change the oil. | 19:17 |
penguinhead | i had trouble with usb-creator, so i actually did an upgrade from 10.10 | 19:17 |
tzanger | penguinhead: because if they can't get the installer reasonably well done I'm not going to go out of my way to support them | 19:17 |
kostkon | tzanger, can you try with a different hdd? | 19:18 |
penguinhead | running on an old IBM R52 | 19:18 |
tzanger | kostkon: will try that next just in case the hdd is hosed | 19:18 |
kostkon | tzanger, a spare one perhaps, just for testing | 19:18 |
Eagleman | What would be a good value for entropy_avail ? | 19:18 |
KM0201 | why not try the alternate cd? | 19:18 |
tzanger | KM0201: that might happen shortly. | 19:18 |
ejo | Hi all. What controls the background color for program icons in the Unity launcher? | 19:18 |
KM0201 | (assuming you're competent enough to use it, aas it's 100% text based) | 19:18 |
penguinhead | try the alternate CD | 19:18 |
KM0201 | tzanger: why eventually? if the live cd doesn't work for some reason, thats what the alt. cd is for. | 19:19 |
tzanger | KM0201: well I was going to install debian etch, I'm pretty sure of my competency. Been using linux for well over a decade now :-) | 19:19 |
KM0201 | tzanger: then why are you even stressing over this.. just use the alt. cd | 19:19 |
gordonjcp | tzanger: forget unetbootin | 19:19 |
tzanger | KM0201: I redid the usb key again (with usb-creator-kde) and it is working better now | 19:19 |
gordonjcp | tzanger: it basically writes /dev/urandom to the memory stick, as far as I can see | 19:19 |
tzanger | gordonjcp: yeah the unetbootin install fails at syslinux | 19:19 |
tzanger | gordonjcp: haha | 19:20 |
gordonjcp | tzanger: it sure as hell isn't a valid filesystem that I can see | 19:20 |
gordonjcp | tzanger: just dd the iso to a stick, and it'll be fine | 19:20 |
Eagleman | What would be a good value for entropy_avail ? | 19:20 |
eankele | tzanger: My system had an issue with usb sticks. I burned an actual cd and it installed first shot. | 19:20 |
trism | diverdude: that is strange, you could try: sudo initctl reload-configuration; but that shouldn't be necessary since it watches /etc/init/ for changes | 19:20 |
islandmonkey | !patience | Eagleman | 19:20 |
ubottu | Eagleman: Don't feel ignored and repeat your question quickly; if nobody knows your answer, nobody will answer you. While you wait, try searching https://help.ubuntu.com or http://ubuntuforums.org or http://askubuntu.com/ | 19:20 |
ejo | unetbootin worked fine for me when the "system disk creator" from 12.10 was failing | 19:20 |
runtro | I have a working ubuntu latest version, one hard disk with the ubuntu partition and some free space, I want to install some version of windows in the free space. is there an easy way to do this? I did this dual boot in the past many times but always installed windows first | 19:20 |
diverdude | trism: no..same | 19:21 |
gordonjcp | runtro: yes, but be aware that Windows will rather rudely destroy your bootloader | 19:21 |
maxmahem | jrib: hrm dpkg -purge seems to have fixed it, hopefully I haven't borked my dependancies. | 19:21 |
runtro | gordonjcp: yes, of course I want to avoid this | 19:21 |
runtro | gordonjcp: is there a way to achieve this? | 19:22 |
diverdude | trism: i tried restarting also | 19:22 |
jrib | maxmahem: now just do something with apt-get so it can configure your latest kernel (or try dpkg --configure -a) | 19:22 |
gordonjcp | runtro: just reinstall the bootloader | 19:22 |
diverdude | trism: i knew i would have problems with this :/ | 19:22 |
trism | diverdude: ls -l /etc/init/gigecamserver.conf; out of curiosity | 19:22 |
jrib | maxmahem: what did you purge by the way? | 19:22 |
runtro | gordonjcp: 1st install windows, 2nd install bootloader again? | 19:22 |
penguinhead | runtro: https://help.ubuntu.com/community/WindowsDualBoot | 19:23 |
diverdude | trism: that lists /etc/init/gigecamserver.conf | 19:23 |
ejo | To clarify: I see that icons in the Unity Launcher often are .pngs with transparent background, but they show in the launcher bar against a colored background (often orange, green, or blue) that varies from one icon to another. Where can I set that color? | 19:23 |
penguinhead | scroll down, your worries are over | 19:23 |
tzanger | the installer's doing what I'd expect now. Thank you everyone for your help, I do appreciate it. | 19:23 |
maxmahem | jrib: oldest 3 kernals on the disk um... linux-image-3.0.0-14-server | 19:23 |
penguinhead | good luck tzanger! | 19:23 |
jrib | maxmahem: that should be fine | 19:23 |
maxmahem | apt-get install -f seemed to work fine so I think I'm good now. | 19:23 |
maxmahem | now for the do-release upgrade! | 19:23 |
richwestcoast | ok iv followed that internet sharing article on ubuntu website. but its not working :/ just to get something straight. TO fwdd internet, does it have to be a connection by the client ie PPPOA/E ? | 19:23 |
richwestcoast | Authenticated (PPPoA/E) connection. | 19:24 |
gordonjcp | runtro: yup | 19:24 |
AlexPortable | I get this when installing my printer driver: https://paste.nl.eu.org/PFSLjgYv https://paste.nl.eu.org/2t9sTfL0 | 19:24 |
runtro | gordonjcp: thanks | 19:24 |
gordonjcp | richwestcoast: no | 19:24 |
gordonjcp | richwestcoast: not unless you've got it hooked directly to a PPPoA modem | 19:24 |
richwestcoast | its a cable modem | 19:24 |
richwestcoast | and the router makes the connection and assigns ip's with a gateway(the modem's ip) | 19:25 |
diverdude | trism: ahh now i am getting job failed to start instead...thats progress | 19:25 |
gordonjcp | richwestcoast: then the cable modem won't care about PPPoA since it's DOCSIS :-) | 19:25 |
diverdude | trism: can it be seen somewhere why it failed to start | 19:25 |
trism | diverdude: dmesg or /var/log/kern.log | 19:25 |
trism | diverdude: such as [ 9485.026028] init: Failed to spawn gigecamserver main process: unable to execute: No such file or directory | 19:26 |
richwestcoast | iv got my network setup, i can ping the server (which i hope to make the gateway) iv followed their steps for step and it still says (no internet) on that connection | 19:26 |
gordonjcp | richwestcoast: so has the server got an internet connection, that works correctly? | 19:26 |
richwestcoast | yep | 19:26 |
richwestcoast | its assigned by the wireless ip | 19:26 |
richwestcoast | then iv got a virtaul network connected to my win7 | 19:27 |
diverdude | trism: aha it says terminated with status 127 | 19:27 |
diverdude | trism: but no log has been created in /var/log for the job | 19:27 |
richwestcoast | http://justpaste.it/1fxi thats my ifconfig | 19:28 |
richwestcoast | and im ssh'd into the server throuhg eth1 | 19:28 |
=== matt_ is now known as Guest86557 | ||
trism | diverdude: /var/log/upstart/ and it won't write the log until the process writes to stdout/stderr | 19:29 |
diverdude | trism: ahhhhhh ok nice...now i see the log :D and the reason for it to terminate hehehehe | 19:30 |
trism | diverdude: excellent | 19:31 |
runtro | gordonjcp: does ubuntu still use swap space? I had created some space for swap, now in gparted it shows as "filesystem: unknown" | 19:31 |
diverdude | trism: so i need to do a pre-start script block if i need to set environment vars for the binary to use right? | 19:31 |
runtro | does ubuntu still use swap space? I had created some space for swap, now in gparted it shows as "filesystem: unknown" | 19:32 |
richwestcoast | oms how cool is this: http://justpaste.it/3ky | 19:32 |
=== morphis is now known as morphis|away | ||
gordonjcp | runtro: it does, if you set it to ;-) | 19:33 |
nyRednek | runtro, yeah, it still uses swap space, if you set it up | 19:33 |
dr_willis | runtro: normal install uses a swap partition | 19:33 |
dr_willis | or a swap 'file' can be used. | 19:33 |
runtro | gordonjcp: nyRednek dr_willis how can I check if it is indeed using a swap right now | 19:33 |
trism | diverdude: I think you can use env VAR=VALUE, http://upstart.ubuntu.com/cookbook/#environment-variables | 19:33 |
designbybeck | on 12.10 I tried to install my NVIDIA drives.... on reboot I can login but only see the desktop | 19:33 |
runtro | and if it is that partition I see as "filesystem: unknown" | 19:33 |
dr_willis | runtro: try the free and swapon commands | 19:34 |
designbybeck | I dont' know how to fix this | 19:34 |
AlexPortable | I get this when installing my printer driver: https://paste.nl.eu.org/PFSLjgYv https://paste.nl.eu.org/2t9sTfL0 How to solve it? | 19:34 |
dr_willis | !swap | 19:34 |
ubottu | swap is used to move unused programs and data out of main memory to make your system faster. It can also be used as extra memory if you don't have enough. See https://help.ubuntu.com/community/SwapFaq for more info | 19:34 |
diverdude | trism: i see...outside any script block.. a bit counter intuitive...but ok | 19:34 |
designbybeck | I had to do a complete new clean install.... and now this happens I tried to go check in X11 for an xorg file or the like, but don't seem to see anything... Things look different | 19:34 |
dr_willis | i dont think i have a swap partition on this machine anymore. :0 i removed that hdd. | 19:34 |
runtro | dr_willis: I tried top, see this | 19:34 |
runtro | Swap: 4914952k total | 19:34 |
dr_willis | free command gives more details | 19:35 |
designbybeck | can I reset my NVIDIA drives back to default in commandline? | 19:35 |
designbybeck | runtro: try free -m | 19:36 |
runtro | Swap: 4799 0 4799 | 19:36 |
runtro | how can I check if that corresponds to that partition I set up | 19:36 |
AlexPortable | no swap being used | 19:36 |
dr_willis | designbybeck: you can remove them if you wanted to. can the guest user login? try a different desktop/window manager as a test also | 19:36 |
runtro | but it is "defined" | 19:36 |
mikey1234 | For some reason, whenever I try installing the propriatery nvidia drivers on 12.10 (any from the offered ones like nvidia-current or current-updates) the system, upon the next reboot, there are like window borders missing, the unity launcher on the left and the top bar are missing as well, and the resolution is set to 800x600. Does anyone know why this is happening? | 19:37 |
designbybeck | same things happens for the guest dr_willis | 19:37 |
runtro | this means it is available | 19:37 |
dr_willis | designbybeck: could be compiz is failing to get 3d going and exiting. | 19:37 |
runtro | how can i check whether that swap that says there is the partition I created or it is just taking the space from somewhere else | 19:37 |
designbybeck | this is a clean install.... all i did was install the NVIDIA drivers and restart.... it was the "recommended" drivers | 19:37 |
designbybeck | have suggestions dr_willis to turn it off from the commandline | 19:37 |
mikey1234 | designbybeck: Are you by any chance having issues with proprietary nvidia drivers on 12.10? | 19:38 |
designbybeck | yes mikey1234 | 19:38 |
=== MattsTechUK is now known as Matt | ||
penguinhead | dr_willis: how does the swap command work, again? | 19:38 |
designbybeck | you having same problem mikey1234 ? | 19:38 |
dr_willis | swapon -s for summary. ;) | 19:38 |
runtro | penguinhead: swap is not a command | 19:38 |
=== Matt is now known as Guest63072 | ||
dr_willis | swapon -a turn on all... | 19:38 |
dtigue | is anyone here familiar with pyroom? | 19:38 |
dina_ | hello | 19:38 |
mikey1234 | designbybeck: Window borders gone, no launcher on the left, no top bar and res set to 800x600 upon reboot? | 19:39 |
dina_ | I need help to install flash on chromium | 19:39 |
dina_ | :( | 19:39 |
designbybeck | can't see anything mikey1234 | 19:39 |
dtigue | dina_: flash is built in to chrome | 19:39 |
designbybeck | i can right click and see the change background option | 19:39 |
designbybeck | i can press the powerbutton the system and i see the shutdown info | 19:39 |
mikey1234 | designbybeck: Oh, then it's the same issue. | 19:39 |
runtro | dr_willis: is there a way to tell which partition swap is using= | 19:39 |
dtigue | dina_: not sure about chromium though let me check on that | 19:39 |
designbybeck | but pressing AlT or superkey doesn't pull up anything | 19:39 |
designbybeck | it looks zoomed in and a big cursor | 19:39 |
dina_ | ok thank you | 19:40 |
penguinhead | thanks dr_ | 19:40 |
dr_willis | runtro: tried that swapon -a command yet? | 19:40 |
designbybeck | have a solution mikey1234 ? | 19:40 |
dr_willis | or swapon -s | 19:40 |
mikey1234 | designbybeck:You can revert back to nouveau until Nvidia fixes this. | 19:40 |
designbybeck | mikey1234: how do I do that? | 19:40 |
pirx | hello! i have a high (30) load on a server, and cant see much through top/ps whats causing it. the system _is_ indeed slow, and 'ps' tells me that the kernel "migration" threads use a lot of CPU. so i guess that means that there is a lot of processes that need to be moved around. anyone who knows how to further look into this? how possibly to see which threads those are? | 19:40 |
dr_willis | swap is defined in the fstab file also... | 19:40 |
designbybeck | I can't even seem to reboot and get grub to come up!? it is the "tab" key isn't it? | 19:41 |
designbybeck | mikey1234: did you try all the NVIDIA drivers? | 19:41 |
designbybeck | looked to be 3 of them listd | 19:41 |
runtro | dr_willis: seems to have two define | 19:41 |
runtro | d | 19:41 |
mikey1234 | designbybeck: click to change your background, then press the thing on the top to go back to the preferences. then go to sources where you found them in the first place and selece the xorg x server drivers and install them, | 19:41 |
dtigue | dina_: if you type in the address bar 'chrome://plugins' do you see flash listed anywhere on that page ? | 19:42 |
mikey1234 | designbybeck: And yeah, I tried all of proprietary.. no luck. | 19:42 |
designbybeck | AAHhhhh why didn't I think of that!! Thanks mikey1234 | 19:42 |
AlexPortable | I get this when installing my printer driver: https://paste.nl.eu.org/PFSLjgYv https://paste.nl.eu.org/2t9sTfL0 How to solve it? | 19:42 |
designbybeck | so it is a known issue with NVIDIA and has been reported mikey1234 ? | 19:42 |
dr_willis | runtro: you can easially have several swap partitions across different drives. for speed | 19:42 |
mikey1234 | designbybeck: No idea yet. From what I understand no. Someone should report it. | 19:42 |
runtro | dr_willis: I have just one physical drive | 19:43 |
trism | mikey1234: there is bug 1057000 for nvidia-current-updates (but it doesn't seem like as many issues as your having), you could also try x-updates ppa which has 304.60 which is working for me (but nvidia-current which is reverted to 304.43 also works for me) | 19:43 |
ubottu | Launchpad bug 1057000 in xorg-server (Ubuntu) "[Ubuntu 12.04.1/12.10] nVidia drivers 304.51 prevent autohidden Unity launcher from revealing" [High,Triaged] https://launchpad.net/bugs/1057000 | 19:43 |
dr_willis | runtro: or you can have swap files and swap partitions | 19:43 |
runtro | anyway I don't see the partition I had in that swap list | 19:43 |
runtro | so I'll just remove the partition | 19:43 |
Kartagis | what's the ubuntu equivalent to chkconfig in centos? | 19:43 |
dina_ | dtigue: Yes shockwave Flash version 10.1 | 19:43 |
designbybeck | trism: mikey1234 what cards do you have? | 19:43 |
Nono923 | Hi, I have trouble with Ubuntu on my netbook. The nvidia drivers do not work with it's ion card, and I can't do anything on it because of that. | 19:43 |
dtigue | dina_: and flash still doesn't work for you ? | 19:44 |
mikey1234 | trism: Thanks, I'll check if that's the bug I'm having. I'm using nouveau atm and it;'s working fine. | 19:44 |
designbybeck | I've got an NVDIA 2000 Quadro | 19:44 |
Nono923 | Is there anyone who could help me please? | 19:44 |
mikey1234 | designbybeck: 8400 GS. | 19:44 |
designbybeck | hmmm | 19:44 |
nate_H | Ok, so basically I'm doing some port forwarding with ssh. ssh -g -R 8080:localhost:9999 -R 8081:localhost:9998 root@192.168.39.149' THe problem is that only localhost on that 192.168.39.149 is able to connect. I want other machines on the same subnet to be able to hit those ports on 192.168.39.149. I thought -g fixed this, but is there a different server option or client option i need to pass? | 19:44 |
dina_ | yes It does not | 19:44 |
mikey1234 | designbybeck: I think they use same drivers, I'll check. | 19:44 |
Kartagis | Nono923: get xserver-xorg-video-nouveau | 19:44 |
designbybeck | mikey1234: from what I gather you are correct | 19:44 |
SvenHH | hi everyone, I have a problem with my xserver. it always starts with vesa driver and won't use the os driver radeon. can anyone help me on this? thanx in advance. cheers sven | 19:44 |
dina_ | i have been trying since ealier today | 19:44 |
Nono923 | Kartagis: But then I can't even play the simplest games | 19:44 |
liquidstone | i just installed nvidia drivers, and i cant see anything on my desktop but the wallpaper | 19:44 |
Kartagis | Nono923: and uninstall nvidia-* but nvidia-common | 19:45 |
trism | designbybeck: old card here, GeForce 6800 | 19:45 |
liquidstone | it looks like unity is gone | 19:45 |
Nono923 | Even world of goo fails to wrok properly | 19:45 |
liquidstone | please help | 19:45 |
zetox-4 | anybody available to help me? | 19:45 |
dtigue | dina_: you can always try installing the plugin in the repositroies either through searching for flash in the software center or by typing in a terminal 'sudo apt-get install flashplugin-installer | 19:45 |
dina_ | i tried on firefox and just downloaded chromium when i lost hope | 19:45 |
designbybeck | gotcha | 19:45 |
=== alexfpms_ is now known as alexfpms | ||
tottto-drummond | regarding what zetox-r | 19:45 |
tottto-drummond | zetox-4 | 19:45 |
designbybeck | and mikey1234 after rebooting I am back to my desktp and can see my launcher and such tahnks for the help | 19:45 |
zetox-4 | display problems | 19:45 |
tottto-drummond | explain your problem | 19:45 |
Nono923 | Kartagis: I am currently on xserver-xorg-vide-nouveau, but it's not really good enough. I'm not able to play anything really. | 19:46 |
tottto-drummond | zetox-r | 19:46 |
mikey1234 | designbybeck: You're welcome. Hopefully nvidia is going to solve this soon. | 19:46 |
tottto-drummond | zetox-4 explain your problem | 19:46 |
dtigue | dina_: that may require you to disable the built in version in chromium by going back to the plugin page you went to a minute ago and click disable under the built in version of flash | 19:46 |
Nono923 | And installing nvidia anything causes it to complain about xorg or something like that. | 19:46 |
bkfitz | Question: New Lenovo X1 Carbon with fingerprint reader and 12.04 LTS. Installed Fingerprint-GUI from PPA but I'm getting "No Devices Found" in UI | 19:46 |
bkfitz | help | 19:46 |
mikey1234 | designbybeck: By the way, they do use the same drivers: http://www.nvidia.com/object/linux-display-amd64-304.60-driver.html | 19:46 |
Kartagis | Nono923: sudo lshw -C display what does driver read | 19:46 |
dina_ | ok | 19:46 |
Kartagis | ? | 19:46 |
designbybeck | mikey1234: good to know | 19:46 |
Nono923 | Kartagis: withe the display? | 19:47 |
MonkeyDust | bkfitz better contact the maintainer of the PPA | 19:47 |
Kartagis | Nono923: yes | 19:47 |
bkfitz | MonkeyDust : 10-4 thx | 19:47 |
dina_ | flashplugin-installer is already the newest version. | 19:47 |
dina_ | The following packages were automatically installed and are no longer required: | 19:47 |
dina_ | libatk1.0-0:i386 libxcomposite1:i386 nspluginwrapper libnspr4-0d:i386 | 19:47 |
dina_ | libcairo2:i386 libdatrie1:i386 libgdk-pixbuf2.0-0:i386 libpixman-1-0:i386 | 19:47 |
dina_ | libxinerama1:i386 nspluginviewer:i386 libxft2:i386 libthai0:i386 | 19:47 |
FloodBot1 | dina_: Please don't flood; use http://paste.ubuntu.com to paste; don't use Enter as punctuation. | 19:47 |
dina_ | libjasper1:i386 libpango1.0-0:i386 libxcb-render0:i386 libxcursor1:i386 | 19:47 |
Nono923 | It runs through some things and then ends with PCI (sysfs) | 19:47 |
=== fernando is now known as dados | ||
SvenHH | can't get my radeon hd 4670 to work. stuck on vesa. can anyone plz help? | 19:48 |
Nono923 | oh, now it showed something. | 19:48 |
trism | mikey1234: well we don't have 304.60 in the repo yet, we have 304.51, 304.43 and 304.48, (304.60 is in the x-updates ppa though) | 19:48 |
liquidstone | anyone to solve my problem? | 19:48 |
ejo | Icons in the Unity Launcher often are .pngs with transparent background, but they show in the launcher bar against a colored background (often orange, green, or blue) that varies from one icon to another. Where can I set that color? | 19:48 |
mikey1234 | trism: Wait, so did nvidia release 304.60 as new drivers to address this? | 19:48 |
Nono923 | Kartagis: pastebin.com/0a19tWVE | 19:48 |
=== tdc_ is now known as tdc | ||
zetox-4 | i installed ubuntu studio for dual boot with windows 7 and have a samsung display on hdmi now i wanted to watch a movie on my other tv screen true hdmi and deactivated my laptop screen in the manager but now i plugged in the samsung again an its not recognized neither it is in windows | 19:49 |
designbybeck | mikey1234: trism said he had an older card? maybe it is working with other cards? | 19:49 |
mikey1234 | I believe he said he was using an older driver. | 19:49 |
zetox-4 | im using a asus k55a laptop | 19:50 |
trism | mikey1234: I'm not saying it fixes your bug (though it is supposed to fix the bug I listed), I'm just saying there is a newer driver than the one in the repos (the one you listed) | 19:50 |
Kartagis | Nono923: so are running nouveau | 19:50 |
designbybeck | ah | 19:50 |
dina_ | dtigue flashplguin installer is already the newest version | 19:50 |
Kartagis | you might want to install nvidia* | 19:50 |
n1 | hi. want to use GParted manager. when open it as a root from terminal, and right click on the main partition to resize it (only ubuntu on this terminal), cannot choose (in the dropdown menu) "resize". any tip? | 19:50 |
mikey1234 | trism: I guess it's worth a shot. | 19:51 |
dina_ | i disabled the built in version | 19:51 |
Nono923 | Kartagis: right now, yes. But it's too slow | 19:51 |
dina_ | and still keep getting the message flash is not uptodate | 19:51 |
mikey1234 | designbybeck: I found the solution if you're interested, | 19:51 |
genera | n1, which filesystem? | 19:51 |
designbybeck | sure mikey1234 | 19:51 |
Kartagis | n1: unmount it first, that means you have to start LiveParted | 19:51 |
mikey1234 | designbybeck: Try this: http://askubuntu.com/questions/202677/nvidia-driver-doesnt-work-in-12-10 | 19:51 |
xangua | n1: use a live cd | 19:51 |
genera | mounted partition? | 19:51 |
dtigue | dina_: so you have two versions listed in chrome://plugins ? | 19:51 |
Kartagis | what's the ubuntu equivalent to chkconfig in centos? | 19:52 |
SvenHH | i'm trying to purge fglrx driver but X still tries to load the module. can't get rid of it. anyone help? | 19:52 |
designbybeck | looking now mikey1234 | 19:52 |
dina_ | no only one | 19:52 |
dtigue | odd | 19:52 |
mikey1234 | designbybeck: I'm gonna try doing that. brb | 19:52 |
designbybeck | me too mikey1234 | 19:52 |
n1 | genera xangua and Kartagis thx! | 19:53 |
Nono923 | Kartagis: I had nvidia installed, but that cause everything to go wrong | 19:53 |
trism | mikey1234: oh maybe the bug was your drivers just weren't built? you could check out: dkms status; to make sure they were all installed | 19:53 |
ejo | SvenHH: did you install 12.10? I am guessing that's maybe why you had a fglrx problem... I recommend 12.04 for now if you have an ATI video card | 19:53 |
dtigue | dina_: what error are you getting when trying to run flash, and what website are you trying to use flash with ? | 19:53 |
dina_ | If you are using the open source Chromium browser, please download and install the Flash Player plug-in below. | 19:54 |
Nono923 | Kartagis: could it be cause by some glx problems? Cause that's what it complained about all the time as well, when nvidia- was installed. | 19:54 |
dina_ | it s not built in chromium | 19:54 |
diwant | Dev questions here? Or different room? | 19:54 |
Kartagis | could be, Nono923 | 19:54 |
diverdude | hello, i have specified environment variables as env NAME=VAL but for some reason the executable specified below as exec /path/to/file cannot find the .so files anyway....should these environment variables be set in a different way? | 19:55 |
dina_ | i am trying to upload photos on facebook I want to use the advanced option | 19:55 |
SvenHH | ejo: installed 12.10. can't get the oss radeon driver to work. always stuck on vesa. can u help on this | 19:55 |
dina_ | I keep receiving please update your flash player | 19:55 |
nabblet | can some1 tell me what just happened? here my dmesg http://codepad.org/trXKhLkf - my whole system nearly froze, and i had to change to tty2 to kill evince and firefox - afterwards nearly all my programs (thunderbird, skype,...) were down too... | 19:55 |
diverdude | trism: how can i check if the env vars have been set properly=? | 19:55 |
Nono923 | Kartagis: I have tried installing it, but it says that it depends on glx-diversions (=0.2.2), which itself can't be installed because of nvidia-installer-cleanup not being there. | 19:56 |
designbybeck | The solution about NVIDIA Drives not working worked for me | 19:56 |
diwant | Hey, what counts as a hook to replace HOOK hook_preprocess_HOOK? I need to preprocess a display suite preprocess field. | 19:56 |
diwant | Ooooh nvm | 19:56 |
diwant | I need the drupal channel, later all | 19:56 |
designbybeck | If you are having problems with NVDIA Drivesr in 12.10 see if this is your problem: http://askubuntu.com/questions/202677/nvidia-driver-doesnt-work-in-12-10 | 19:56 |
dina_ | on animoto it tells me time to update your flash | 19:57 |
dina_ | looks that you do not have the required version installed | 19:57 |
Wonkaewt[OFF] | .onn | 19:57 |
halo_22 | Hi guy | 19:57 |
halo_22 | s | 19:57 |
=== Craw_dinner is now known as CrawfordComeaux | ||
=== Wonkaewt[OFF] is now known as Wonkaewt | ||
halo_22 | I get a freeze of the splashscreen on my Ubuntu 12.04 LTS | 19:58 |
halo_22 | when I try to boot | 19:58 |
Gorfo | join #ubuntu-fr | 19:58 |
trism | diverdude: replace the exec line with: exec /path/to/script which echoes the environment var? seems to work here, are you trying to use LD_PRELOAD? | 19:58 |
ejo | SvenHH: I probably cannot help with being stuck on VESA. What I can tell you is that the radeon driver likely will work but not well, that many crucial compositing operations will still not be hardware accelerated, and compiz and/or unity will crash often. I recommend sticking with 12.04 until the ATI situation improves a lot. | 19:58 |
Nono923 | designbybeck: thanks, that's exactly my problem! | 19:58 |
Nono923 | Hopefully it'll fix it | 19:58 |
designbybeck | mine as well Nono923 and it just worked for me! | 19:59 |
designbybeck | share it with others if they have the problem as well Nono923 | 19:59 |
diverdude | trism: mmm no what is LD_PRELOAD? | 19:59 |
liquidstone | Guys i just dumped the default nouveau drivers because when i change my resolution, my monitor shuts down instantly. So i installed the nvidia drivers. Everything went good until i rebooted. | 19:59 |
liquidstone | On loading the mouse and wallpaper appeared first, nothing else. No unity dock no top bar, nothing. Only the wallpaper and mouse. | 19:59 |
liquidstone | How to fix this problem? | 19:59 |
ejo | So, no one here knows about altering the background colors for program icons in the Unity Launcher? Not the launcher overall background color, but the background per icon. | 19:59 |
SvenHH | ejo: thanx. so I'm trapped. have already switched to 12.10. | 19:59 |
ejo | SvenHH: I backed up my important files, and did a clean install of 12.04. Much happier. | 20:00 |
SvenHH | ejo: ic. will think about that. thanx. cheers. | 20:01 |
ejo | ok, good luck | 20:01 |
crazydip | how do I change the order of the scopes shown in a lens (in unity's dash)? | 20:01 |
dr_willis | not sure you can crazydip | 20:02 |
trism | diverdude: http://stackoverflow.com/questions/426230/what-is-the-ld-preload-trick | 20:02 |
=== danbeck_ is now known as danbeck | ||
lbod | im just getting used to unity after upgrading on sunday, not too sure about the changes yet but ive ran into that old problem with flash. It's actually completely freezing the machine (reboot only way to fix) and wondering best log files to look in... Again there's many blogs on flash problem but none of the problems seem as severe as im getting | 20:05 |
trism | crazydip: you could try com.canonical.unity.dash home-lens-ordering , not played with it myself though | 20:07 |
FlyingElvis | lbod: use google chrome...built in guaranteed to work flash | 20:07 |
lbod | its chromium im using | 20:07 |
Nono923 | designbybeck: It worked! Thanks for pointing me to it. Although the boot screen is uuugly now (text and wrong resolution), and I see an nvidia splashscreen now, but that's an acceptable trade for the other things. | 20:08 |
crazydip | trism: thanks! is this dbus? | 20:08 |
itaws | i am not able to upgrade my system update | 20:08 |
trism | crazydip: gsettings/dconf-editor | 20:08 |
FlyingElvis | the only reason i prefer chrome over chromium is the built in flash and pdf | 20:08 |
crazydip | trism: ahh, ok :) | 20:08 |
designbybeck | Great good to hear Nono923 | 20:08 |
trism | crazydip: though it does use dbus underneath | 20:08 |
mikey1234 | designbybeck: Did that work for you? | 20:08 |
designbybeck | yes it did mikey1234 | 20:08 |
designbybeck | you mikey1234 ? | 20:08 |
mikey1234 | designbybeck: Is the minimize animation also weird now? For me it is, but it's working at least. | 20:08 |
designbybeck | don't remember what it was like before mikey1234 might look a lil funny though | 20:09 |
lbod | FlyingElvis: you mean install googles chrome rather than the ubuntu distro's version? | 20:09 |
mikey1234 | designbybeck: It was basically a scale animation moving very slowly. Now only the window borders show animation. | 20:10 |
FlyingElvis | yes download from google...they have deb version | 20:10 |
designbybeck | oh yes I see that, it is only the borderish mikey1234 | 20:10 |
lbod | ok will do, i never realised they packaged their own versions | 20:10 |
FlyingElvis | yup youll be good to go | 20:11 |
=== jkim is now known as kercyr | ||
=== atrius is now known as atrius_away | ||
diverdude | trism: i found it....its because apparantly i cannot do eg. env NAME=VAL where VAL is $HOME/some/path. It seems that will be rendered to $HOME/some/path instead of /home/username/some/path...for some reason | 20:13 |
trism | crazydip: hmm unfortunately seems to make no difference here | 20:13 |
trism | diverdude: ohh, yeah that would do it | 20:14 |
lbod | FlyingElvis: will do.. im not impressed with unity so far to be honest, seems like ive a few performance things to sort out... ive disabled compiz for the moment but at the back of my mind i knew i should have fresh installed this time.. ive done ugrades since 10.04 ! | 20:14 |
=== Y_Ichiro_ is now known as Y_Ichiro | ||
dina_ | what does deconf means? | 20:14 |
diverdude | trism: why isnt it rendered properly? | 20:14 |
FlyingElvis | ibod im a kubuntu user...i about puked when i loaded ubuntu 12.10 and saw that amazon ad | 20:15 |
crazydip | trism: hrm, I also don't see where the order of the scorpes is located for the file and application lenses | 20:15 |
dr_willis | cant say ive had many uity issues.. wife has been using the amazon search feature like mad. | 20:15 |
trism | diverdude: I'm not sure env expands other environment variables, plus I don't know that HOME is set for upstart jobs (but this is just guessing) | 20:16 |
zetox-4 | how can i acce svideo card settings in ubuntu studio? | 20:17 |
crazydip | ha, i just stumbled on a porn unity lens :D | 20:17 |
ikonia | then keep it yourself | 20:17 |
dr_willis | the 'upstart cookbook' and docs mention some 'user land upstart' services trism but i think its a 'in the future' feature | 20:17 |
dr_willis | zetox-4: what kind of svideo card? | 20:18 |
lbod | FlyingElvis: i wish id stayed on 11 (though i never like change), actually think it might have been since 9 i was upgrading. Ive thought about another desktop for a while but the jittery transitions if i dont sort out this week will make me change.. horrible performance, i need to look at the nvidia drivers too | 20:18 |
zetox-4 | intel hd 4000 | 20:18 |
dr_willis | that thing has a svideo out? or what do you mean? | 20:18 |
FlyingElvis | im loving kubuntu....i find it a lot more useful than unity | 20:18 |
FlyingElvis | but thats my preference | 20:18 |
zetox-4 | that was a space | 20:19 |
zetox-4 | i mean acces video card settings | 20:19 |
Nono923 | I have a problem with bluetooth in Ubuntu. The chip used to work, but I disabled it before rebooting and now I can't enable it in any way. | 20:19 |
zetox-4 | for some reason my hdmi output isnt working anymore | 20:19 |
dr_willis | the monitors/displays tool under system settings normally for that zetox-4 | 20:19 |
Nono923 | Is there a way to find out what's the module for it or something like that? | 20:19 |
zetox-4 | i know | 20:19 |
dr_willis | if its a laptop you may need to use those fn-# keys to toggle the displays | 20:20 |
zetox-4 | for some reason my screen/tv isnt detected anymore | 20:20 |
dr_willis | i had one laptop i had to have the tttv plugged in when i powered up. hot plugging confused it | 20:21 |
zetox-4 | doesnt work | 20:21 |
Kartagis | !xen | 20:21 |
ubottu | XEN is a virtual machine monitor for x86 that supports execution of multiple guest operating systems with unprecedented levels of performance and resource isolation. Information on installing it for Ubuntu can be found at https://help.ubuntu.com/community/Xen | 20:21 |
zetox-4 | i have the same problem in windows | 20:21 |
domino14 | my machine is asking me for a private key password when i ssh to it from box A, but not from box B | 20:22 |
dr_willis | 'unprecedented' ;) marketing terms.. gotta love it | 20:22 |
ikonia | domino14: so put the key password in | 20:22 |
zetox-4 | i have a asus k55a | 20:22 |
domino14 | how does box B have my private key password stored? | 20:22 |
yeehi | hello! does anybody know a text editor that displays the total number of bytes currently used to hold the text in the editor? | 20:22 |
ikonia | domino14: it doesn't | 20:22 |
ikonia | domino14: it verifyies the has against the public key | 20:22 |
trism | dr_willis: yeah I think they were added to upstart a long time ago but never enabled in ubuntu (neat idea but I haven't played with them yet) | 20:22 |
lotharz0r | Hi. Will sleep mode on a hard drive still work, if I connect it to a second power supply taht is not connected to the mainboard? | 20:22 |
ikonia | zetox-4: for windows problems join ##windows | 20:22 |
domino14 | ikonia: so if the box has the public key in the same place as teh private key, it doesn't ask you for the password? | 20:23 |
zetox-4 | its caused by this version of ubuntu | 20:23 |
ikonia | domino14: the place has nothing to do with it | 20:23 |
lbod | FlyingElvis: im doing a few tests first, kill compiz and access as many vids as possible.. if i dissappear its all failed :D | 20:23 |
ikonia | zetox-4: ubuntu does not affect windows | 20:23 |
domino14 | so how does it verify it? | 20:23 |
ikonia | domino14: verify what ? | 20:24 |
ikonia | domino14: I'm sorry, I don't understand what your actual problem is, it's doing what it's meant to do | 20:24 |
zetox-4 | you would think but somehow my hdmi output doesnt work anymore and this happened afer i watched a movie on linux | 20:24 |
samanthaj | Hi. I need help setting up a local SMTP server on my Ubuntu server. I'm not quite sure what the best way to go about this is since I am used to Windows. Can someone help me? | 20:24 |
domino14 | box B doesn't ask me for a private key password | 20:24 |
ikonia | zetox-4: it does not effect windows | 20:24 |
domino14 | box A does | 20:24 |
ikonia | domino14: that will be gnome-keyring | 20:24 |
zetox-4 | i unvinked the box that says use this display for my laptop monitor | 20:25 |
ikonia | zetox-4: the guys in ##windows will help you with the windows issues | 20:25 |
domino14 | is there a way to remove a private key password? | 20:25 |
zetox-4 | when i turned it back on my big screen doesnt work anymore | 20:25 |
zetox-4 | the problem appeared in linux when i rebooted i hsad the same problem in window | 20:26 |
=== mh0` is now known as mh0 | ||
moen | Is it possible to "pre-bundle" in some custom apps in my ubuntu install? Kinda boring to install all the software everytime I reinstall a server | 20:28 |
zetox-4 | i think i have to reinstall both osses again | 20:28 |
zetox-4 | goddamn never gonna dual boot again | 20:28 |
lbod | and whats with the stupid scroll bars? is that just meant to look like touch scrollbars? | 20:29 |
jonnyro | zetox-4, i hear you on that one. such a pain | 20:30 |
=== mj is now known as madj | ||
crazydip | is there an irc channel for unity dev? | 20:30 |
Aufwind | Dear Ubuntu community. I ran into a problem between MBR and GPT. I learned, that I have to use gdisk to delete any GPT Stuff. I installed gdisk and ran gdisk -l which results in an error: "Problem opening -l for reading! Error is 2. | 20:31 |
Aufwind | The specified file does not exist!" Maybe someone is willing to assist me. By the way I ran into the problem while trying to dual install windows ans Ubuntu. | 20:31 |
trism | lbod: you can change them back, in 12.04- org.gnome.desktop.interface ubuntu-overlay-scrollbars, in 12.10 com.canonical.desktop.interface scrollbar-mode normal | 20:31 |
trism | crazydip: #ubuntu-unity maybe? | 20:31 |
crazydip | trism: thanks! | 20:31 |
Aufwind | And (2nd) by the way. My goal is a fresh installation of both operating systems (Windows 7 and Ubuntu). What can I do to get rid of GPT and make MBR the way to go again? | 20:32 |
lbod | trism: thanks, it's the biggest jump in ui weirdness ive seen from ubuntu in a long time.. | 20:32 |
marouane | is there any irc channel for javascript or web developers please ? | 20:32 |
Aufwind | marouane: Yes there is I belieb its name is #javascript | 20:33 |
marouane | Aufwind: Thank you ;) | 20:33 |
=== EIXv is now known as eixV | ||
Aufwind | marouane: You are welcome, mate. :-) | 20:34 |
manuel | hi all! | 20:35 |
Deluxo | Hello | 20:35 |
Deluxo | i have noticed a bug in ubuntu with compiz | 20:35 |
manuel | may I demand some help regarding modprobe and stuff? | 20:35 |
manuel | I'm quite a noob | 20:35 |
Deluxo | where can i report for it to be noticed relatively quickly? | 20:35 |
MiningMarsh | manuel: what do you need to know? | 20:36 |
gruebert | Greetings. | 20:36 |
Aufwind | gruebert: Greetings to you sir! :-) | 20:36 |
=== mrc is now known as Guest27501 | ||
gruebert | Aufwind: Any Nexus7 news? | 20:36 |
Aufwind | gruebert: I belieb I am the wrong guy to ask that. :-) | 20:37 |
manuel | I've some problem with my nvidia and I've a couple of questions about how can I change and make effective some options in the module | 20:37 |
gruebert | must. have. native. ubuntu. | 20:37 |
Aufwind | gruebert: Sounds interesting. | 20:37 |
gruebert | indeed. | 20:37 |
wastrel | Deluxo: launchpad is where you report bugs | 20:37 |
gruebert | UDC is going to be awesome. | 20:37 |
L3top | !ot | 20:38 |
ubottu | #ubuntu is the Ubuntu support channel, for all Ubuntu-related support questions. Please use #ubuntu-offtopic for other topics (though our !guidelines apply there too). Thanks! | 20:38 |
Aufwind | gruebert: Sorry L3top. | 20:38 |
wastrel | !launchpad | Deluxo | 20:38 |
ubottu | Deluxo: Launchpad is a collection of development services for Open Source projects. It's Ubuntu's bug tracker, and much more; see https://launchpad.net/ | 20:38 |
manuel | If I can't solve my cpu issue setting module options I would like to probe or remove the module | 20:38 |
manuel | basing the choice from user or kernel I'm booting | 20:39 |
manuel | sorry but I'm also a irc noob so I don't know much the etiquette here | 20:40 |
FLeiXiuS`` | what happens after cups during a base ubuntu bootup sequence? I have a livecd that hangs after cups | 20:40 |
MiningMarsh | manuel: I dont have nvidia, can't help yout here. | 20:40 |
manuel | MiningMarsh, no problem thanks anyway. Can you point me a irc bay where I can find an help? | 20:41 |
wols | manuel: change what? | 20:42 |
zykes- | d-i partman-auto/disk string /dev/vda < can I have that match either vda or sda ? | 20:42 |
DarthExpeditor | Anyone know the best utility to back up my wubi installation and restore it as the main OS? | 20:42 |
manuel | wols: nvidia module comes with powermizer that cause a cpu overhead | 20:43 |
=== Dext is now known as dext | ||
manuel | wols: I'm trying to disable it but I can't make effective change in the options of the module (in nvidia.conf) | 20:43 |
manuel | wols: one cause is that I cannot remove the probed module since is in use | 20:44 |
mah454 | Hello | 20:44 |
manuel | wols: do I have to reboot every time? | 20:44 |
mah454 | I installed fglrx-update in ubuntu-12.10 | 20:44 |
MiningMarsh | FLeiXiuS``: look under /etc/rc6.d for a file that has a higher number before than the cups file does. Those come after cups. | 20:44 |
mah454 | but X windows system not work ! pleaase view this: http://paste.ubuntu.com/1298547/ | 20:45 |
L3top | mah454: lspci | grep VGA | 20:45 |
mah454 | How can fix this problem ? | 20:45 |
manuel | wols: second) can I probe some module depending on the user/kernel? | 20:45 |
mah454 | L3top: 01:00.0 VGA compatible controller: Advanced Micro Devices [AMD] nee ATI Caicos [Radeon HD 6400M/7400M Series] | 20:45 |
FLeiXiuS`` | MiningMarsh, This is on the livecd, I'd rather not unsquash the filesystem | 20:45 |
mah454 | L3top: Vostro 3350 | 20:45 |
DarthExpeditor | Anyone know the best utility to back up my wubi installation and restore it as the main OS? | 20:46 |
wilee-nilee | DarthExpeditor, Youcan just transfer to a partition. | 20:46 |
DarthExpeditor | I don't have one. | 20:46 |
DarthExpeditor | I don't have an extra | 20:46 |
DarthExpeditor | I should always be more specific | 20:47 |
DarthExpeditor | wait a sec. | 20:47 |
L3top | mah454: one second | 20:47 |
wilee-nilee | DarthExpeditor, https://help.ubuntu.com/community/MigrateWubi | 20:47 |
DarthExpeditor | Can I transfer it to a USB HDD partition and then back to my main drive as the main OS? | 20:47 |
=== erkan^ is now known as onzichtbaar | ||
mah454 | L3top: this is Xorg output : http://paste.ubuntu.com/1298547/ | 20:48 |
wilee-nilee | DarthExpeditor, Theoretically yes, you could use this migrate to a external and dd it or clone it. | 20:48 |
Giant81_ | I know with linux to linux I can run ssh -Y blahblah to run remote x windows session, any easy way to do this from a windows host? | 20:48 |
wilee-nilee | should work DarthExpeditor | 20:48 |
DarthExpeditor | kk. | 20:49 |
L3top | mah454: can I see the output of apt-cache policy fglrx-updates | grep -i installed | 20:49 |
DarthExpeditor | Here goes nothing. | 20:49 |
doomlord | anyone here familiar with the awesome window manager | 20:49 |
Giant81_ | or to clarify, I'm on a iwndows machine, ssh'ing to an Ubuntu server, looking to do remote x-windows session so it shows up on the windwos machine | 20:49 |
wilee-nilee | DarthExpeditor, May the force be with you. ;) | 20:49 |
L3top | Giant81_: putty | 20:49 |
synsveta | Hi all. Can someone say mee how can I remove selenium server? | 20:49 |
Giant81_ | can putty do remote x-windows between windows and linux? | 20:50 |
stefanomandelli | aptitude remove selenium ? | 20:50 |
L3top | Giant81_: not sure... I dont have a windows machine left to test on... you might also look at teamviewer | 20:50 |
OerHeks | synsveta, stop the service, then uninstall | 20:50 |
wols | Giant81_: it can do X forwarding, yes | 20:50 |
synsveta | ps doesn't see it | 20:50 |
Giant81_ | I'll look at the documentation for it | 20:50 |
Giant81_ | thanks | 20:51 |
Giant81_ | I thought I might have to go to nomachine NX or something | 20:51 |
wols | Giant81_: what X server do you use? | 20:51 |
wols | Giant81_: do you even have a Windows X server? | 20:51 |
=== klaas_ is now known as klaas | ||
synsveta | when I, trying to use i2p firefox says "Selenium can't find the server at forum.i2p" | 20:52 |
dr_willis | Giant81: xming on window's can do it | 20:52 |
dr_willis | its a x server for windows | 20:52 |
hansm | \q | 20:52 |
hansm | quit | 20:52 |
zoopp | deadmund: ..my HDD just died completely. | 20:54 |
Giant81_ | I was looking at xming now, but omg talk about a list of links | 20:54 |
Giant81_ | still trying to find the installer | 20:54 |
dr_willis | its dead jim! | 20:54 |
=== atrius_away is now known as atrius | ||
dr_willis | http://www.straightrunning.com/XmingNotes/ | 20:56 |
donc3 | Hi all | 20:56 |
wastrel | how do i get pidgin added to the messaging menu in 12.10 | 20:56 |
dr_willis | public domain release | 20:56 |
=== tf81_netbook is now known as Guest70939 | ||
donc3 | I have an error with ubuntu | 20:56 |
donc3 | can somebody help me? | 20:56 |
dr_willis | details needed donc3 | 20:56 |
Toph2 | is 12.10 offocially out? | 20:57 |
Toph2 | officially | 20:57 |
IdleOne | yes | 20:57 |
k1l | Toph2: yes | 20:57 |
donc3 | I'm getting an error with libc package and I don't know how to fix it | 20:57 |
trism | wastrel: pidgin isn't ported yet for 12.10 to the messaging-menu | 20:57 |
wastrel | okey dokey | 20:57 |
donc3 | after I do apt-get upgrade I have this error: libc6 : Depende: libc-bin (= 2.15-0ubuntu10.2) pero 2.15-0ubuntu10.3 está instalado libc6-dev : Depende: libc6 (= 2.15-0ubuntu10.3) pero 2.15-0ubuntu10.2 está instalado E: Dependencias incumplidas. Pruebe de nuevo usando -f. | 20:57 |
Toph2 | k1l,,, ok,, thanks | 20:58 |
trism | wastrel: enabling the status icon is a decent workaround, and whitelisting pidgin in com.canonical.Unity.Panel systray-whitelist | 20:58 |
donc3 | and if I do apt-get -f install i get this | 20:59 |
whatwhat | guys what the hell is this | 20:59 |
wastrel | i will do these things you say trism | 20:59 |
whatwhat | http://www.youtube.com/watch?v=q5SZzFaAZyY&feature=related | 20:59 |
donc3 | A copy of the C library was found in an unexpected directory: '/lib/i386-linux-gnu/libc-2.15.so' It is not safe to upgrade the C library in this situation; please remove that copy of the C library or get it out of '/lib/i386-linux-gnu' and try again. | 20:59 |
donc3 | Can somebody help me?? | 20:59 |
=== tf81_netbook is now known as Guest78625 | ||
wilee-nilee | !ot | whatwhat | 21:00 |
ubottu | whatwhat: #ubuntu is the Ubuntu support channel, for all Ubuntu-related support questions. Please use #ubuntu-offtopic for other topics (though our !guidelines apply there too). Thanks! | 21:00 |
gustav__ | Hello. | 21:01 |
donc3 | Nobody? | 21:01 |
MiningMarsh | donc3: try doing waht is says | 21:01 |
MiningMarsh | donc3: sudo mv /lib/i386-linux-gnu/libc-2.15.so /lib/i386-linux-gnu/libc-2.15.so.back. This could break thigns though | 21:02 |
humbolt | the kernel in the current ubuntu version is broken! | 21:02 |
donc3 | Mining: If I do this the system doesn't works | 21:02 |
humbolt | It cost me a day to find that out!!! | 21:02 |
=== luigi is now known as Guest61544 | ||
bekks | humbolt: So whats broken exactly - it works fine here so far. | 21:03 |
humbolt | I can not quite tell, where and how yet, but I will investigate. | 21:03 |
humbolt | bekks: well, I had OBE installed and recompiled a hundred times and it would not work | 21:03 |
doomlord | anyone here familiar with awesome wm - in lua is it possible to get a table of clients currently mapped to a tag. (really i just want the number) | 21:03 |
humbolt | now I switched back to the old kernel and it works again | 21:04 |
MiningMarsh | donc3: its kind of a donc3: no idea. If you are worried, leave it and dont do anything | 21:04 |
=== alin|mobile is now known as alinmear | ||
bekks | humbolt: Whats OBE? | 21:04 |
paolooo | @all, What is the shortcut key for maximizing and minimizing windows? | 21:04 |
humbolt | open broadcast encoder | 21:04 |
ToyImp | can anyone suggest a good php channel/server? | 21:04 |
=== alinmear is now known as alin|mobile | ||
ikonia | ToyImp: ##php ....try the search functions | 21:05 |
ToyImp | thanks | 21:05 |
bekks | humbolt: And what "would not work"? | 21:05 |
bestdnd | in LibreOffice calc, how can i add the unicode RTL sign? i have a multi-line text in a single cell, and want to override the direction set for the cell in a single line. | 21:07 |
MonkeyDust | bestdnd there's also #libreoffice | 21:08 |
bestdnd | didn't know that. going there now | 21:08 |
ObsidianBlade | Hi everyone, hoping to get some assistance here. | 21:10 |
ejo | I honestly think Ubuntu ought to scrap the 6-month release schedule and release when ready | 21:10 |
ejo | at least if everyone else in the ecosystem (for example, ATI drivers) can't or aren't interested in being ready on that schedule | 21:11 |
MiningMarsh | ejo: or offer a seperate rolling release. | 21:11 |
ObsidianBlade | I have an MSI GT70 0NE 276US with (what I believe is) a hardware RAID 0 set up. I was wondering if someone could tell me what I have to do to get Ubuntu to install on it? I can't seem to get it to work right. | 21:11 |
wols | ObsidianBlade: it's not hardware raid | 21:11 |
wols | ObsidianBlade: do you really really need RAID? | 21:11 |
ObsidianBlade | Well, no, but I'd rather have 256GB than 128GB | 21:12 |
wols | ObsidianBlade: is this a SSD "RAID"? | 21:12 |
ObsidianBlade | yeah | 21:13 |
wols | wow, the idiocy is limitless. | 21:13 |
ObsidianBlade | ?? | 21:13 |
wols | an SSD raid is utterly stupid. but then, you bought a gaming laptop. no more comments necessary. Ubuntu should recognize both SSDs as normal disks | 21:13 |
MiningMarsh | Why is that stupid | 21:14 |
MiningMarsh | wols: he wants a raid0. Thats just combination, | 21:14 |
ThePendulum | Hey. I was wondering if someone knows a nice tool to manage media. Rename files, compare files to a database and auto-tag/name them, etc. | 21:14 |
FLeiXiuS`` | wols, Explain why an SSD raid is silly. | 21:14 |
ThePendulum | Preferably TV shows and music, or seperate tools | 21:14 |
FLeiXiuS`` | wols, and I'll explain why every concern of yours is illegitimate. | 21:15 |
wols | FLeiXiuS``: it's a SSD. he won't notice the RAID part. especially with a fakeraid.then there is the lack of trim | 21:15 |
MiningMarsh | wols: he just wants a large physical volume. | 21:16 |
FLeiXiuS`` | Simultaneousness r/w's even with fake raid will prove to have a dramatic increase in responsiveness with application load times vs large file to mem queries. | 21:16 |
MiningMarsh | wols: its hard not to notice that your two hard drives suddenly became one | 21:16 |
DreadNaught | Can anyone pm me with installing help please? | 21:17 |
alos22 | hello i am looking for an ubuntu version with gnome 3.6 and gnome shell | 21:18 |
ikonia | alos22: doesn't exist at this time | 21:18 |
FLeiXiuS`` | wols, and in terms of TRIM support, so long as he selects a fs that supports it, he'll have no issues. | 21:18 |
trism | alos22: 12.10 has gnome 3.6.1 and gnome-shell | 21:18 |
ikonia | DreadNaught: just ask the channel for help | 21:18 |
trism | alos22: not by default of course, unless you get the remix iso | 21:19 |
alos22 | i hear something like ubuntu gnome remix 12.10 can i use that? | 21:19 |
ikonia | trism: is it 3.6.1 ? | 21:19 |
ikonia | !info gnome | 21:19 |
ubottu | gnome (source: meta-gnome3): The GNOME Desktop Environment, with extra components. In component universe, is optional. Version 1:3.0+6ubuntu4 (quantal), package size 2 kB, installed size 51 kB | 21:19 |
DreadNaught | I'm having problems installing 12.10 and it won't install from the windows installer or from the cd | 21:19 |
DreadNaught | cd/dvd | 21:19 |
FLeiXiuS`` | Regardless, it'll work with superior gains. | 21:19 |
ikonia | DreadNaught: explain the problem | 21:19 |
dr_willis | alos22: if it does what you want.. but its not an official ubuntu variant that i know of. (yet) | 21:19 |
trism | !info gnome-shell | ikonia | 21:19 |
ubottu | ikonia: gnome-shell (source: gnome-shell): graphical shell for the GNOME desktop. In component universe, is optional. Version 3.5.91-0ubuntu1 (quantal), package size 342 kB, installed size 933 kB | 21:19 |
ikonia | trism: that's showing 3.5 | 21:19 |
=== alin|mobile is now known as alinmear | ||
DreadNaught | ikonia: I try to use the install cd boot and I get an unknown error from the 12.10 dvd | 21:20 |
trism | ikonia: yeah needs updating it seems, https://launchpad.net/ubuntu/+source/gnome-shell/3.6.1-0ubuntu1 | 21:20 |
trism | alos22: this is the remix https://wiki.ubuntu.com/UbuntuGNOME/ReleaseNotes/12.10 (it's in universe so as official as xubuntu I suppose) | 21:21 |
ObsidianBlade | Anyway, fellas: MiningMarsh, wols, FLeiXiuS'', this is what it looks like when I go to install, which confused the hell outta me http://imageshack.us/f/823/photoalve.jpg/ | 21:21 |
ikonia | trism: gnome-remix isn't an oficial release | 21:22 |
ikonia | xubuntu is | 21:22 |
=== alinmear is now known as alin|mobile | ||
trism | ikonia: ubuntu-gnome-desktop is the package | 21:22 |
ikonia | trism: that's a metapackage | 21:22 |
trism | ikonia: that the iso builds from | 21:22 |
dr_willis | that dosent make it an official relase. | 21:22 |
ikonia | trism: yes, that's still not offical though | 21:23 |
trism | it was discussed at UDS 12.04 too, though I suppose you're right I don't really know the status | 21:23 |
rozmuq | hi. when i'm trying to install something, i get many errors.. http://pastebin.com/8Li15u4K | 21:23 |
=== alin|mobile is now known as alinmear | ||
dr_willis | somthing? Cant even give specifics? ;P | 21:23 |
trism | actually yeah, good point lubuntu-desktop was there for a while before becoming official, my mistake | 21:24 |
mib_mib | guys, when i type free -m or just free or vmstat, the shell just hangs and returns nothing - can someone help/ | 21:24 |
ObsidianBlade | So since you guys established that the RAID 0 SSD setup isn't stupid, how do I go about getting it to work? | 21:24 |
ikonia | ObsidianBlade: depends on how you are raiding it | 21:25 |
ikonia | ObsidianBlade: it can be a terrible terrible idea | 21:25 |
alexThunder | catalyst isn't working anymore for me on quantal. i have a radeon 5870 - anyone got an idea? | 21:25 |
ObsidianBlade | How come? | 21:25 |
=== alinmear is now known as alin|mobile | ||
=== alin|mobile is now known as alinmear | ||
ikonia | ObsidianBlade: due to the differences in how it's implemented. | 21:25 |
DreadNaught | ikonia: any clue what is wrong with the dvd for 12.10? | 21:26 |
ikonia | DreadNaught: what's the exact error | 21:26 |
DreadNaught | An error occurred: Could not retrieve the required installation files | 21:26 |
gustav__ | alexThunder: Have you tried turning it off and on again? | 21:26 |
alexThunder | yes | 21:26 |
DreadNaught | then it gives a log file to look at | 21:27 |
giakar | ciao | 21:27 |
ObsidianBlade | ikonia: The main reason I wanted to do it was because of the hard drives being rather small individually. Not only that but when I turned off RAID in the BIOS and set it to AHCI, they still came up in a RAID sort of way | 21:27 |
giakar | !list | 21:27 |
ubottu | giakar: No warez here! This is not a file sharing channel (or network); read the channel topic. If you're looking for information about me, type « /msg ubottu !bot ». If you're looking for a channel, see « /msg ubottu !alis ». | 21:27 |
ikonia | ObsidianBlade: what does a "raid sort of way" mean | 21:27 |
alexThunder | gustav__: in fact, I tried it multiple times, with 12.8 and 12.9 Beta | 21:27 |
ObsidianBlade | It said it was striped | 21:27 |
ikonia | ObsidianBlade: what said it was striped | 21:27 |
=== onzichtbaar is now known as erkan^ | ||
ObsidianBlade | The setup? | 21:27 |
ikonia | ObsidianBlade: what setup | 21:28 |
ObsidianBlade | Ubuntu's???? | 21:28 |
ikonia | ObsidianBlade: be specific | 21:28 |
DreadNaught | that's all it's listing ikonia | 21:28 |
ikonia | ObsidianBlade: I'm sorry, that doesn't make any sense, ubuntu's installer doesn't say "these disks are striped" | 21:28 |
ikonia | ObsidianBlade: be very careful, if you're using software raid on these disks it will ruin them | 21:28 |
FLeiXiuS`` | ObsidianBlade, rather a raid setup, have you looked into LVM at all? | 21:28 |
=== alinmear is now known as alin|mobile | ||
ObsidianBlade | ikonia: I don't remember specifics unfortunately. Although I can go through the process again. Either way, I wanted the drives to be unified | 21:29 |
=== alin|mobile is now known as alinmear | ||
ObsidianBlade | FLeiXiuS'': I don't know anything about it unfortunately | 21:29 |
ikonia | ObsidianBlade: well, I've warned you, it's up to you what you do | 21:29 |
FLeiXiuS`` | ObsidianBlade, LVM is configurable during the installation. It'll be a much simpler solution | 21:30 |
ikonia | be careful with LVM | 21:30 |
ObsidianBlade | ikonia: What do you mean it'll ruin them? | 21:30 |
ikonia | the logical volumes will not support trim | 21:30 |
wN | lvm is really scary. | 21:30 |
ikonia | lvm is not scary, you just have to be aware using it with SSD's | 21:31 |
=== alinmear is now known as alin|mobile | ||
wN | D: | 21:31 |
FLeiXiuS`` | LVM doesnt support trim, but the logical volume formatted with ext4 will. | 21:31 |
facu__ | alguien que me pueda ayudar? Can someone help me¿? | 21:31 |
ikonia | FLeiXiuS``: no, it won't | 21:31 |
=== alin|mobile is now known as alinmear | ||
FLeiXiuS`` | ikonia, It's working perfectly fine and dandy here. | 21:31 |
ikonia | FLeiXiuS``: I don't believe it actually is though, it may look like it does | 21:32 |
facu__ | someone can help me? | 21:32 |
FLeiXiuS`` | I work closely with file system forensic tools, it's clearly freeing up unused blocks. | 21:32 |
wols | !ask | facu__ | 21:32 |
ubottu | facu__: Please don't ask to ask a question, simply ask the question (all on ONE line and in the channel, so that others can read and follow it easily). If anyone knows the answer they will most likely reply. :-) See also !patience | 21:32 |
FLeiXiuS`` | This hasnt always be the case, but since 11.04 it has been. | 21:32 |
facu__ | Ok | 21:32 |
ikonia | FLeiXiuS``: ah, so a specific version has fixed it. | 21:33 |
FLeiXiuS`` | Or 11.10 | 21:33 |
facu__ | I have to instal the grafic drivers... Is Ubuntu drivers better than NVIDIA Drivers? | 21:33 |
ikonia | FLeiXiuS``: I'm surprised it's that early a version | 21:33 |
FLeiXiuS`` | ikonia, TRIM Support was added the the kernel in 08, 4 years for LVM support is plenty of time. | 21:33 |
FLeiXiuS`` | So long as the LV is formatted with a suitable FS it'll work | 21:34 |
ObsidianBlade | FLeiXiuS'':Alright so is LVM the direction I should be taking this? Is there like a written out guide for it? | 21:34 |
ikonia | FLeiXiuS``: trim support has been in the kernel for a long time, i'm aware however it's support with LVM has not been | 21:34 |
tzanger | that is the strangest thing | 21:34 |
facu__ | I have to instal the grafic drivers... Is Ubuntu drivers better than NVIDIA Drivers? | 21:35 |
tzanger | two completely separate drives (both SATA, but different manufacturers and different "eras") fail to POST after installing Ubuntu 12.10. If I put the drive on a different controller (not a different port of the same controller) it works just fine | 21:35 |
wols | facu__: no. use the ubuntu proprietary nvidia drivers. they're made by nvidia but packaged properly for ubuntu | 21:35 |
FLeiXiuS`` | I just tested, again, with hdparm - it's working. | 21:35 |
FLeiXiuS`` | ikonia, ^ | 21:35 |
facu__ | wols how could I know wich driver is the correct of the list? | 21:36 |
ikonia | FLeiXiuS``: I'm not doubting you | 21:36 |
ikonia | FLeiXiuS``: although I wouldn't use hdparm as a "it's working" test | 21:36 |
ObsidianBlade | ikonia &FLeiXiuS``: What do you suggest as the best course of action? | 21:36 |
facu__ | wols: how could I know wich driver is the correct of the list? | 21:37 |
DreadNaught | oh well guess I will jsut stick with windows then thanks for whatever help you gave | 21:38 |
OerHeks | ObsidianBlade, maybe this answer is any help clearing up trim/discar on LVM >> "Add "devices/issue_discards" to lvm.conf." Version 2.02.85 - 29th April 2011. I n 12.04 the LVM version is 2.02.66 (12.10 comes with 2.02.95). >> http://askubuntu.com/questions/191914/how-should-i-configure-trim-support-for-lvm-logical-volumes | 21:40 |
ikonia | OerHeks: that's direct conflict with FLeiXiuS`` suggestion that it works in 11.04 | 21:41 |
ikonia | OerHeks: that info suggests it's 12.10 as the first release. | 21:41 |
OerHeks | ikonia noticed that too. | 21:41 |
ikonia | OerHeks: your info ties in with what I was expecting. | 21:42 |
OerHeks | I hope this confirmation benefits all. | 21:42 |
Meris | How long should a filesystem search using gpart normally take on a 2TB HDD that used to have only one partition ? I have started the process around 14:30 | 21:43 |
wariat | Hello! I like to know what i've installed on my computer. I was sure that i will find this by # apt-mark showmanual but there is a lot of crap I did not install manually. I've installed ubuntu on other machine today, after is tarted i've checked # apt-mark showmanual | wc -l; apt-mark showauto | wc -l and the result is: 1381, 62 and IMO should be 0, 1443 can anyone please tell me if it is just a bug or maybe that auto/manual is not about who | 21:45 |
wariat | installed the packet in the system. | 21:45 |
ikonia | wariat: probably just dependencies | 21:46 |
jordanm | wariat: "automatic" installations occur when something is installed because it depends or recommended by a package that it was told to install (which is manual) | 21:46 |
jordanm | wariat: the packages the installer explicitly tells apt to install would be manual whereas the things that get pulled in as a result are "automatic" | 21:47 |
zykotick9 | wariat: FYI, using root isn't recommended on ubuntu | 21:47 |
wariat | as i said, i've made clean install today, after that (i did not install anything) apt-mark showmanual gives 1381 resulst and showauto 62 while IMO all should be marked as automatic | 21:47 |
jordanm | zykotick9: interactive sudo sessions is valid and proper usage of sudo | 21:47 |
bashking_ | Im upgrading to 12.10! | 21:47 |
jordanm | wariat: I just explained it, are you reading? | 21:47 |
zykotick9 | jordanm: true... i still say it's silly though ;) | 21:48 |
wariat | i'm readind, but probably not understand excuse me | 21:48 |
XiaolinDraconis | can i listen to audio through 2 sets of headphones at the same time? | 21:48 |
jordanm | wariat: you installed the manually installed packages by using the ubuntu installer | 21:48 |
XiaolinDraconis | front and rear jacks | 21:48 |
wariat | zykotick9: i'm not using root account just: "sudo su - " that is also "not recommended" ? | 21:49 |
zykotick9 | jordanm: please see wariat above ;) | 21:50 |
zykotick9 | wariat: don't use "sudo su" ever | 21:50 |
jordanm | wariat: sudo -i is the proper way to get a root shell using sudo | 21:50 |
=== jen is now known as oopsIdiditagain | ||
wariat | ok i'll try to remember thank you | 21:50 |
daviddoria | I am trying to upgrade from 12.04 to 12.10. It seems to be stuck on installing dropbox - the processor has been stuck at 100% for several hours. What is the best way to proceed? | 21:50 |
oopsIdiditagain | uh so I deleted my downloads folder lol | 21:50 |
OerHeks | XiaolinDraconis, not all systemboards support use of both front & back together, usually the back phone is muted when you plugin your headphone in the front | 21:51 |
wN | ikonia: do you happen to have some documentation handy that goes over logical volumes not supporting trim? | 21:51 |
wariat | about manual/automatic so ok it is not the way to get liust of packages i've installed manually. Is that any way to get it? Easy way better ;-) | 21:51 |
oopsIdiditagain | so here | 21:51 |
oopsIdiditagain | is my problem, I have a folder called MISC, and it somehow has my downloads folder in it, so I cant delete it and its taking up space | 21:52 |
=== rafael is now known as Guest63894 | ||
=== Guest63894 is now known as rafael_psx | ||
jordanm | wariat: no, apt does not differentiate between you typing "apt-get install" and the installer running "apt-get install" | 21:53 |
jordanm | or perhaps the installer running tasksel foo and that in turn running "apt-get install" | 21:53 |
oopsIdiditagain | anyone know how to fix that? lol | 21:53 |
XiaolinDraconis | OerHeks, ive had ubuntu play sound from the internal and the jack | 21:54 |
simpleirc1 | mmh | 21:54 |
jordanm | oopsIdiditagain: a directory only containing a single other directory only takes up 4K of space on an ext filesystem | 21:55 |
wariat | jordanm: so theer is no way to get this list? weird but ok i'll try to live with that. Anyway so the information about manual/automatic packages has any sense here? I'm asking because i like to know what for is something | 21:55 |
npws_marc | does the command line of ubuntu server have a resolution? my kvm is saying it is out of range and to set it to 1024x768 | 21:55 |
jordanm | wariat: 17:46:16 < jordanm> wariat: "automatic" installations occur when something is installed because it depends or recommended by a package that it was told to install (which is manual) | 21:55 |
dr_willis | npws_marc: it could be using the framebuffer feature of the kernel. | 21:55 |
oopsIdiditagain | jordan, but its still annoying lol I want to delete the folder but I can't without completely deleting my whole downloads folder | 21:56 |
jilebedev | Hi - what's the appropraite way to add a user from command line s.t. it creates the /home directory and sets the default terminal to bash? | 21:56 |
npws_marc | hmm | 21:56 |
dr_willis | npws_marc: also the grub menu can have differnt resolutions | 21:56 |
npws_marc | i see | 21:56 |
jordanm | wariat: if I say apt-get install foo and it installs bar also because bar is a depends "foo" is a manual installation and "bar" is an automatic | 21:56 |
npws_marc | i can't get into the OS because of that | 21:56 |
dr_willis | try the 'text' and 'nofb' options perhaps. | 21:56 |
zykotick9 | jilebedev: use "adduser", NOT "useradd" | 21:56 |
dr_willis | edit the grub line 'noquiet nosplash text nofb' | 21:57 |
dr_willis | instead of 'quiet splash' | 21:57 |
jilebedev | zykotick9: I did exactly that. adduser foo ... it just ended, without any prompts for full name or anything else. | 21:57 |
elementz | hi all. i am having problems when trying to run autogen.sh for the following software: https://github.com/hzeller/gmrender-resurrect the error message i get: http://pastie.org/private/sfmkb5zreplutynpcnwm9a | 21:57 |
zykotick9 | jilebedev: did you use sudo? | 21:57 |
npws_marc | dr_willis: can you edit that from teh grub screen? | 21:57 |
npws_marc | or from a livecd of ubuntu server | 21:58 |
elementz | this is on a arm-based machine. on a x86 machine the compilation works fine | 21:58 |
jilebedev | zykotick9: Yep. Never mind actually: ti works now. I deleted the user, and now it's working OK. Must have been a typo on my end. | 21:58 |
elementz | maybe somebody can help? | 21:58 |
dr_willis | npws_marc: yes. | 21:58 |
dr_willis | npws_marc: grub menu has full editing features for single boot ussage | 21:58 |
npws_marc | thank you | 21:58 |
npws_marc | i gotta run though, i'll have to try this tomorrow haha. everyone wants to leave | 21:58 |
wariat | jordanm: but it doeas not work like this … i've installed vim for example (manually) so vim should be manual, and it's dependencies should be automatic right? Can you see here: http://pastebin.com/pD9wjSEF ? | 21:58 |
=== simpleirc1 is now known as vainamoinen | ||
jilebedev | Anyone know of a convenient way to copy group memberships between two members? | 21:59 |
jilebedev | ... and nevermind. I think I'll google things before spamming this channel. Sorry. | 22:00 |
jordanm | wariat: the last 3 were done by the installer | 22:01 |
zykotick9 | wariat: ubuntu does come with vim-tiny by default | 22:02 |
wariat | jordanm: Ok so there is a way to get a list od packages installed by the installer? You kno to compare this list with all manuall packages and get a list of packages installed by me | 22:02 |
jordanm | wariat: what are you really trying to accomplish? | 22:03 |
zykotick9 | jordanm: i'm guessing wariat is looking for something like the clone factoid... not something i'd currently recommend to anyone ;) | 22:04 |
wariat | jordanm: i like to get a list od packages i've installed on my computer. Like i had in gentoo in /var/lib/portage/world just a list of packages installed by me not the installer or anyone | 22:04 |
jordanm | wariat: for what purpose? just to waste time? gentoo has an installer now? | 22:05 |
wariat | why i'm looking for it? Just because i like to install any new computer from the beginning and like to look a list of packages installed on other one. Look and say ok this and this i want to have here also. | 22:06 |
talsamon | hello, if i want to remove chromium, synaptics show me, lubuntu-desktop will also removed, how can i remove chromium ? | 22:06 |
t|4sk | Hi, which is a good CLI web browser beside elinks? | 22:06 |
wols | t|4sk: lynx, links, w3m | 22:06 |
zykotick9 | t|4sk: i use links2 myself for cli browsing... | 22:06 |
t|4sk | wols: thanks I try w3m ... now I remeber herad of it | 22:07 |
wariat | for me it is a kind of waste of time if i have to make a list (on piece of paper) to prepare the desktop to work, gentoo made this work for me for free ;-) | 22:07 |
wariat | anyway gentoo is not good choice for atom powered netbook :-) | 22:07 |
ardchoille | talsamon: lubuntu-desktop is a meta package, it's safe to remove | 22:07 |
oopsIdiditagain | does anyone know how to properly fix this problem? | 22:07 |
t|4sk | zykotick9: k, I try this one too, thx | 22:07 |
talsamon | ardchoille, thanks, i hope so ;-) | 22:08 |
wols | oopsIdiditagain: why can't you delete it? | 22:08 |
ardchoille | talsamon: just remember to re-install it if you do an upgrade, just to keep things tidy | 22:08 |
oopsIdiditagain | wols, i have no idea | 22:09 |
zykotick9 | talsamon: fyi, removing chromium is probably more effort then it's worth... for one thing, you need meta-packages to upgrade to a new version of ubuntu... so down the road it could cause issues. ALSO, pay close attention to everything that gets uninstalled. | 22:09 |
jordanm | wariat: aptitude search -F '%100p' '~i!~M' > package_list; on the reference machine; xargs aptitude --schedule-only install < package_list; aptitude install; on the other machine | 22:09 |
talsamon | ardchoille, its an important info | 22:09 |
daviddoria | if I force close the upgrade install process, is everything going to be broken? Or will it resume nicely? | 22:09 |
=== alinmear is now known as alin|mobile | ||
talsamon | zykotick9, yes, i will keep chromium, but i don't like anything from google | 22:10 |
zykotick9 | wariat: re_ jordanm's aptitude suggesion. DON'T use that method if you are using 64bit! | 22:10 |
wariat | and last but not least if apt gives information about automatic/manual packages i was sure it is giving this information for something. And IMO (maybe i'm wrong) if the list is spammed by installator packages it is useless. And i don't want to clone two computers i like to have a list and look on it | 22:11 |
XiaolinDraconis | no tips on how i can listen to stuff through both jacks? | 22:11 |
=== alin|mobile is now known as alinmear | ||
zykotick9 | talsamon: my solution to cruft. start from mini (aka netinstall) - and DON'T select a desktop (*buntu-desktop) and then create a script for your install, of ONLY the packages you want/need, 0 cruft. Not good for upgrading in ubuntu to new versions! | 22:12 |
=== alinmear is now known as alin|mobile | ||
PatrickDickey | daviddoria, I'd say it will break. Once the upgrade starts, you want to leave it alone. | 22:12 |
lindenle_ | Hi all, sound is working as root but not as a user in 12.04. Can someone help me out? I checked and the user is in the audio group and the /dev/snd/* files all seem to have the correct permission. | 22:12 |
=== alin|mobile is now known as alinmear | ||
wols | oopsIdiditagain: error messages are important. what does yours say? | 22:13 |
oopsIdiditagain | wols, derp hold on | 22:13 |
facu__ | I have to instal the grafic drivers... Is Ubuntu drivers better than NVIDIA Drivers? | 22:13 |
talsamon | zykotick9, thanks, in the moment i keep it as it is, till i consider another distribution | 22:13 |
=== alinmear is now known as alin|mobile | ||
=== alin|mobile is now known as alinmear | ||
=== alinmear is now known as alin|mobile | ||
facu__ | I have to instal the grafic drivers... Is Ubuntu drivers better than NVIDIA Drivers? | 22:16 |
=== alin|mobile is now known as alinmear | ||
erictr1ck | i just upgraded to 12.10 and am now getting this error when trying to run a virtual box image: Kernel driver not installed (rc=-1908) | 22:16 |
erchina | hi all | 22:18 |
zykotick9 | erictr1ck: "Kernel driver not installed" suggests the issue/solution. personally, i'd purge vbox. | 22:19 |
zykotick9 | reboot - install vbox again. | 22:19 |
args[0] | ,./;' | 22:19 |
facu__ | I have to instal the grafic drivers... Is Ubuntu drivers better than NVIDIA Drivers? | 22:19 |
PatrickDickey | facu_ you can try the drivers from the ubuntu repository, and if they don't work, then uninstall them and get NVIDIA's drivers. | 22:19 |
zykotick9 | facu PatrickDickey suggestion to use nvidia.com's drivers is probably NOT a good idea. | 22:20 |
erchina | where i can find some help for dns server configuration on lan? | 22:20 |
facu__ | PatrickDickey: Wich driver of ubuntu propietary drivers do I take? the [Reccomend] ? | 22:21 |
facu__ | There is a list | 22:21 |
L3top | facu__: lspci -nn | grep VGA | 22:22 |
erchina | help DNS server and PfSense redirect | 22:22 |
erchina | any1? | 22:22 |
facu__ | L3top: 00:0d.0 VGA compatible controller [0300]: NVIDIA Corporation C61 [GeForce 6100 nForce 405] [10de:03d1] (rev a2) | 22:23 |
eankele | erchina what is the problem? | 22:23 |
erchina | hi eank | 22:23 |
erchina | sorry is my 1st irc | 22:23 |
eankele | erchina: Hi, what did you need some help with? | 22:24 |
erchina | do u know pfsense firewall | 22:24 |
erchina | ? | 22:24 |
eankele | erchina: yes, I have used it in the past. | 22:24 |
erchina | i have it in a lan | 22:25 |
L3top | facu__: what version are you on? sudo apt-get install nvidia-current typically. | 22:25 |
erchina | with a DNS server | 22:25 |
L3top | facu__: version ubuntu I mean. | 22:26 |
facu__ | L3top: Version of Ubuntu, 12.04.1 | 22:26 |
eankele | erchina. Yes. Go on... | 22:26 |
L3top | facu__: nvidia-current would be fine. | 22:26 |
wariat | ty all | 22:26 |
facu__ | L3top: ok ty bro | 22:26 |
erchina | when the user connect to the lan there is a rediredt to login page | 22:26 |
=== alinmear is now known as alin|mobile | ||
erchina | the local address is firewall.domaiin.org | 22:27 |
eankele | erchina - using the captive portal? | 22:27 |
erchina | yes exactly | 22:28 |
erchina | the problem is that when the DNSserver is down there is no redirect | 22:28 |
erchina | to login page | 22:28 |
=== root is now known as Guest55799 | ||
facu | zyckotik9: ok bro thanks | 22:28 |
erictr1ck | zykotick9, dang, same error after a purge, reboot, and reinstall :( | 22:28 |
erchina | how can i fix have redirect always? | 22:29 |
facu | ykotick9: ok bro, thanks! | 22:29 |
facu | zykotick9: ok bro, thanks! | 22:29 |
zykotick9 | erictr1ck: sorry man. i don't know anything specific for this case? have you searched for any bugs on launchpad? anyone else having issues with vbox and kernel after upgrading? | 22:30 |
eankele | erchina: This belongs more in a pfsense irc, but you can put in rules to block tcp/udp 53 from inside to outside and only allow it to your internal DNS. | 22:31 |
nimda28 | wich version of the kernel?? | 22:31 |
nimda28 | *which | 22:32 |
erchina | eankele: mm..ok..i'll try | 22:32 |
DaBidM | http://blogs.technet.com/b/seanearp/archive/2007/10/06/windows-server-2008-fine-grained-password-policy-walkthrough.aspx | 22:33 |
erchina | eankele: thx for help | 22:33 |
=== WCCHANDLER is now known as wcchandler | ||
dormito | I recently wiped my ubuntu 12.04(upgraded from 11.x but the upgrade had issues) and installed 12.10. However when ever I set my monitor to 1920x1080 resolution, the left and top edge of the screen are cut off(for example only a fraction of the launcher is displayed). the 12.04 install worked in this mode. I have two radeon hd 5770 cards, but when I try to install the ati driver... I am not really sure how to explain other than it fails and on | 22:33 |
dormito | reboot after loging on, only the background is present(no launcher). I found how to revert this problem. But how can I get 1920x1080 resolution to display properly? (I do not care if its via the open driver or ati's, but it would be kinda nice is the hdmi sound worked as well, which atm are not listed in the sound settings) | 22:33 |
eankele | erchina: very welcome. | 22:34 |
zykotick9 | facu: you might be interested to know what TAB works in IRC for nicknames (makes life A LOT easier) | 22:35 |
facu | zykotick9: haha, I had imagine something xD Thanks a lot bro! | 22:37 |
michele | hola | 22:37 |
nimda28 | dormito: lspci | grep VGA | 22:38 |
nimda28 | hola | 22:38 |
* zykotick9 believe suggesting "lspci | grep -i vga" saves a lot of heartache... | 22:39 | |
dormito | nimda28: http://paste.ubuntu.com/1298795/ | 22:40 |
erictr1ck | zykotick9, sudo apt-get install virtualbox-dkms did the trick | 22:40 |
zykotick9 | erictr1ck: NICE! | 22:40 |
Fishscene | How would I join 2 variables together to form a 3rd variable? For example: "$opt$choice" So that the new variable becomes something like 1hello | 22:42 |
swordz2 | Hi. I've just installed 12.10, and am having some issues with Unity3D. My screen is too wide, and doesn't fit inside a 'box' that Unity3D requires. In 12.04 I could do Unity2D, but I can't in 12.10. Any pointers as to a good way to proceed? | 22:43 |
swordz2 | Fishscene: newvar="$opt$choice" ? | 22:43 |
zykotick9 | swordz2: are you by chance using ati as well? | 22:43 |
swordz2 | zykotick9: I could believe that? | 22:44 |
swordz2 | How can I check? | 22:44 |
zykotick9 | swordz2: "lspci | grep -i vga" | 22:44 |
ItsAllGoneWierd | hi, im trying to use virtualbox, but after i have created the disk it jumps back to the "create-disk" screen (actually called Summary) and nothing has happened..? Whats wrong? | 22:44 |
=== jen is now known as inneedofbigtimeh | ||
swordz2 | zykotick9: Thanks for the help, let me go check - I won't be able to respond while I'm doing so, as my graphical interface is... limited at the moment :p | 22:45 |
inneedofbigtimeh | so what the heck is a 'share' folder, because its almost 100% full and I don't know what it is | 22:45 |
D0minat0r | need help reading about scripting with rsync, i need to backup a folder that has subfolder in need to tar before sending to backup | 22:45 |
swordz2 | zykotick9: Yep, I am. Want the full string? Or is there a generic fix from here... | 22:46 |
zykotick9 | D0minat0r: sidenote/fyi rsync has a gz switch for transfer. need serious cpu hit. | 22:46 |
zykotick9 | swordz2: dormito is having issues after upgrade with ati and "screen are cut off" as well. don't reply to me further, i won't see it. good luck. | 22:47 |
D0minat0r | well i need a bit more advanced, every subfolder need to be gz on its own then sent to backup | 22:47 |
D0minat0r | and next time backup is run it should get last folder it backup up and continue from there if new folders are in mainfolder | 22:48 |
luisgbm | hey guys! I just updated a remote machine of mine to ubuntu 12.10 and VNC access is not working anymore… I have normal SSH access, can anyone please help? | 22:48 |
nimda28 | is the vnc service up??? | 22:49 |
luisgbm | nimda28: I can't run the vino-server from command line, it complains because there is no display... | 22:49 |
nimda28 | yaeh but you have ssh access mo?? | 22:50 |
nimda28 | *no? | 22:50 |
inneedofbigtimeh | anyone? what is a 'share folder' its taking up tons of space on my computer | 22:50 |
luisgbm | nimda28: yes, ssh is normal | 22:50 |
zykotick9 | nimda28: you might want to see "/msg ubottu who" and "/msg ubottu tab" and look for private messages from ubottu. it helps the channel if you use highlights, and we can all see who you are talking too. | 22:50 |
nimda28 | ok :) | 22:51 |
michele | !list | 22:52 |
ubottu | michele: No warez here! This is not a file sharing channel (or network); read the channel topic. If you're looking for information about me, type « /msg ubottu !bot ». If you're looking for a channel, see « /msg ubottu !alis ». | 22:52 |
dr_willis | i wonder how many MB of log we would save a month if we had ubottu msg people the !list factoid. ;) | 22:54 |
zykotick9 | D0minat0r: fyi/sidenote using gz with backups is a bad idea. any part of that file gets corrupt - you loose all of it. not idea situation for a "backup"... | 22:55 |
D0minat0r | zykotick9: ok yeah got that from other people as well, will do normal rsync with no compress | 22:56 |
zykotick9 | D0minat0r: may i PM you? | 22:59 |
Oprr | Hi everyone | 22:59 |
D0minat0r | zykotick9: sure | 23:00 |
Oprr | I want give permission to /var/www what recommend you? | 23:00 |
* Oprr I want write | 23:00 | |
dr_willis | i belive you want to learn to use 'groups' to allow users permission Oprr | 23:01 |
inneedofbigtimeh | guise | 23:03 |
isaac | Does anyone know how to obtain libjpeg.so.8 for 10.x LTS please? | 23:03 |
Oprr | dr_willis: yes, but it is for security reasons? | 23:03 |
crazydip | where do i set default terminal? there's no longer an entry in "default applications" settings panel | 23:03 |
Oprr | or exist other form? | 23:03 |
inneedofbigtimeh | okay what the heck | 23:04 |
inneedofbigtimeh | local>share>files, the files is red but there is nothing there even when I Hit CTRL-H for anything hidden D: | 23:05 |
dr_willis | crazydip: just tap super, or click the big ubutuu button at the top left and type 'term' ;) | 23:05 |
cmatheson | if i change my cursor in dconf-editor (or gnome-tweak-tool), secondary cursors (like the hourglass or finger) change, but my the regular cursor does not. is there something i can do about that? | 23:05 |
dr_willis | cmatheson: ive seen where some times apps that were running befor the change dont use the new cursors. or get confused. | 23:06 |
crazydip | dr_willis: not launch terminal, but set the default terminal application | 23:06 |
isaac | Does anyone know how to obtain libjpeg.so.8 please? | 23:07 |
crazydip | crazydip: it used to be in the settings->details->default applications equivalent settings tab | 23:07 |
crazydip | lol | 23:07 |
crazydip | dr_willis: it used to be in the settings->details->default applications equivalent settings tab | 23:07 |
zykotick9 | cmatheson: personally, i bet, if you using a non-compiz based DE/WM that your cursor changes will work. compiz has had cursor issues forever... | 23:08 |
=== Dreadtower is now known as Breadflour | ||
cmatheson | zykotick9: i'm using mutter | 23:08 |
zykotick9 | cmatheson: then igonore me! sorry, i "guessed" wrong ;) | 23:08 |
cmatheson | haha, that's ok | 23:08 |
ItsAllGoneWierd | If i want to run Mint or BT5 in virtualbox, should I choose Ubuntu or Other Linux? Anyone? | 23:09 |
cmatheson | dr_willis: my cursor won't change in newly started apps either. i had this problem in 12.04 too, but i just ignored it (was hoping it would be fixed in 12.10) | 23:09 |
inneedofbigtimeh | what does it mean when the disk analyzer says firefox is full? How do I free that type of space? | 23:10 |
=== morphis|away is now known as morphis | ||
=== taypeinternation is now known as Guest17422 | ||
Fishscene | How would I join 2 variables together to form a 3rd variable? For example: "$opt$choice" So that the new variable becomes something like "opt1", where var "opt1=HELLO!. swordz2 said "newvar="$opt$choice" , however, It spits out something like "1" or if I mangle it: "$opt1" (it's reading the text, but not interpreting it as a variable and returning "HELLO!" | 23:11 |
deadmund | inneedofbigtimeh: "full"? | 23:11 |
inneedofbigtimeh | deadmund, yeah its all red in the pie chart | 23:11 |
inneedofbigtimeh | oh how do I remove cache or what not | 23:12 |
=== the-other-carif_ is now known as carif1 | ||
inneedofbigtimeh | and yahoo | 23:12 |
Oprr | which is the best idea for give permission to /var/www ? | 23:13 |
michele__ | !list | 23:13 |
ubottu | michele__: No warez here! This is not a file sharing channel (or network); read the channel topic. If you're looking for information about me, type « /msg ubottu !bot ». If you're looking for a channel, see « /msg ubottu !alis ». | 23:13 |
artikanet-48098 | ciao a tutti | 23:13 |
cmatheson | Fishscene: ${opt}${choice} | 23:14 |
bekks | Oprr: Add a specific user to the group that /var/www belongs to. | 23:14 |
zykotick9 | Oprr: in my opinion only! NOT too. having a "services" files be writable seems dangerous to me. | 23:14 |
michele__ | hola | 23:14 |
Fishscene | cmatheson: I'll give it a try. Thanks! | 23:14 |
Oprr | bekks: how can I make it? | 23:15 |
stsmith3 | where can i find tips for debugging cloud-config bootcmd commands | 23:15 |
stsmith3 | or cloud-init in general | 23:15 |
bekks | Oprr: usermod -a should do the job | 23:16 |
bekks | Oprr: Be careful with the -g and -G options | 23:16 |
Oprr | ok then, usermod -a and the directory? | 23:17 |
bekks | Oprr: No. | 23:17 |
Lunar_Lander | hello, I got arduino installed on my ubuntu and I'd need to add a library into usr/share/arduino, but I have no permission to copy into there, what do I need to do? | 23:17 |
bekks | Oprr: usermod -a -g www-data username | 23:17 |
bekks | Oprr: then logout completely, and log in again | 23:18 |
Oprr | ok | 23:18 |
bekks | Oprr: In a second step you may have to adjust the group permissions on /var/www | 23:18 |
Oprr | this did... sudo adduser mynameuser www-data | 23:19 |
Oprr | and after ... sudo chown root.www-data /var/www | 23:20 |
Fishscene | cmatheson: One last question. In "cow=${opt}${choice}", it returns "1", which is "$choice" as "$opt" isn't a variable. What if "opt" was just text and not a variable? For example, I have a variable called "opt1" and I need to combine "opt" with whatever the user types in (in this case "1"). | 23:20 |
Oprr | it is right? | 23:20 |
Oprr | and finally.. sudo chmod g+ws /var/www | 23:20 |
cmatheson | Fishscene: if i'm understanding you correctly, you just want cow=opt${choice} | 23:20 |
cmatheson | $ is for interpolation | 23:21 |
Fishscene | If I change it to "cow=opt${choice}", it echo's "opt1", but doesn't call the variable "$opt1" | 23:21 |
Oprr | maybe the final step it is restart or close the session... | 23:21 |
bekks | Oprr: Wrong... | 23:21 |
Oprr | ok.. | 23:21 |
cmatheson | Fishscene: oh ok, so you want to escape the first $. .. cow="\$opt${choice}" | 23:21 |
bekks | What you did was this: adding your user to www-data; changing permissions of ONLY /var/www to root:www-data | 23:22 |
Fishscene | lol. It returns "$opt1" | 23:22 |
bekks | Oprr: Better solution, give me a minute to type it: | 23:22 |
Oprr | ok | 23:22 |
Oprr | please :) | 23:22 |
diverdude | What is the latest stage i can start the daemon automatically on bootup? | 23:22 |
ooooo | what are the draw backs to using cinnamon? | 23:23 |
Lunar_Lander | hello, I got arduino installed on my ubuntu and I'd need to add a library into usr/share/arduino, but I have no permission to copy into there, what do I need to do? | 23:23 |
cmatheson | Fishscene: do you mean you're trying to get the value of something in a variable called $opt1 ? | 23:23 |
Lunar_Lander | I am the only user on the system | 23:23 |
=== themill_ is now known as themill | ||
Fishscene | cmatheson: Yes. :) | 23:23 |
Oprr | I want do the best way | 23:23 |
bekks | Oprr: sudo chown -R root:www-data /var/www; find /var/www -type d -exec chmod 775 {} \; find /var/www -type f -exec 664 {} \; | 23:23 |
bekks | Oprr: STOP NOW | 23:23 |
diverdude | trism: hey, are you still there mate? | 23:23 |
bekks | Oprr: BEFORE doing it, read this: the above commands will change the ownership of EVERYTHING under /var/www to root:www-data; and grant full access on directories and files under /var/www to the group www-data | 23:24 |
bekks | Oprr: Think twice wether this is what you really want. | 23:25 |
=== ryan is now known as Guest82131 | ||
Oprr | yes.. sound good | 23:25 |
diverdude | What is the latest stage i can start the daemon automatically on bootup? | 23:25 |
cmatheson | Fishscene: eval cow=\$opt${choice} | 23:26 |
sosaguitar | hi folk | 23:26 |
sosaguitar | somebody speak Spanish here? | 23:27 |
zykotick9 | !es | sosaguitar | 23:27 |
ubottu | sosaguitar: En la mayoría de los canales de Ubuntu, se habla sólo en inglés. Si busca ayuda en español entre al canal #ubuntu-es; escriba "/join #ubuntu-es" (sin comillas) y presione intro. | 23:27 |
wachpwnski | Anyone know a good way to setup a CIFS with samba? | 23:27 |
Fishscene | cmatheson: WOOHOO! Thanks! I can only imagine how you dug that information up. Feel free to share if you have a link. I appreciate your assistance. | 23:27 |
cmatheson | Fishscene: http://tldp.org/LDP/abs/html/ivr.html | 23:27 |
Fishscene | Thanks again mate! | 23:27 |
bekks | !samba | wachpwnski | 23:27 |
ubottu | wachpwnski: Samba is the way to cooperate with Windows environments. Links with more info: https://wiki.ubuntu.com/MountWindowsSharesPermanently and https://help.ubuntu.com/12.04/serverguide/C/windows-networking.html - Samba can be administered via the web with SWAT. | 23:27 |
cmatheson | sure thing, good luck | 23:27 |
nishttal2 | Hello ppl.. is there a way to tell Ubuntu to NOT use the graphics card on the server and go thru the on board VGA? | 23:28 |
ejo | You know how you can drag a window to the side edge of a display and have it resize to fill one half of that display... what can I do to fix it if this is leaving a couple of pixels of that window leaking over onto the next display on that side? | 23:29 |
=== viv`d is now known as vivid | ||
ejo | Or actually, it's not leaking from one display onto another, but from one workspace into the next. | 23:30 |
wachpwnski | bekks: can I host swat on apache? | 23:30 |
bekks | wachpwnski: No. swat is independent of a running apache instance. | 23:30 |
bekks | wachpwnski: And thats good, by intent. | 23:30 |
ejo | I have 2x2 workspaces set up, and when I drag a window to auto-resize at the right side of my display on the leftmost workspace, a few pixels of that window are visible on the left side of the right workspace. | 23:30 |
vivid | can we get a current nvidia driver for 12.10? | 23:30 |
bekks | vivid: There is. | 23:31 |
vivid | 310.14 or 304.60 would be great | 23:31 |
vivid | bekks, but..there is not | 23:31 |
Oprr | bekks: in the third command I have a problem | 23:31 |
vivid | in fact the drivers in Q are older than those available in P | 23:31 |
=== sburjan_ is now known as sburjan` | ||
ejo | vivid: at least 12.10 is more nvidia friendly than ati friendly... you should feel lucky | 23:31 |
bekks | vivid: And whats wrong at that point? | 23:31 |
bekks | We have 304.x in the repos. | 23:32 |
vivid | wait what? | 23:32 |
vivid | !info nvidia-current | 23:32 |
ubottu | nvidia-current (source: nvidia-graphics-drivers): NVIDIA binary Xorg driver, kernel module and VDPAU library. In component restricted, is optional. Version 304.43-0ubuntu4 (quantal), package size 37202 kB, installed size 105660 kB (Only available for i386; amd64; lpia) | 23:32 |
bekks | Oprr: ? | 23:32 |
vivid | ^old | 23:32 |
bekks | vivid: Whats wrong, beside "old" in your eyes? | 23:32 |
Oprr | find: «664»: No existe el archivo o el directorio // does not exist the file or directory | 23:32 |
vivid | the current provides fixes and improvements | 23:32 |
vivid | also, experimental package is missing | 23:32 |
bekks | Oprr: find /var/www -type f -exec chmod 664 {} \; | 23:33 |
vivid | and, on the bug report, devs are saying "use the proposed repo and not a ppa" well, you need to provide that stuff to make that a possibility | 23:33 |
diverdude | What is the latest stage i can start the daemon automatically on bootup? | 23:33 |
bekks | vivid: Name one fix/enhancement vital to your environment please. | 23:33 |
vivid | bekks, name one reason to leave old drivers in the release | 23:33 |
bekks | vivid: Stability. | 23:33 |
vivid | bekks, thats what the experimental packages are for. | 23:34 |
vivid | get moving. | 23:34 |
bekks | Ubuntu isnt known as the distro providing the latest avail drivers out there. | 23:34 |
vivid | so revert the ridiculous changes that broke using the nvidia-installer | 23:34 |
Oprr | bekks: now? | 23:34 |
bekks | Oprr: ? | 23:34 |
vivid | and nobody will come here and ask for the packages | 23:34 |
Oprr | I must restart? | 23:34 |
bekks | Oprr: No. | 23:35 |
bekks | vivid: Ubuntu is no rolling-release distro. | 23:35 |
vivid | bekks, and to answer your question: Improved performance and responsiveness of | 23:35 |
vivid | windowed OpenGL applications running inside a | 23:35 |
vivid | Unity session. | 23:35 |
vivid | theres one | 23:35 |
bekks | vivid: I dont see a "vital" reason there. Some "cool to have it", bbut no vital. | 23:36 |
vivid | bekks, go read the bug reports where you made changes to jockey and nvidia-common to provide these packages quickly | 23:36 |
vivid | then, provide them | 23:37 |
Jupiterist | vivid xubuntu install :) | 23:37 |
bekks | vivid: I did not made any changes. And I am not going to provide a package. | 23:37 |
Aufwind | Would someone help me getting grub2 to work? This is the log of boot-repair for my system. http://paste.ubuntu.com/1298853/ | 23:37 |
Oprr | bekks: I still cant paste anything | 23:37 |
vivid | well, then dont knock down what im asking for | 23:37 |
Jupiterist | more fast | 23:37 |
diverdude | What is the latest stage i can start the daemon automatically on bootup? | 23:37 |
vivid | if you have no influence on the situation, it would be great if you remained silent | 23:37 |
Aufwind | At the moment Windows is started without asking me which Operating System I wanna start. | 23:38 |
bekks | vivid: I still got no "vital" reason from you. But however. | 23:38 |
vivid | the vital reason is that valve and users are asking for it | 23:38 |
bekks | Oprr: You did not log out completely and log back in. | 23:38 |
t|4sk | vivid: what's your problem? install them if you want | 23:39 |
vivid | t|4sk, wheres the package? | 23:40 |
t|4sk | vivid: it's not supported by this channel | 23:40 |
vivid | t|4sk, whats not supported by this channel? | 23:41 |
bjrohan | I could get a java plugin on a site to work pre 12.10 update, now it does not detect java on my machine, even though it is there. How do I remove all instances of Java and start fresh? | 23:41 |
Oprr | bekks: Thank you very much! | 23:41 |
t|4sk | vivid: but if you want to liv on the edge... install xedgers ppa unstable .. good luck... but this channel is only support for official packages | 23:42 |
vivid | t|4sk, so wheres the official package. thats what im asking | 23:42 |
Oprr | bekks: everything works fine | 23:42 |
bekks | Oprr: :) | 23:43 |
vivid | t|4sk, they are available in precise.....but not quantal. | 23:43 |
t|4sk | vivid: the official is in 'Settings/Software Packages/additional' | 23:43 |
crazydip | vivid: you may want to contact bryce harrington - supposedly he's working on making bleeding edge video drivers available to ubuntu (he works for Canonical) | 23:43 |
TheRedOctober | Greetings all. I am having a bad time trying to get kerberos up (https://help.ubuntu.com/12.04/serverguide/kerberos-ldap.html). I am currently getting "kadmin.local: No such file or directory while initializing kadmin.local interface" when trying to run kadmin.local. Any ideas what is wrong here? | 23:44 |
=== anonmyous is now known as folorn | ||
bjrohan | How does one go about removing all java | 23:44 |
vivid | crazydip, ill keep that in mind. i dont want to contact him really though. i was just hoping someone had an idea when they would be available. unfortunately, i was met with some hostility | 23:44 |
folorn | could anyone tell me what a person uses again to view webpages thru terminal enviroment? | 23:45 |
t|4sk | vivid: you are asking us to help you to get your system unstable... that's not the purpose of this channel | 23:45 |
folorn | i forget the command to do it or which to get. | 23:45 |
bekks | vivid: My criticism was not ment to be hostile - for the records. | 23:45 |
vivid | t|4sk, are you going to make me show you the bug report? where it was agreed these would be provided? | 23:45 |
vivid | stop bashing me. and just dont say anything if you dont know | 23:45 |
folorn | the help would be great if anyone knows. | 23:45 |
vivid | bekks, thats fine, i suppose its hard to express correctly on the internet :p | 23:46 |
rozmuq | can u pls advice me what to use, 32bit or 64 bit linux? i got e6300 1.86Ghz overclocked to 2.8Ghz and 4GB of Ram. | 23:46 |
diverdude | is rc.local latest upstart file on ubuntu? | 23:46 |
crazydip | folorn: w3m | 23:46 |
t|4sk | vivid: ok. I stop. | 23:46 |
bekks | vivid: I am NOT bashing you. And I am not responsible when you dont like the answers you get. My $.02 | 23:46 |
folorn | whats 23m crazy or how ya do it? | 23:46 |
folorn | oops w3m | 23:46 |
vivid | bekks, the answers you give were literally sidestepping the question. thats not how we make progress | 23:46 |
crazydip | folorn: w3m is a web browser for the terminal, it's what you asked for | 23:47 |
jrib | diverdude: what do you mean? | 23:47 |
folorn | ooh k i see how it works. thanks crazydip :) | 23:47 |
Fishscene | rozmuq: I typically spring for 64-bit linux as most people are moving towards 64-bit. Unless there's a pressing reason to use 32-bit (like your processor doesn't support it, I say go with 64-bit) | 23:47 |
bekks | vivid: We're not making progress in providing official packages for bleeding edge drivers, though. And I am out of this discussion at this point. | 23:47 |
vivid | bekks, theres nothing bleeding about it. | 23:48 |
nimda28 | aptitude remove *** | 23:48 |
t|4sk | bekks: good decision | 23:48 |
vivid | bekks, in fact, you "officially" provide a bleeding/broken driver for quantal | 23:48 |
folorn | Do you do much c and c++ programing at all crazydip? just curious cause im also kinda..well i bought a book and was gonna attempt to learn how to do c and c++ but not sure if codelit is a worth while application ?? | 23:48 |
Jimster480-L | what about a broken driver? | 23:48 |
folorn | anything that you could recommend ? | 23:49 |
diverdude | jrib: : well...its a server i have written which automatically connects to mysql, and a camera connected to the ethernet...so camera and mysql needs to be running already before my server starts | 23:49 |
jrib | diverdude: so use upstart. Weren't you told about upstart earlier? | 23:49 |
ejo | another similar example: the current open-source 'radeon' driver for ATI video is practically unusable on 12.10, I had to reinstall 12.04 so that I could use the proprietary fglrx driver and get reasonable compositing performance. The fallback to software compositing under 12.10 was a completely unacceptable hit to desktop responsiveness in Unity | 23:50 |
diverdude | jrib: yes, and i am using it now | 23:50 |
jrib | diverdude: what's your question? | 23:50 |
crazydip | folorn: no idea what codelit is, if you're asking for a text editor i tend to use vim and gvim, sometimes scribes, but if you're totally new gedit may be ok for you | 23:50 |
diverdude | jrib: but i have tried making it start on runlevel 5 and thats not working. its to early | 23:50 |
Jimster480-L | the open source radeon driver is horrible ejo | 23:51 |
jrib | diverdude: don't use runlevels. Wait for the actual things you want to wait for: i.e. mysql and internet | 23:51 |
jjkinas | ejo: http://ubuntuforums.org/showthread.php?t=2073198 this is how i fixed my 12.10 radeon HD problems | 23:51 |
vivid | bekks, for your reference, this is what i was asking about: https://bugs.launchpad.net/ubuntu/+source/nvidia-common/+bug/1047681 | 23:51 |
diverdude | jrib: ok. how do i do that? | 23:51 |
ubottu | Launchpad bug 1047681 in nvidia-common (Ubuntu) "Add package nvidia-experimental for tracking nvidia beta drivers" [Wishlist,In progress] | 23:51 |
jrib | !upstart | diverdude | 23:52 |
ubottu | diverdude: Upstart is meant to replace the old Sys V Init system with an event-driven init model. For more information please see: http://upstart.ubuntu.com/ | 23:52 |
Jimster480-L | I do agree there have been massive graphics driver issues on 12.10 | 23:52 |
jrib | diverdude: read the cookbook there | 23:52 |
jjkinas | ejo: top of page 2 is how i fixed mine | 23:52 |
Cong | what. I can't paste xml in paste.ubuntu.com. | 23:52 |
diverdude | jrib: ok i know that link but i cannot find how to wait for 2 so specific things | 23:52 |
folorn | not all that new, semi new to programing um i got gedit for doing harder stuff vim still kinda learning just want something good for writing programs simple to use and you can debug and compile codlite is something i got from the software center does all of it but seems semi complicated yet. vims cool also not sure about gvim .. i know what vim is thou | 23:52 |
jrib | diverdude: how about waiting for one thing? | 23:52 |
diverdude | jrib: i dont know which one is later. camera on ethernet or mysql | 23:53 |
ejo | ugh... too late, I'm just sticking with LTS for now | 23:53 |
jrib | diverdude: you haven't answered my question | 23:53 |
ejo | jjkinas: no compiz crashes since your fix? | 23:53 |
jjkinas | not yet | 23:53 |
jrib | diverdude: do you know how to wait for one thing? | 23:53 |
Jimster480-L | folorn: Gedit isnt bad on nix. Most of my development thigns are for Windows | 23:53 |
diverdude | jrib: no | 23:53 |
jrib | diverdude: have you read the cookbook? | 23:53 |
diverdude | jrib: no i did not read those 2000 pages carefully. I have looked through them | 23:54 |
Meris | isaac, why don't you just start a LiveCD of 10.04 and copy the file from that live image to a suitable storage medium? | 23:54 |
jrib | diverdude: you need to read them more closely | 23:54 |
folorn | i agree jimster its really good reminds me of notepad personally just trying to find a all in 1 but simple solution is all | 23:54 |
diverdude | jrib: that will take a year | 23:54 |
crazydip | vivid: just so you know, 304.60 is available in x updates ppa - if you wan't more info on bryce h.: http://www.bryceharrington.org/wordpress/?p=91 AND https://wiki.ubuntu.com/BryceHarrington | 23:55 |
Jimster480-L | folorn: its like Notepad++ on Windows. Which is something I used for all kinds of development | 23:55 |
vivid | crazydip, i saw that, but its not uploaded for quantal as of yet | 23:55 |
jrib | diverdude: no, it won't | 23:55 |
folorn | could you pm me please jimster480-L | 23:56 |
jrib | diverdude: some info at http://upstart.ubuntu.com/getting-started.html may be outdated but that might give you broad overview of what to focus on in the cookbook | 23:56 |
compdoc | is it possible to define a hard drive as /dev/sda, instead of how the bios detects it (detects as sdc now) | 23:56 |
folorn | i had some questions and some personal requests regarding c++ if you know much about it. then and ya i loved writing in notepad++ | 23:56 |
folorn | that was my favorite. | 23:56 |
folorn | thanks everyone for the help. | 23:57 |
t|4sk | Any good CLI MP3 player (with playlist) you would recommend? | 23:57 |
jrib | t|4sk: mpd, cmus | 23:57 |
jrib | t|4sk: mplayer :x | 23:57 |
ejo | jjkinas: I'm on a HD4970 which provides far far more performance than Linux needs and yet ATI considers it legacy/unsupported as if it were obsolete. It's so silly that it would be difficult to find and install correct drivers for a hardware item that still provides cutting-edge performance on this OS. I guess that comes down to AMD basically caring about Windows. | 23:58 |
SolarisBoy | moc | 23:58 |
vivid | crazydip, thanks for that information. ill see if i can spot him on irc and direct my question towards him | 23:58 |
jrib | t|4sk: moc is kind of popular too | 23:58 |
crazydip | vivid: you're right, sorry - i would submit a bug report | 23:58 |
n2diy_ | I upgraded my test box from 12.04 to 12.10, and now X doesn't display correctly, and the mouse isn't working. I can use command line in a console. | 23:59 |
t|4sk | jrib: nice, thanks :) | 23:59 |
gustav__ | t|4sk: mpg321. | 23:59 |
Generated by irclog2html.py 2.7 by Marius Gedminas - find it at mg.pov.lt!